| Basic Information | |
|---|---|
| Family ID | F050712 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 41 residues |
| Representative Sequence | DKSEYDFGFITVKVMKYLGLVKATRTGEEVPKDVPLGALDF |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.17 % |
| % of genes from short scaffolds (< 2000 bps) | 88.97 % |
| Associated GOLD sequencing projects | 124 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.241 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.172 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.172 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.759 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.99% β-sheet: 0.00% Coil/Unstructured: 71.01% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF04116 | FA_hydroxylase | 86.21 |
| PF00106 | adh_short | 0.69 |
| PF08240 | ADH_N | 0.69 |
| PF00202 | Aminotran_3 | 0.69 |
| PF01568 | Molydop_binding | 0.69 |
| PF11218 | DUF3011 | 0.69 |
| PF08818 | DUF1801 | 0.69 |
| PF11188 | DUF2975 | 0.69 |
| PF00326 | Peptidase_S9 | 0.69 |
| PF13358 | DDE_3 | 0.69 |
| PF01850 | PIN | 0.69 |
| PF01926 | MMR_HSR1 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 86.21 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.69 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.24 % |
| Unclassified | root | N/A | 2.76 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000567|JGI12270J11330_10193706 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300000955|JGI1027J12803_105503491 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300000955|JGI1027J12803_108706799 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300001305|C688J14111_10149529 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 718 | Open in IMG/M |
| 3300002568|C688J35102_118523565 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300003203|JGI25406J46586_10163187 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300003224|JGI26344J46810_1001809 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300004156|Ga0062589_101090313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 754 | Open in IMG/M |
| 3300004635|Ga0062388_101807750 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300005332|Ga0066388_101065739 | All Organisms → cellular organisms → Bacteria | 1363 | Open in IMG/M |
| 3300005332|Ga0066388_101235286 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
| 3300005454|Ga0066687_10143630 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300005457|Ga0070662_100154763 | All Organisms → cellular organisms → Bacteria | 1788 | Open in IMG/M |
| 3300005471|Ga0070698_100028209 | All Organisms → cellular organisms → Bacteria | 5832 | Open in IMG/M |
| 3300005526|Ga0073909_10579433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 552 | Open in IMG/M |
| 3300005541|Ga0070733_10250955 | All Organisms → cellular organisms → Bacteria | 1163 | Open in IMG/M |
| 3300005548|Ga0070665_101769360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 625 | Open in IMG/M |
| 3300005563|Ga0068855_100178116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 2404 | Open in IMG/M |
| 3300005563|Ga0068855_102548438 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005578|Ga0068854_101399857 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300005764|Ga0066903_103882633 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300005841|Ga0068863_100195120 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300005842|Ga0068858_101650279 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005843|Ga0068860_102624175 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006041|Ga0075023_100152047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300006086|Ga0075019_10811037 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006102|Ga0075015_100029085 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2507 | Open in IMG/M |
| 3300006163|Ga0070715_10421530 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300006172|Ga0075018_10464636 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006175|Ga0070712_100149497 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300006175|Ga0070712_100359903 | All Organisms → cellular organisms → Bacteria | 1193 | Open in IMG/M |
| 3300006176|Ga0070765_100943720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300006893|Ga0073928_10026743 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5678 | Open in IMG/M |
| 3300006903|Ga0075426_10801041 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300006914|Ga0075436_101431552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300006954|Ga0079219_11204216 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300007788|Ga0099795_10206742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300009088|Ga0099830_11878086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300009090|Ga0099827_10543309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1000 | Open in IMG/M |
| 3300009137|Ga0066709_100618337 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales | 1546 | Open in IMG/M |
| 3300009143|Ga0099792_10750635 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300009143|Ga0099792_10886308 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009174|Ga0105241_10765035 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300009176|Ga0105242_11602574 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300009553|Ga0105249_12960512 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300010335|Ga0134063_10168405 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300010361|Ga0126378_10624309 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300010371|Ga0134125_11270381 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300010373|Ga0134128_11379657 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300010396|Ga0134126_10420076 | All Organisms → cellular organisms → Bacteria | 1551 | Open in IMG/M |
| 3300010396|Ga0134126_12578742 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010400|Ga0134122_11369408 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300011120|Ga0150983_10540394 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300011270|Ga0137391_10935226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300011271|Ga0137393_10880532 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300012202|Ga0137363_10390703 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300012202|Ga0137363_11262309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300012203|Ga0137399_10787656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300012210|Ga0137378_11284820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300012212|Ga0150985_119617038 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300012359|Ga0137385_11160014 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300012683|Ga0137398_10452453 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300012917|Ga0137395_11004821 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300012917|Ga0137395_11256666 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012924|Ga0137413_11505860 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012925|Ga0137419_10227271 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300012930|Ga0137407_10729472 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300012955|Ga0164298_10322288 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300012960|Ga0164301_10307325 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300012984|Ga0164309_10410152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1013 | Open in IMG/M |
| 3300012986|Ga0164304_11576979 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 546 | Open in IMG/M |
| 3300013307|Ga0157372_11340430 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300013503|Ga0120127_10073375 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300014166|Ga0134079_10081764 | All Organisms → cellular organisms → Bacteria | 1200 | Open in IMG/M |
| 3300014325|Ga0163163_12510301 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300014969|Ga0157376_11438349 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300015197|Ga0167638_1092547 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300015374|Ga0132255_101042802 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300016270|Ga0182036_11122668 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 652 | Open in IMG/M |
| 3300017972|Ga0187781_10146850 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300017993|Ga0187823_10236999 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300018433|Ga0066667_10556188 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300018468|Ga0066662_11087000 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 798 | Open in IMG/M |
| 3300018482|Ga0066669_10832984 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300019789|Ga0137408_1301738 | All Organisms → cellular organisms → Bacteria | 1607 | Open in IMG/M |
| 3300019866|Ga0193756_1031291 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300019887|Ga0193729_1024670 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2580 | Open in IMG/M |
| 3300019999|Ga0193718_1051271 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300020140|Ga0179590_1178906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300020579|Ga0210407_11438509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300020580|Ga0210403_10829217 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300020581|Ga0210399_10210418 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300020581|Ga0210399_10448193 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300020582|Ga0210395_11409959 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300021170|Ga0210400_11282725 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300021181|Ga0210388_11015609 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300021406|Ga0210386_11187676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 645 | Open in IMG/M |
| 3300021406|Ga0210386_11419830 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300021407|Ga0210383_10081405 | All Organisms → cellular organisms → Bacteria | 2711 | Open in IMG/M |
| 3300021420|Ga0210394_11462026 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021432|Ga0210384_10703687 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300021432|Ga0210384_11788758 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300021479|Ga0210410_10113482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2398 | Open in IMG/M |
| 3300022557|Ga0212123_10837648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 549 | Open in IMG/M |
| 3300025901|Ga0207688_11029548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 520 | Open in IMG/M |
| 3300025914|Ga0207671_11549170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300025915|Ga0207693_10288844 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
| 3300025916|Ga0207663_10278899 | All Organisms → cellular organisms → Bacteria | 1241 | Open in IMG/M |
| 3300025919|Ga0207657_10853734 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300025949|Ga0207667_12005072 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300026515|Ga0257158_1004293 | All Organisms → cellular organisms → Bacteria | 1928 | Open in IMG/M |
| 3300026515|Ga0257158_1051511 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300026557|Ga0179587_10407064 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300027065|Ga0208489_1006902 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300027174|Ga0207948_1046564 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300027590|Ga0209116_1020135 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300027698|Ga0209446_1180587 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300027812|Ga0209656_10432492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 585 | Open in IMG/M |
| 3300027853|Ga0209274_10253287 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300027867|Ga0209167_10301369 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300027875|Ga0209283_10014210 | All Organisms → cellular organisms → Bacteria | 4768 | Open in IMG/M |
| 3300027879|Ga0209169_10001271 | All Organisms → cellular organisms → Bacteria | 15311 | Open in IMG/M |
| 3300027898|Ga0209067_10214056 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300027898|Ga0209067_10290763 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300029636|Ga0222749_10185437 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300030842|Ga0075404_11137324 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300031057|Ga0170834_109494457 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300031090|Ga0265760_10084378 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300031231|Ga0170824_111815633 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031231|Ga0170824_119453955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 893 | Open in IMG/M |
| 3300031474|Ga0170818_100268111 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
| 3300031525|Ga0302326_10309032 | All Organisms → cellular organisms → Bacteria | 2519 | Open in IMG/M |
| 3300031722|Ga0311351_10358270 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300031962|Ga0307479_10060268 | All Organisms → cellular organisms → Bacteria | 3657 | Open in IMG/M |
| 3300031962|Ga0307479_10574513 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300032174|Ga0307470_11160086 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300032205|Ga0307472_100546570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1010 | Open in IMG/M |
| 3300032783|Ga0335079_11161108 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300032893|Ga0335069_11023622 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300032955|Ga0335076_10577211 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300033158|Ga0335077_11312171 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.21% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.14% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.76% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.07% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.07% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.69% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.69% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.69% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300003224 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011406 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT539_2 | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019866 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1m1 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027065 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF006 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030842 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OB3 SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12270J11330_101937062 | 3300000567 | Peatlands Soil | LRLSHDKSEYDFGFLTIKVMKGLGLVKATPRGELIPADVPLRALDF* |
| JGI1027J12803_1055034912 | 3300000955 | Soil | KSEYDFGFVTVKVMKYLGLVKATRTGAELPKDVLLGALNF* |
| JGI1027J12803_1087067992 | 3300000955 | Soil | LSHDDTEYDFGFLTVKVMRSLGLVKATSRGEKIPHDVPLGALGF* |
| C688J14111_101495292 | 3300001305 | Soil | GILRLSHDETEYDFGFLTVKVMKALGLVKATARGETIPEDVPLNALGF* |
| C688J35102_1185235651 | 3300002568 | Soil | HHESEYDFGFITVKFMKLFGLVKATSKGAELPKDVPLGVLDF* |
| JGI25406J46586_101631872 | 3300003203 | Tabebuia Heterophylla Rhizosphere | RLSHDESEYDFGFTTVKLMKALGLVQATRKGAEIPKDVPLKSLNF* |
| JGI26344J46810_10018092 | 3300003224 | Bog Forest Soil | DKSEYDFGFITVKFMKLLGVVKATKKGAELPEDVPLGALEF* |
| Ga0062589_1010903132 | 3300004156 | Soil | ESEYDFGFLTVKVMKSLGLVKATIVGQKIPEDVALTALGS* |
| Ga0062388_1018077502 | 3300004635 | Bog Forest Soil | LRLSHDKSEYDFGFITVKVMKRLGLVKATRSGAEIPKDVPLDALGF* |
| Ga0066388_1010657391 | 3300005332 | Tropical Forest Soil | LSHDNSEYDFGFLTVKAMKHLGLVKATRKGAEMPKDVPLDALGF* |
| Ga0066388_1012352862 | 3300005332 | Tropical Forest Soil | SHDNSEYDFGFLTVKVMKRLGLVKATASGAQLPKDVPLAALGF* |
| Ga0066687_101436301 | 3300005454 | Soil | SHDKSEYDFGFITVKVMKHLGLVKATNTGAQLPKDVPLDALGF* |
| Ga0070662_1001547633 | 3300005457 | Corn Rhizosphere | LRLSHDESEYDFGLLTVRVMKYLGLVKATTRGAIVPHDVSLDVLGF* |
| Ga0070698_1000282094 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | SHDKSEYDFGLATVKFMKYFGLVKATTKGAELPKDVPLGELNF* |
| Ga0073909_105794331 | 3300005526 | Surface Soil | HDKSEYDFGFLTVKLMKLFGLVKATATGAQLPKDVPLGALDF* |
| Ga0070733_102509551 | 3300005541 | Surface Soil | SHDKSEYDFGFITVKIMKTLGLVKATRKGAELPKDVPLAALEF* |
| Ga0070665_1017693601 | 3300005548 | Switchgrass Rhizosphere | SHDKSEYDFGFLTVKLMKLFGLVKATATGAQLPKDVPLGALDF* |
| Ga0068855_1001781161 | 3300005563 | Corn Rhizosphere | SHDKSEYDFGFLTVKVMKYLGLVKATKTGEEVPKDVPFALEF* |
| Ga0068855_1025484382 | 3300005563 | Corn Rhizosphere | FGFLTVKVLKNLGLVTATAKGEEIPKDVPLAALDF* |
| Ga0068854_1013998571 | 3300005578 | Corn Rhizosphere | GFVTVKVMKYLGLVKASRTGAEVPNDVPLGTLEF* |
| Ga0066903_1038826332 | 3300005764 | Tropical Forest Soil | RLSHDESEYDFGFLAIKAMKRLGLVRATRTGAELPKDVALASLNF* |
| Ga0068863_1001951203 | 3300005841 | Switchgrass Rhizosphere | RLSHDESEYDFGFLTVKVMKSFGLVKATSRGEIIPNDVPLDALGF* |
| Ga0068858_1016502792 | 3300005842 | Switchgrass Rhizosphere | LSHDKSEYDFGFVTVKVMKYLGLVKASRTGAEVPKDVPLGALEF* |
| Ga0068860_1026241752 | 3300005843 | Switchgrass Rhizosphere | FGFLTVKVMKSLGLVKASSTGALVPKDVPLEALDF* |
| Ga0075023_1001520471 | 3300006041 | Watersheds | LRLSHDKSEYDFGFVTVKLMKYLGLVKATRTGAALPTDVPLGALDF* |
| Ga0075019_108110371 | 3300006086 | Watersheds | EYDFGFITVKVMKYLGLVKATRTGAEIPKDVALDALGF* |
| Ga0075015_1000290851 | 3300006102 | Watersheds | LRLSHDKSEYDFGFVTVKFMKYLGLVKATRTGEEVPKDAPLGALDF* |
| Ga0070715_104215301 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | SHDKSEYDFGFVTVKVMKYLGLVQASRTGAEVPNDVPLGALEF* |
| Ga0075018_104646362 | 3300006172 | Watersheds | LRLSHDKSEYDFGFLTVKLMKSWGLVNATTKGEELPKDVPLGALDF* |
| Ga0070712_1001494971 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SEYDFGFMTVKVMKYLGLVKATKTGEQVPRDVPLGTLDF* |
| Ga0070712_1003599031 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EYDFGFLTVKVLKNLGLVTATAKGEEIPKDVPLAALDF* |
| Ga0070765_1009437202 | 3300006176 | Soil | DKSEYDFGFVTVKLMKYFGLVKATTKGAELPKGVPLGALDF* |
| Ga0073928_100267438 | 3300006893 | Iron-Sulfur Acid Spring | LRLSHDSSEYDFGFITVKFMKGLGLVKATKKGAELPEDVPLGALEF* |
| Ga0075426_108010411 | 3300006903 | Populus Rhizosphere | FGFLTVKVMKHLGLVKATKTGEELPHDVPLRALDF* |
| Ga0075436_1014315522 | 3300006914 | Populus Rhizosphere | SHDESEYDFGFMTVKVMKYLGLVKATTTGEQVPKDVPLAALDF* |
| Ga0079219_112042162 | 3300006954 | Agricultural Soil | DFGFLTVKVMKRLGLVKATKTGEELPKDVPLGALGF* |
| Ga0099795_102067421 | 3300007788 | Vadose Zone Soil | YDFGFVTVKIMKYFGLVKATTRGADLPNDVPLGALNF* |
| Ga0099830_118780862 | 3300009088 | Vadose Zone Soil | SEYDFGFVTVKLMKYFGLVKATRTGEEVPKDVPLGALDF* |
| Ga0099827_105433092 | 3300009090 | Vadose Zone Soil | DFGFVTVKLMKDLGLVKATKTGAEIPKDVRLDALGF* |
| Ga0066709_1006183371 | 3300009137 | Grasslands Soil | DEEYDFGFITVKAMKALGLVKATSTGMQIPKEVPLQAVGF* |
| Ga0099792_107506351 | 3300009143 | Vadose Zone Soil | LSHDKSEYDFGFITVKVMKHLGLVKATNTGAQLPKDVPLDALGF* |
| Ga0099792_108863082 | 3300009143 | Vadose Zone Soil | DFGVVTVKIMKYFGLVRATRTGEEMPKDVPLGALDF* |
| Ga0105241_107650351 | 3300009174 | Corn Rhizosphere | GFLTVKVMKSLGLVKASSTGALVPKDVPLEALDF* |
| Ga0105242_116025741 | 3300009176 | Miscanthus Rhizosphere | DFGFLTVKVMRSLGLVTATRSGAEIPKDIPLDALGF* |
| Ga0105249_129605121 | 3300009553 | Switchgrass Rhizosphere | RLSHDESEYDFGFLMVKVMKALGLVKATSTGAELPQDAPLKALNF* |
| Ga0134063_101684052 | 3300010335 | Grasslands Soil | FGFLTVKVMKALGLVKATARGETIPNDVPLEALGF* |
| Ga0126378_106243092 | 3300010361 | Tropical Forest Soil | YDFGFLTVRAMKSLGLVKATITGTQIPRDVPLDALNF* |
| Ga0134125_112703812 | 3300010371 | Terrestrial Soil | SEYDFGFATVKVMKYFGLVKATRTGEVVPKDVPLGALDF* |
| Ga0134128_113796571 | 3300010373 | Terrestrial Soil | KSEYDFGFVTVKVMKYVGLVKATRTGEDLPKDVPLGALDF* |
| Ga0136847_135186392 | 3300010391 | Freshwater Sediment | GVSHHPAEYDFGFLTVRAFRALGLVTTSSTGRHLPNDVPLAELGL* |
| Ga0134126_104200762 | 3300010396 | Terrestrial Soil | LRLSHDESEYDFGFLTVKVLKNLGLVTATAKGEEIPKDVPLAALDF* |
| Ga0134126_125787421 | 3300010396 | Terrestrial Soil | SEYDFGFLTVKVMKSFGLVKATARGEKIPADVPLAALGF* |
| Ga0134122_113694082 | 3300010400 | Terrestrial Soil | LRLSHDESEYDFGFLMVKVMKALGLVKATGTGAELPQDVPLKALNF* |
| Ga0150983_105403942 | 3300011120 | Forest Soil | DNSEYDFGFLTVRVMKQVGLVKATATGAQLPKDVPLNALDF* |
| Ga0137391_109352261 | 3300011270 | Vadose Zone Soil | FGFVTVKVMKYLGLVKATKTGEQLPKDVPLGALEF* |
| Ga0137393_108805322 | 3300011271 | Vadose Zone Soil | SHDKSEYDFGFLTVKLMKHLGLVKATSTGATLPKDVPLGALDF* |
| Ga0137454_10138773 | 3300011406 | Soil | LRLSHDPAEYDLGFLTVRCMKALGLVRPSRTGAQLPHDFPLKDLGF* |
| Ga0137363_103907031 | 3300012202 | Vadose Zone Soil | LSHDKSEYDFGFLTVKVMKHLGLVKATSTGATLPKDVPLDALGF* |
| Ga0137363_112623091 | 3300012202 | Vadose Zone Soil | LSHDKSEYDFGFVTVKVMKYFGLVKATRTGEEVPKDVPLGALDF* |
| Ga0137399_107876562 | 3300012203 | Vadose Zone Soil | LSHDKSEYDFGFITVKVMKYLGLVKATRTGAEIPKDVPLDALGF* |
| Ga0137378_112848201 | 3300012210 | Vadose Zone Soil | SHDKSEYDFGFITVKVMKYLGLVKATRTGEELPKDVPLGALGF* |
| Ga0150985_1196170381 | 3300012212 | Avena Fatua Rhizosphere | SEYDFGFLTVKVMKALGLVKATTRGETIPEDVPLGALGF* |
| Ga0137385_111600141 | 3300012359 | Vadose Zone Soil | LSHDKSEYDFGFVTVKLMKYLGLVKATRTGAEIPKDVPLDALGF* |
| Ga0137398_104524531 | 3300012683 | Vadose Zone Soil | RLSHEKSEYDFGFVTVKLMKYLGLVKATKTGEEMPKDVPLGALDF* |
| Ga0137395_110048211 | 3300012917 | Vadose Zone Soil | KSEYDFGFVTVKVMKYFGLVKATRTGEEMPKDVPLGALDF* |
| Ga0137395_112566662 | 3300012917 | Vadose Zone Soil | EYDFGFVTVKLMKYFGLVKATTRGAELPNDVPLGALNF* |
| Ga0137413_115058601 | 3300012924 | Vadose Zone Soil | YDFGFVTVKLMKYFGLVKATTNGAELPKDVPLDALNF* |
| Ga0137419_102272713 | 3300012925 | Vadose Zone Soil | FGFVTVKVMKYFGLVKATRTGEEVPKGVPLGALDF* |
| Ga0137407_107294721 | 3300012930 | Vadose Zone Soil | FGFLTVKVMKALGLVKATVTGAQLPKDVPLGALEF* |
| Ga0164298_103222882 | 3300012955 | Soil | DFGFVTVKVMKYLGLVKASRTGAEVPKDVPLGALEF* |
| Ga0164301_103073251 | 3300012960 | Soil | DESEYDFGFLTVRVMKCLGLVKATTRGAIVPHDVSLDVLGF* |
| Ga0164309_104101522 | 3300012984 | Soil | LSHDKSEYDFGFVTVKLMKYLGLVKATTKGAELPHDVPLRALDF* |
| Ga0164304_115769791 | 3300012986 | Soil | ESEYDFGFLTVKVMKYFGLVKSTTRGETIPKDVSLSALGF* |
| Ga0157372_113404302 | 3300013307 | Corn Rhizosphere | YDFGFLTVRVMKCLGLVKATTRGAIVPHDVSLDVLGF* |
| Ga0120127_100733752 | 3300013503 | Permafrost | SHDKSEYDFGFITVKVMKYLGLVKATRTGAEIPRDVPLDALGF* |
| Ga0134079_100817641 | 3300014166 | Grasslands Soil | LSHDKSEYDFGFITVKAMKYLGLVKATNTGAQLPKDVPLDALGF* |
| Ga0163163_125103012 | 3300014325 | Switchgrass Rhizosphere | SEYDFGFVTVKVMKYLGLVKASRTGAEVPKDVPLGALEF* |
| Ga0157376_114383492 | 3300014969 | Miscanthus Rhizosphere | FLRLSHDKSEYDFGLVTVKTMKYLGLVSATAKGAEIPKDVPLTSLNF* |
| Ga0167638_10925471 | 3300015197 | Glacier Forefield Soil | DKSEYDFGFVTVKLMKYLGLVKATAKGAELPEDVPLGALDF* |
| Ga0132255_1010428022 | 3300015374 | Arabidopsis Rhizosphere | DFGFLTVKVMKSLGLVKASSTGALVPKDVPLEALDF* |
| Ga0182036_111226682 | 3300016270 | Soil | FGFLTVKVMKSLGLVQATTTGAHIPTDVSLDALNF |
| Ga0187781_101468501 | 3300017972 | Tropical Peatland | FGFVTVKFLKRLGLVKATARGEQIPADVRLAALDF |
| Ga0187823_102369991 | 3300017993 | Freshwater Sediment | ESEYDFGFITVKAMKHLGLVKATTRGAELPNDVPLGALNF |
| Ga0066667_105561881 | 3300018433 | Grasslands Soil | FGFLTVKVMKSLGLVKASSTGVLVPKDVPLEALDF |
| Ga0066662_110870002 | 3300018468 | Grasslands Soil | YDFGFLTVKVMKALGLVKATTRGESIPEDVPLGALGF |
| Ga0066669_108329841 | 3300018482 | Grasslands Soil | SEYDFGFITVKVMKHLGLVKATNTGAQLPKDVPLDALGF |
| Ga0137408_13017381 | 3300019789 | Vadose Zone Soil | HDKSEYDFGFITVKVMKHLGLVKATNTGAQLPKDVPLDALGF |
| Ga0193756_10312912 | 3300019866 | Soil | YDFGFLTVKVMKSLGLVKASSTGALVPKDVPLEALDF |
| Ga0193727_11366661 | 3300019886 | Soil | HDPAEYDFGFLTVRCMKALGLVRASRTGAQLPKDVPLQDLGF |
| Ga0193729_10246704 | 3300019887 | Soil | RLSHDESEYDFGFVTVKIMKHFGLVKATTKGAELPKDVPLGALDF |
| Ga0193718_10512712 | 3300019999 | Soil | HEKSEYDFGFITVKAMKYLGLVKATSTGAEIPEDVALDALGF |
| Ga0179590_11789061 | 3300020140 | Vadose Zone Soil | DQSEYDFGFATVKIMKYFGLVKATTRGADLPNDVPLGALNF |
| Ga0210407_114385091 | 3300020579 | Soil | LSHDKSEYDFGFVTVKLMKYFGLVKATRTGAELPKDVPLGALDF |
| Ga0210403_108292172 | 3300020580 | Soil | KSEYDFGFITVKVMKYLGLVKATRKGAELPSDVPLGALEF |
| Ga0210399_102104181 | 3300020581 | Soil | LSHDESEYDFGFITVKVMKYLGLVKATRTGEEVPKDVPFGVLDF |
| Ga0210399_104481932 | 3300020581 | Soil | SEYDFGFLTVKVMKYLGLVKATARGEIVPGDVPLDALGF |
| Ga0210395_114099592 | 3300020582 | Soil | LRLSHDKSEYDFGFLTVKVMKYLGLVKATRTGEEIPKDVPLGALDF |
| Ga0210400_112827251 | 3300021170 | Soil | LSHDESEYDFGFLTVKVVKYLGVVKATTRGETIPNEVPLAALDF |
| Ga0210388_110156092 | 3300021181 | Soil | RLSHHESEYDFGFLTVKVMKAFGLVRATARGREVPKDVPLAALNF |
| Ga0210386_111876761 | 3300021406 | Soil | LRLSHDKSEYDFGFITVKVMKYLGLVKATSTGAHMPKDVPLGALGF |
| Ga0210386_114198302 | 3300021406 | Soil | DESEYDFGFLTVKVMKRLGLVKATGRGEIVPNDVPLAALDF |
| Ga0210383_100814051 | 3300021407 | Soil | LSHDNSEYDFGFLTVKVMKQIGLVKATATGAQLPKDVPLDALDF |
| Ga0210394_114620261 | 3300021420 | Soil | FGFLTVKVMKSLGLVKATARGVDLPKDVPLGALEF |
| Ga0210384_107036872 | 3300021432 | Soil | EYDFGFLTVKVMKHLGLVKATTRGEKIPHDVPLEALGF |
| Ga0210384_117887582 | 3300021432 | Soil | DKSEYDFGFITVKVMKYLGLVKATRTGEEVPKDVPLGALDF |
| Ga0210410_101134823 | 3300021479 | Soil | EYDFGFITVKVMKYLGLVKATRTGAEIPKDIPLDALGF |
| Ga0212123_108376481 | 3300022557 | Iron-Sulfur Acid Spring | YDFGFVTVKLMKYCGLVKATTKGAELPKDVPLNALNF |
| Ga0207688_110295482 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | EYDFGFLTVKVMKYFGLVKSTTRGETIPKDVPLSALGF |
| Ga0207671_115491702 | 3300025914 | Corn Rhizosphere | HHYPGILRLSHDKSEYDFGFATVKVMKYLGLVKATRTGADVPRDVPLGALDF |
| Ga0207693_102888441 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | EYDFGFLTVKVLKNLGLVTATAKGEEIPKDVPLAALDF |
| Ga0207663_102788992 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | SHDNSEYDFGFLTVKLMKYLGLVKATRKGEELPKDVPLDALGF |
| Ga0207657_108537342 | 3300025919 | Corn Rhizosphere | EYDFGFITVKAMKALGLVKATSTGLQIPKEVPLQAVGF |
| Ga0207667_120050722 | 3300025949 | Corn Rhizosphere | FGFLTVKVLKNLGLVTATAKGEEIPKDVPLAALDF |
| Ga0257158_10042931 | 3300026515 | Soil | RLSYDKSEYDFGFVTVKLMKYFGLLKATTKGAELPKDVPLDALNF |
| Ga0257158_10515112 | 3300026515 | Soil | LRLSHDESEYDFGFVTVKLMKYFGLVKATTKGAELPKDVPLGALDF |
| Ga0179587_104070642 | 3300026557 | Vadose Zone Soil | HEKSEYDFGFITVKVMKTLGLVKATSTGAQIPKDIPLDALGF |
| Ga0208489_10069021 | 3300027065 | Forest Soil | SHDKSEYDFGFVTVRLMKYFGLVKATRTGAELPKDVPLGALDF |
| Ga0207948_10465642 | 3300027174 | Forest Soil | RLSHDKSEYDFGFITVKVMKYLGLVKATSTGAQLPKDVPLDALGF |
| Ga0209116_10201352 | 3300027590 | Forest Soil | EYDFGFLTVKVMKYLGLVKATTRGETIPKDVPLAALDF |
| Ga0209446_11805872 | 3300027698 | Bog Forest Soil | HHESEYDFGFLTVKAMKNFGLVKATPNGARMPKDVPLVGLDF |
| Ga0209656_104324921 | 3300027812 | Bog Forest Soil | RLSHDNSEYDFGFLTVKLMKQLGLVRATRKGQELPKDLPLDALGF |
| Ga0209274_102532872 | 3300027853 | Soil | LRLSHDKSEYDFGFVTVKVMKSWGLVKATARGASIPADIPLGGLGF |
| Ga0209167_103013691 | 3300027867 | Surface Soil | HDNSEYDFGFLTVKFMKQLGLVQATRKGQELPKDVPLEALGF |
| Ga0209283_100142104 | 3300027875 | Vadose Zone Soil | DKSEYDFGFVTVKLMKYFGLVKATRTGEEVPKDVPLGALDF |
| Ga0209169_100012711 | 3300027879 | Soil | LRLSHHESEYDFGFLTVKVMKAFGLVRATARGREVPKDVPLAALNF |
| Ga0209067_102140561 | 3300027898 | Watersheds | FGFITVKVMKYLGLVKATSTGGQLPKDVPLDALGF |
| Ga0209067_102907632 | 3300027898 | Watersheds | EYDFGFITVKVMKYLGLVKATRTGAEIPKDVALDALGF |
| Ga0222749_101854371 | 3300029636 | Soil | EYDFGFLTVKVMKQIGLVKATSTGTQLPKDVPLDALDF |
| Ga0075404_111373241 | 3300030842 | Soil | DFGFVTVKIMKHFGLVKATTKGAELPKDVSLGALNF |
| Ga0170834_1094944572 | 3300031057 | Forest Soil | HDDSEYDFGFLTVKVMKNLGLVKATRKGAELPKDVPLGALDF |
| Ga0265760_100843782 | 3300031090 | Soil | SEYDFGFVTVKIMKALGLVKATARGVDVPNDVPLGALEF |
| Ga0170824_1118156332 | 3300031231 | Forest Soil | RLSHEKSEYDFGFITVKAMKYLGLVKATRTGAEIPKDVALEALGF |
| Ga0170824_1194539552 | 3300031231 | Forest Soil | FGFVTVKAMKYFGLVKATKKGEELPADVPLGALDF |
| Ga0170818_1002681111 | 3300031474 | Forest Soil | DKSEYDFGFVTVKAMKRLGLVQATTKGKELPKDVPLGALEF |
| Ga0302326_103090321 | 3300031525 | Palsa | LRLSHDESEYDFGFLTVKVMKGLGLVNATARGELKPPDVPLAALDF |
| Ga0311351_103582702 | 3300031722 | Fen | EYDFGFIAVKAMKAMGLVKATRTGLEIPQDVPLASLGF |
| Ga0307479_100602685 | 3300031962 | Hardwood Forest Soil | LRLSHDESEYDFGFITVKVMKYLGLVKATRTGEEVPKDVPFGALDF |
| Ga0307479_105745131 | 3300031962 | Hardwood Forest Soil | LRLSHDESEYDFGFITVKVMKYLGLVKATRTGEEVPKDVPFGVLDF |
| Ga0307470_111600862 | 3300032174 | Hardwood Forest Soil | HDESEYDFGFITVKVMKYLGLVKATRTGEDVPKGVPFGALEF |
| Ga0307471_1029637543 | 3300032180 | Hardwood Forest Soil | DLGFLTVRGLKALGLVRPTRTGAQLPKDFPLRDLGF |
| Ga0307472_1005465701 | 3300032205 | Hardwood Forest Soil | DKSEYDFGFLTVKLMKYVGLVKATTKGAELPKDVPLGTLDF |
| Ga0335079_111611082 | 3300032783 | Soil | HDESEYDFGFLTVKLMKQLGLVKASKHGAELPKDVPLGALDF |
| Ga0335069_110236221 | 3300032893 | Soil | LSHDESEYDFGFLTVKVMKAFGLVKASPRGEIVPQDVPLSALDF |
| Ga0335076_105772112 | 3300032955 | Soil | DESEYDFGFLTVKFMKSLGLVKASRHGAELPKDVPLGAIDF |
| Ga0335077_113121711 | 3300033158 | Soil | LRLSHDESEYDFGFLTVKLMKQLGLVKASKHGADLPKDVPLGALDF |
| ⦗Top⦘ |