| Basic Information | |
|---|---|
| Family ID | F050693 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 46 residues |
| Representative Sequence | ADAHMELALEKAFLAVACEQMDQTVEGFKKKHAGGPRTRRSKPTRS |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 95.17 % |
| % of genes from short scaffolds (< 2000 bps) | 97.24 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (56.552 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil (12.414 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (38.621 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.49% β-sheet: 0.00% Coil/Unstructured: 63.51% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF13683 | rve_3 | 31.03 |
| PF00665 | rve | 24.14 |
| PF01435 | Peptidase_M48 | 0.69 |
| PF13482 | RNase_H_2 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 24.14 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 24.14 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 24.14 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 24.14 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 56.55 % |
| All Organisms | root | All Organisms | 43.45 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_11725504 | Not Available | 549 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108269704 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300004007|Ga0055476_10306308 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300004013|Ga0055465_10299348 | Not Available | 553 | Open in IMG/M |
| 3300004643|Ga0062591_100515366 | Not Available | 1031 | Open in IMG/M |
| 3300005219|Ga0069004_10032008 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
| 3300005332|Ga0066388_106361597 | Not Available | 596 | Open in IMG/M |
| 3300005439|Ga0070711_100319151 | Not Available | 1241 | Open in IMG/M |
| 3300005830|Ga0074473_10337991 | Not Available | 502 | Open in IMG/M |
| 3300005830|Ga0074473_10684387 | Not Available | 524 | Open in IMG/M |
| 3300005836|Ga0074470_10273777 | Not Available | 1161 | Open in IMG/M |
| 3300006055|Ga0097691_1071598 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300006163|Ga0070715_11018821 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300006224|Ga0079037_102174095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 554 | Open in IMG/M |
| 3300006237|Ga0097621_102266141 | Not Available | 520 | Open in IMG/M |
| 3300006903|Ga0075426_10971588 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006914|Ga0075436_100145779 | All Organisms → cellular organisms → Bacteria | 1665 | Open in IMG/M |
| 3300006930|Ga0079303_10539675 | Not Available | 506 | Open in IMG/M |
| 3300009131|Ga0115027_10661293 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300009131|Ga0115027_11444048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 562 | Open in IMG/M |
| 3300009153|Ga0105094_10306567 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
| 3300009175|Ga0073936_10278278 | Not Available | 1104 | Open in IMG/M |
| 3300009523|Ga0116221_1240315 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300009644|Ga0116121_1138603 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
| 3300009789|Ga0126307_10965360 | Not Available | 689 | Open in IMG/M |
| 3300009840|Ga0126313_11492096 | Not Available | 561 | Open in IMG/M |
| 3300010045|Ga0126311_11769740 | Not Available | 523 | Open in IMG/M |
| 3300010333|Ga0134080_10487938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 584 | Open in IMG/M |
| 3300011415|Ga0137325_1121157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300012171|Ga0137342_1045766 | Not Available | 874 | Open in IMG/M |
| 3300012210|Ga0137378_10266372 | Not Available | 1594 | Open in IMG/M |
| 3300012361|Ga0137360_10378766 | Not Available | 1189 | Open in IMG/M |
| 3300012361|Ga0137360_10486343 | Not Available | 1049 | Open in IMG/M |
| 3300012685|Ga0137397_11149176 | Not Available | 562 | Open in IMG/M |
| 3300012944|Ga0137410_11113679 | Not Available | 676 | Open in IMG/M |
| 3300013297|Ga0157378_12014067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 627 | Open in IMG/M |
| 3300013306|Ga0163162_12462957 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Puniceicoccus → Puniceicoccus vermicola | 598 | Open in IMG/M |
| 3300014312|Ga0075345_1100773 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300014490|Ga0182010_10282457 | Not Available | 888 | Open in IMG/M |
| 3300014498|Ga0182019_11083624 | Not Available | 585 | Open in IMG/M |
| 3300014502|Ga0182021_11210686 | Not Available | 910 | Open in IMG/M |
| 3300015167|Ga0167661_1048041 | Not Available | 801 | Open in IMG/M |
| 3300015357|Ga0134072_10194842 | Not Available | 697 | Open in IMG/M |
| 3300016270|Ga0182036_11142611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
| 3300018051|Ga0184620_10052823 | Not Available | 1148 | Open in IMG/M |
| 3300018051|Ga0184620_10114162 | Not Available | 845 | Open in IMG/M |
| 3300020004|Ga0193755_1070601 | Not Available | 1128 | Open in IMG/M |
| 3300021069|Ga0194062_1069785 | Not Available | 1098 | Open in IMG/M |
| 3300021086|Ga0179596_10191879 | Not Available | 992 | Open in IMG/M |
| 3300021344|Ga0193719_10264146 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300021403|Ga0210397_10961458 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300021479|Ga0210410_11658297 | Not Available | 533 | Open in IMG/M |
| 3300024178|Ga0247694_1010636 | Not Available | 1095 | Open in IMG/M |
| 3300024186|Ga0247688_1049425 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300024219|Ga0247665_1008448 | Not Available | 1141 | Open in IMG/M |
| 3300024246|Ga0247680_1014787 | Not Available | 1136 | Open in IMG/M |
| 3300024254|Ga0247661_1068424 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300024284|Ga0247671_1016273 | Not Available | 1111 | Open in IMG/M |
| 3300024323|Ga0247666_1123215 | Not Available | 515 | Open in IMG/M |
| 3300025457|Ga0208850_1063069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 606 | Open in IMG/M |
| 3300025482|Ga0208715_1032941 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300025619|Ga0207926_1021081 | All Organisms → cellular organisms → Bacteria | 2051 | Open in IMG/M |
| 3300025916|Ga0207663_11696388 | Not Available | 508 | Open in IMG/M |
| 3300025980|Ga0210137_1075922 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300026057|Ga0208294_1023013 | Not Available | 709 | Open in IMG/M |
| 3300026322|Ga0209687_1142699 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300026463|Ga0256815_1014846 | Not Available | 811 | Open in IMG/M |
| 3300027805|Ga0209229_10332545 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300027812|Ga0209656_10179249 | Not Available | 1041 | Open in IMG/M |
| 3300027869|Ga0209579_10820356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
| 3300027875|Ga0209283_10564650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 725 | Open in IMG/M |
| 3300027877|Ga0209293_10135353 | Not Available | 1157 | Open in IMG/M |
| 3300027890|Ga0209496_10204123 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300028145|Ga0247663_1055119 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300028563|Ga0265319_1223199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 576 | Open in IMG/M |
| 3300028754|Ga0307297_10070101 | Not Available | 1113 | Open in IMG/M |
| 3300028876|Ga0307286_10187159 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300029442|Ga0239579_1025638 | Not Available | 989 | Open in IMG/M |
| 3300029944|Ga0311352_10760496 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300029984|Ga0311332_10504590 | Not Available | 949 | Open in IMG/M |
| 3300029984|Ga0311332_11510736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300029998|Ga0302271_10441305 | Not Available | 563 | Open in IMG/M |
| 3300030294|Ga0311349_10687088 | Not Available | 966 | Open in IMG/M |
| 3300030503|Ga0311370_11667964 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300030524|Ga0311357_10672058 | Not Available | 944 | Open in IMG/M |
| 3300030580|Ga0311355_11222411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300031226|Ga0307497_10695469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300031232|Ga0302323_100674637 | Not Available | 1127 | Open in IMG/M |
| 3300031238|Ga0265332_10288561 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 678 | Open in IMG/M |
| 3300031244|Ga0302297_1108593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
| 3300031344|Ga0265316_11181052 | Not Available | 530 | Open in IMG/M |
| 3300031521|Ga0311364_10617601 | Not Available | 1093 | Open in IMG/M |
| 3300031521|Ga0311364_11384646 | Not Available | 696 | Open in IMG/M |
| 3300031716|Ga0310813_12133749 | Not Available | 530 | Open in IMG/M |
| 3300031726|Ga0302321_103228538 | Not Available | 531 | Open in IMG/M |
| 3300031823|Ga0307478_10701726 | Not Available | 847 | Open in IMG/M |
| 3300031834|Ga0315290_11222254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 623 | Open in IMG/M |
| 3300031834|Ga0315290_11328446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 591 | Open in IMG/M |
| 3300031834|Ga0315290_11583239 | Not Available | 530 | Open in IMG/M |
| 3300031873|Ga0315297_10499195 | Not Available | 1023 | Open in IMG/M |
| 3300031873|Ga0315297_10589481 | Not Available | 934 | Open in IMG/M |
| 3300031902|Ga0302322_100988136 | Not Available | 1013 | Open in IMG/M |
| 3300031912|Ga0306921_11066150 | Not Available | 908 | Open in IMG/M |
| 3300031918|Ga0311367_10239198 | All Organisms → cellular organisms → Bacteria | 1893 | Open in IMG/M |
| 3300031962|Ga0307479_10988955 | Not Available | 811 | Open in IMG/M |
| 3300031997|Ga0315278_10693753 | Not Available | 1036 | Open in IMG/M |
| 3300032156|Ga0315295_11143932 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300032160|Ga0311301_10986548 | Not Available | 1117 | Open in IMG/M |
| 3300032164|Ga0315283_11928053 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300032173|Ga0315268_12532465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 527 | Open in IMG/M |
| 3300032177|Ga0315276_11533218 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300032256|Ga0315271_10229047 | Not Available | 1500 | Open in IMG/M |
| 3300032256|Ga0315271_10594721 | Not Available | 945 | Open in IMG/M |
| 3300032256|Ga0315271_11287345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300032256|Ga0315271_11539528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
| 3300032275|Ga0315270_10295139 | Not Available | 1015 | Open in IMG/M |
| 3300032275|Ga0315270_10718440 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300032397|Ga0315287_10486864 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
| 3300032401|Ga0315275_10712679 | Not Available | 1116 | Open in IMG/M |
| 3300032828|Ga0335080_11219687 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300032828|Ga0335080_12245762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 523 | Open in IMG/M |
| 3300032893|Ga0335069_12533501 | Not Available | 530 | Open in IMG/M |
| 3300033289|Ga0310914_10811267 | Not Available | 834 | Open in IMG/M |
| 3300033414|Ga0316619_10966169 | Not Available | 740 | Open in IMG/M |
| 3300033414|Ga0316619_11110741 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300033416|Ga0316622_100657566 | Not Available | 1209 | Open in IMG/M |
| 3300033418|Ga0316625_101605725 | Not Available | 621 | Open in IMG/M |
| 3300033419|Ga0316601_102027351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 580 | Open in IMG/M |
| 3300033483|Ga0316629_10358172 | Not Available | 1011 | Open in IMG/M |
| 3300033483|Ga0316629_10488146 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300033483|Ga0316629_10942480 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300033485|Ga0316626_11667429 | Not Available | 575 | Open in IMG/M |
| 3300033488|Ga0316621_11265752 | Not Available | 559 | Open in IMG/M |
| 3300033493|Ga0316631_10416913 | Not Available | 556 | Open in IMG/M |
| 3300033557|Ga0316617_100359704 | Not Available | 1264 | Open in IMG/M |
| 3300033557|Ga0316617_100516128 | Not Available | 1089 | Open in IMG/M |
| 3300033557|Ga0316617_102029974 | Not Available | 591 | Open in IMG/M |
| 3300033557|Ga0316617_102215054 | Not Available | 567 | Open in IMG/M |
| 3300033798|Ga0334821_108403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300034129|Ga0370493_0371138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300034268|Ga0372943_0300433 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → Lentisphaeria → unclassified Lentisphaeria → Lentisphaeria bacterium | 1019 | Open in IMG/M |
| 3300034281|Ga0370481_0211169 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 12.41% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 12.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.28% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 6.90% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.83% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.14% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.45% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 2.76% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.76% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.76% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.07% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.07% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 2.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.07% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 2.07% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.38% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.38% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.38% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.69% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.69% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.69% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.69% |
| Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.69% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.69% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.69% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.69% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.69% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.69% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300004007 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Muzzi_CordC_D2 | Environmental | Open in IMG/M |
| 3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005219 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D2 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006930 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Methanogen_OWC | Environmental | Open in IMG/M |
| 3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300012171 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2 | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014312 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLA_D1 | Environmental | Open in IMG/M |
| 3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015167 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature) | Environmental | Open in IMG/M |
| 3300015194 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1c, glacier snout) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300021069 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-25m | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024186 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK29 | Environmental | Open in IMG/M |
| 3300024219 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK06 | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025482 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025619 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025980 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026057 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026463 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS6 | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027877 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027890 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Host-Associated | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300029442 | Freshwater lake microbial communities from Alinen Mustajarvi, Finland - AM13 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029998 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_1 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031244 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_2 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033418 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
| 3300033483 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D1_A | Environmental | Open in IMG/M |
| 3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
| 3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033493 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D3_A | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033798 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-3-S | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034281 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_117255042 | 3300000789 | Soil | LRRQLRQAKEALADTCMELALEKEFLAVACAQMDQTVESFKKKHGGSPRIRRSKRTRN* |
| JGIcombinedJ13530_1082697041 | 3300001213 | Wetland | ALERAYLEVACEQMDQSVEGFKKKHGGLPRTGRGKRNRA* |
| Ga0055476_103063081 | 3300004007 | Natural And Restored Wetlands | AHMELALEKAFLEVACERMDQTVAGFKKKHGGRPRTRRSAATRDSK* |
| Ga0055465_102993481 | 3300004013 | Natural And Restored Wetlands | HMELALEKAFLTVACEQLDQTVEGFKKKHGGRRRTGRSRSTRS* |
| Ga0062591_1005153661 | 3300004643 | Soil | SRLRKELRRVKEALADTHVELALEQAYLEVACEQLNQTTEAFKKKQAGGRRTGRSRPTGS |
| Ga0069004_100320081 | 3300005219 | Natural And Restored Wetlands | HIELALEKAFLAVACEQMDQTVEGFKKKHAGRPRTRRSKPTRN* |
| Ga0066388_1063615972 | 3300005332 | Tropical Forest Soil | VIRVEKGDEINAAARVRRQLRQAKEALADAHMELALEKAFLAVACEQLDQTVEGCKKKHGGRRRTKR* |
| Ga0070711_1003191512 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VKEALADTHMELVLEQAFLAVACEELGQGLEEFKKKHAGGRRTRRSKPSRS* |
| Ga0074473_103379911 | 3300005830 | Sediment (Intertidal) | SEVARLRRQLRQAKEALAEAHMELSLERAFLAEACQQLDQSVEGFKKKRGGRRHTGR* |
| Ga0074473_106843871 | 3300005830 | Sediment (Intertidal) | QAFLVVACEELDQSLEAFKKKHAGGRRTRRSKPTRS* |
| Ga0074470_102737772 | 3300005836 | Sediment (Intertidal) | VKEALADAHVDLALEQAFLEVACEELNQPLEVFKKKHAGGRRTRRSRPALNSK* |
| Ga0097691_10715981 | 3300006055 | Arctic Peat Soil | LADAYMELALEKAFLAVACEQMDQTVEGFKKKHAGGPRTRRSKPTRS* |
| Ga0070715_110188212 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | LRRVKEALADTHMELVLEQGFLAVACEELDQGLEEFKKKHAGGRRTRRSQPTRG* |
| Ga0079037_1021740952 | 3300006224 | Freshwater Wetlands | HMELVLEKAYLEVACEQMDETVEGFKKKHAGGPRTRRSKPTRS* |
| Ga0097621_1022661411 | 3300006237 | Miscanthus Rhizosphere | VLEQAFLAVACEELDQSLEEFKKKHAGGRRTRRSQPTRG* |
| Ga0075426_109715882 | 3300006903 | Populus Rhizosphere | LADTHMALALEQAFLAVACEQLDQSLEEFKKKHAGGRRTRRSSSTRSLK* |
| Ga0075436_1001457793 | 3300006914 | Populus Rhizosphere | QAFLAVACEELDQSLESFKKKHAGGRRTRRSRPTRS* |
| Ga0079303_105396751 | 3300006930 | Deep Subsurface | ALEKAFLNVACEQLDQTVEGFKKKHGGRPRTKRSSATRN* |
| Ga0115027_106612932 | 3300009131 | Wetland | LADAHMELALEKAFLAVACEQMDQTVEGFKKKHVGRPRTRRSKPTRN* |
| Ga0115027_114440482 | 3300009131 | Wetland | KAFLAVACEQMDQTVEGFKKKHAGRPRTRRSKPTQN* |
| Ga0105094_103065671 | 3300009153 | Freshwater Sediment | DAHMELALEKAFLVVACERMDQTVEGFKKKHAGRPRTRRSKPTRN* |
| Ga0073936_102782781 | 3300009175 | Freshwater Lake Hypolimnion | LADAHLELALEKAFLEVACVQMDQSVEGFKKKHDGRRPIKRCKPTRN* |
| Ga0116221_12403152 | 3300009523 | Peatlands Soil | LEKAFLVVACEQMDQRVEDFKKKHAGRPRTRRSKASRN* |
| Ga0116121_11386032 | 3300009644 | Peatland | EQAFLAVACEELDQSPEEFKKKHAGGRRTRRSKPSRS* |
| Ga0126307_109653601 | 3300009789 | Serpentine Soil | RRVKEALADTHVELALEKSYLEVACEQLDQTTEAFKKKQAGGRRTGRSRPTRS* |
| Ga0126313_114920962 | 3300009840 | Serpentine Soil | LRQAKEALADAHMDLALEKAFLGVACEQLGQAPEAFKKKQAGRRRTGHWKPTPDSK* |
| Ga0126311_117697402 | 3300010045 | Serpentine Soil | HVELALEKAYLEVACEQLDQTTEAFKKKQAGGRRTGRSRPTRS* |
| Ga0134080_104879381 | 3300010333 | Grasslands Soil | ALADTHMELALEQAFLAVACEELDQNLEEFKKKHAGGRRTRRSKPTRS* |
| Ga0137325_11211571 | 3300011415 | Soil | LEQAFLAVACEELDQSLEDFKKKHAGGRRTRRSRLSRS* |
| Ga0137342_10457661 | 3300012171 | Soil | RRVKEALADTYMELALEKAFLVVACERMDQTVEGFKKKHGGRPRTRRSKATRS* |
| Ga0137378_102663723 | 3300012210 | Vadose Zone Soil | RRVKEALADTHMELALEQAFLAVACEELDQSLEEFKKKHAGGRRTRRSRPTRS* |
| Ga0137360_103787661 | 3300012361 | Vadose Zone Soil | LRSELRRVKEALADTHMELALEQAFLAVACEELDQSLGELKKKHAGGRRTRRSKPTRS* |
| Ga0137360_104863431 | 3300012361 | Vadose Zone Soil | LALEQAFLAVACEELDQSLEEFKKKHAGGRRTRRSRPIGN* |
| Ga0137397_111491762 | 3300012685 | Vadose Zone Soil | DMHMELALEQAFLAVACEELDQSLESFKKKHAGGRRTRRSWPTRS* |
| Ga0137410_111136791 | 3300012944 | Vadose Zone Soil | LEKAFLVVACEEMNQSLEGFKKKHAGGRRTGPLKPTRSSKGRASASGPR* |
| Ga0157378_120140672 | 3300013297 | Miscanthus Rhizosphere | LADTHIELALEQAFLAVACEELDQSLESFKKKHAGWRRTRRSQPSRS* |
| Ga0163162_124629571 | 3300013306 | Switchgrass Rhizosphere | KAFLAVACEEMNQTPEAFKKKHAGGRRTGRSRLTPSSK* |
| Ga0075345_11007731 | 3300014312 | Natural And Restored Wetlands | AKEALADTHMELALEQGFLAVACEELDQSLEAFKKKHAGGRRTRRSRPSRS* |
| Ga0182010_102824572 | 3300014490 | Fen | QTKEALADAHMELALEKAFLAVACEQMDQTVEGFKKKRAGGPRTRRSKTTRS* |
| Ga0182019_110836241 | 3300014498 | Fen | LHRAKEALADTHMELALEQAFLAVACEELDQSVEGFKKKHAGGRRTRRSRLTRS* |
| Ga0182021_112106862 | 3300014502 | Fen | EQAFLAVACEELDQSVEGFKKKHAGGRRTRRSRLTRS* |
| Ga0167661_10480412 | 3300015167 | Glacier Forefield Soil | LALEKAFLEVACEQMGQSAEAFKKKHAGGRRTWRSRDTRSSK* |
| Ga0167666_11122952 | 3300015194 | Glacier Forefield Soil | HVELALEKAFLEVACEQLNQPLEVFKKKQAGRRRTKQ* |
| Ga0134072_101948421 | 3300015357 | Grasslands Soil | KAFLVVACEEMDQSLEAFKKKHAGGRRTRRSKPTRS* |
| Ga0182036_111426112 | 3300016270 | Soil | LADTHMELALERAFLAVACEELDQSLEDFKKKHAGGRRTRRSRPSRS |
| Ga0184620_100528231 | 3300018051 | Groundwater Sediment | ELRRVKDALAATHVELAVEKGYLEVACEQLDQTTEAFKKKQAGGRRTGRSRPTRS |
| Ga0184620_101141622 | 3300018051 | Groundwater Sediment | ALADAHMELALEKAFLAVACEQMGQTAEAFKKKQVGRRRTSRSRPTPGSK |
| Ga0193755_10706011 | 3300020004 | Soil | RAKEALADAHMELALEKAFLVEACLELNQSLEGFKKKHPGGRRIGRLRPSRSSK |
| Ga0194062_10697852 | 3300021069 | Anoxic Zone Freshwater | ALEQAFLAVACEELDQSLEAFKKKHAGGRRTRRSTRTPS |
| Ga0179596_101918791 | 3300021086 | Vadose Zone Soil | LRRVKEALADTHMELALEQAFLAVACEELDQSLEDFKKKHAGGRRTKRSRPSRS |
| Ga0193719_102641461 | 3300021344 | Soil | THMELALEQAFLAVACEELDQSLEEFKKKHAGGRRIRRSKPTRS |
| Ga0210397_109614581 | 3300021403 | Soil | ALADTHMELALEKAFLVVACEELDQSLEDFKKKHAGGRRTRRSRPTRS |
| Ga0210410_116582972 | 3300021479 | Soil | NEAARLRSQLRQTKEALADAHMELALEKAFLAVACEQMGQTAEAFKKKHPGGRRTARSK |
| Ga0247694_10106362 | 3300024178 | Soil | ALADTHMELALEQAFLAVACEELDQSLESFKKKHAGWRRTRRSQPSRS |
| Ga0247688_10494251 | 3300024186 | Soil | ADAHMELALEKAFLTVACEQMDQTVEGFKKKHGGRPRTRRSRSTRS |
| Ga0247665_10084481 | 3300024219 | Soil | LRQAKEALADAHMELALEKAFLAVACEQMGQTTEAFKKKHPGGRRTSQSKPTPSSR |
| Ga0247680_10147872 | 3300024246 | Soil | KEALADAHMELALEKAFLAVACEEMNQTPEAFKKKHAGGRRTGRSRLTPSSK |
| Ga0247661_10684241 | 3300024254 | Soil | LAVACEEMNQTPEAFKKKHAGGRRTGRSRLTPSSK |
| Ga0247671_10162732 | 3300024284 | Soil | DAHMELALEKAFLRVACDQLEQTVEGFKKKHGGRPRTRRSS |
| Ga0247666_11232151 | 3300024323 | Soil | EALADAHMELALEKAFLAVACEQMGQTEEAFKKKHVGRRRTWRSRGTPGSK |
| Ga0208850_10630691 | 3300025457 | Arctic Peat Soil | MELALEKAFLAVACEQMDQTVEGFKKKHAGGPRTRRSKPTRS |
| Ga0208715_10329411 | 3300025482 | Arctic Peat Soil | ADAHMELALEKAFLAVACEQMDQTVEGFKKKHAGGPRTRRSKPTRS |
| Ga0207926_10210811 | 3300025619 | Arctic Peat Soil | AHMELALEKAFLAVACEQMDQTVEGFKKKHAGGPRTRRSKPTRS |
| Ga0207663_116963881 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | LEQAFLAVACEELDQSLEEFKKKHAGGRRTRRSKPTRS |
| Ga0207712_103935572 | 3300025961 | Switchgrass Rhizosphere | LADAHVELALEKAYLEVACEEINQTPEAFKKKQAGKRRTRS |
| Ga0210137_10759221 | 3300025980 | Natural And Restored Wetlands | DAHIELALEKAFLAVACEQMDQTVEGFKKKHAGRPRTRRSKPTRN |
| Ga0208294_10230131 | 3300026057 | Natural And Restored Wetlands | AHMELVLEKAYLEVACEQMDETVEGFKKKHGGRPRTRRSSSTRS |
| Ga0209687_11426992 | 3300026322 | Soil | VLEQALLAVACEELDQSPEEFKKKHAGGRRTRRSRSTRS |
| Ga0256815_10148461 | 3300026463 | Sediment | EQAFLAVACEELDQSLEAFKKKHAGGRRTRRSKPTRS |
| Ga0209229_103325451 | 3300027805 | Freshwater And Sediment | LVLEKAFLSVACEQLDQTVEGFKKKHGGRPRTRRSSSTRS |
| Ga0209656_101792492 | 3300027812 | Bog Forest Soil | LEQAFLAVACEELDQSLEGFKKKHAGGRRTRRSRPTRS |
| Ga0209579_108203562 | 3300027869 | Surface Soil | LEQAFLAVACEELDQSLEGFKKKHAGGRRTRRSRSTRS |
| Ga0209283_105646502 | 3300027875 | Vadose Zone Soil | MELALEQAFLAVACEELDQSLEEFKKKHAGGRRTRRSRPTRS |
| Ga0209293_101353532 | 3300027877 | Wetland | ELVLEQGFLAVACEELDQSLEEFKKKHAGGRRTRRSKPTRS |
| Ga0209496_102041231 | 3300027890 | Wetland | LADTYMELALEKAFLVVACERMDQTVEGFKKKHGGRPRTRRSKATRS |
| Ga0247663_10551192 | 3300028145 | Soil | RLRRQLRQAKEALADAHMELALEKAFLAVACEQMGQTTEAFKKKHPGGRRTSQSKPTPSS |
| Ga0265319_12231992 | 3300028563 | Rhizosphere | VELALERAFLVVACEELDQSLEGFKKKHAGGRRTRRSGQTRK |
| Ga0307297_100701012 | 3300028754 | Soil | RLRKELRRVKEALADTHVELALEKGYLEVACEQLDQTTEAFKKKQAGGRRTGRSRPTRS |
| Ga0307286_101871591 | 3300028876 | Soil | ADAHMELVLEKAFLSVACEQLDQTVEGFKKKHGGRPRTRRSS |
| Ga0239579_10256382 | 3300029442 | Freshwater Lake | DTHVALALEQAFLAVACEELDQSLEAFKKKHAGGRRTRRSTRTPS |
| Ga0311352_107604962 | 3300029944 | Palsa | AVRLRSQLRQAKEALADVHMELALEKAFLAEACEQMDQTVEGFKKKQAGGRRTGRSRRTH |
| Ga0311332_105045902 | 3300029984 | Fen | ADAHMELALERSFLEVACEQLDQTPEAFKKKQAGKRRTWRSRRTPGSK |
| Ga0311332_115107362 | 3300029984 | Fen | LALEKAFLAVACEQMDQTVEGFKKKQAGGSRTRRSKTTRS |
| Ga0302271_104413052 | 3300029998 | Bog | EKAYLAVACEQMNQSVERFKKKQAGGRHTKRSKPTRN |
| Ga0311338_107322582 | 3300030007 | Palsa | DLALEKAFLEAACEQMNQTVEGFKKKQSGGRRTGRLRASRR |
| Ga0311349_106870881 | 3300030294 | Fen | VSEIERLRRQLRRAKEALADAHMELALEKAFLSVACEQLDQNVADFKKKRDGRQRAGPSKRRRS |
| Ga0311370_116679641 | 3300030503 | Palsa | RQAKEALAEAHMELALEKAFLAEACEQMDQTVEGFKKKQAGGRRTGRSRRTRS |
| Ga0311357_106720581 | 3300030524 | Palsa | RSQLRQAKEALADVHMELALEKAFLAEACEQMDQTVEGFKKKQAGGRRTGRSRRTHS |
| Ga0311355_112224111 | 3300030580 | Palsa | LADAHMELALEKAFLAVACEEMQQSLEGFKKKHAGGRRTGRSRTTRSSK |
| Ga0307497_106954691 | 3300031226 | Soil | EALADACMELALEKEFLSVACEQMNQTVEAFKKKHAGGRRTGRSKPTRN |
| Ga0302323_1006746371 | 3300031232 | Fen | LERTFLAVACEELGQGLEAFKKKHAGGRRTRRSRSTRN |
| Ga0265332_102885612 | 3300031238 | Rhizosphere | LALEQAFLVVACEELDQSLEGFKKKHAGGRRTRRSGQTRK |
| Ga0302297_11085931 | 3300031244 | Fen | LELRRAKEALADTHMALALEQAFLVAACEEMDQSVEAFKKKHAGGRRTRRSRRSPG |
| Ga0265316_111810521 | 3300031344 | Rhizosphere | ADTYMELALEKAFLVVACERLDQTVEGFKKKHGGRPRTRRCKPTRN |
| Ga0311364_106176012 | 3300031521 | Fen | LEQAFLAVACEELDQSLEAFKKKHVGGRRTGRWRRTPS |
| Ga0311364_113846461 | 3300031521 | Fen | AFLAVACEEMGQSVEGFKKKHAGGRRTRRLRPTRS |
| Ga0310813_121337493 | 3300031716 | Soil | KEALADAHMELALEKAFLAVACEQMGQTEEAFKKKHVGRRRTWRSRGTPGSK |
| Ga0302321_1032285382 | 3300031726 | Fen | RGELRRAKEALADAHMELALEKAFLTVACEQMGQTAEAFKKKHVGRRRTSRSRRTPDSR |
| Ga0307478_107017261 | 3300031823 | Hardwood Forest Soil | ALEQAFLAMACEELDQSLEGFKKKHAGGRRTRRSRPTRS |
| Ga0315290_112222541 | 3300031834 | Sediment | RVKEALADTHMELVLEQAFLAVACEELDQSLEAFKKKHAGGRRTRRSKPTRSRK |
| Ga0315290_113284462 | 3300031834 | Sediment | ADTHMELVLEQAFLAVACEELDQSLEAFKKKHAGGRRTRRSKPTRS |
| Ga0315290_115832391 | 3300031834 | Sediment | LADTYMELALEKAFLVVACERLDQTVEGFKKKHGGRPRTRRSKPTRN |
| Ga0315297_104991951 | 3300031873 | Sediment | DAHMELALEKAFLVVACERMDQTVEGFKKKHGGRPRTRRSKPTRN |
| Ga0315297_105894811 | 3300031873 | Sediment | LADTHVALALEQAFLAVACEELDQSLEAFKKKHAGGRRTRRSRRIPS |
| Ga0302322_1009881362 | 3300031902 | Fen | ELALEKAFLVVACERMDQTVEGFKKKHGGRPRTRRCKPTQN |
| Ga0306921_110661502 | 3300031912 | Soil | AHMELALEQAFLAVACEEMEQSVEGFKKKHAGGRRTRRSRPSRS |
| Ga0311367_102391982 | 3300031918 | Fen | MELALEKAFLAVACEQMDQSVERFKKKHAGKPRTRRSKPTRN |
| Ga0307479_109889551 | 3300031962 | Hardwood Forest Soil | VKEALADTHMELALEQAFLAVACEELDQSLEDFKKKHAGGRRTRRSRPTRS |
| Ga0315278_106937532 | 3300031997 | Sediment | DAYMELALEKAFLAVACEQMDQTVEGFKKKHGGSPRTRRSKPTRS |
| Ga0315295_111439321 | 3300032156 | Sediment | EKAFLAVACERLDQTVESFKKKHGGSPRTRRSKSTRS |
| Ga0311301_109865481 | 3300032160 | Peatlands Soil | ALERAYLGVACEQLDQSVEDFKKKHVGLPRTGRGRRSRS |
| Ga0315283_119280531 | 3300032164 | Sediment | IRVEKGDEISEGARLRSQLRRAKEALADTHMELALEKAFLAVACAQMDQTVESFKKKHGGSPRTRRSKPTRR |
| Ga0315268_125324652 | 3300032173 | Sediment | RELRRVKEALADTHMALGLEQAFLAVACEELDQSLEAFKKNTLAGGARGGRRRPGVEGDLAV |
| Ga0315276_115332181 | 3300032177 | Sediment | HMELALEKAFLAVACEQMDQTVEGFKKKHAGRPRTRRSKPTRN |
| Ga0315271_102290471 | 3300032256 | Sediment | MELALEKAFLVVACERMDQTVEGFKKKHGGRPRIRRSKATRS |
| Ga0315271_105947212 | 3300032256 | Sediment | MELALEKAFLTVACEQMDQTVERFKKKHGGSPRTRRSKPTRS |
| Ga0315271_112873452 | 3300032256 | Sediment | LRRVKEALADTHLELALEQAFLAVACEELDQSPEDFKKKHAGGRRTRRSKPTRS |
| Ga0315271_115395282 | 3300032256 | Sediment | AHMALALEQAFLEVACERLDQTVEAFKKKHAGRPRTRRCKPTRN |
| Ga0315270_102951391 | 3300032275 | Sediment | LEKAFLTVACEQLDQTVEGFKKKHDGRPRTRRSSATRS |
| Ga0315270_107184402 | 3300032275 | Sediment | LADAHLELALQKAFLEVACEQLDQTVDGFKKKHDGRPRTRRSKPTRN |
| Ga0315287_104868643 | 3300032397 | Sediment | LEKAFLLVACERMDQTVEGFKKKHAGRPRTRQFKPTRK |
| Ga0315275_107126792 | 3300032401 | Sediment | LADTHVALALEQAFLAVACEELDQSLEAFKKKHAGGRRTRRSTRTPS |
| Ga0335080_112196872 | 3300032828 | Soil | ADTHMELALEQAFLVVACEELGQSLEGFKKKHAGGRRTRRSRPSRS |
| Ga0335080_122457622 | 3300032828 | Soil | VKEALADTHMELALEQAFLVMACEELDQSLESFKKKHAGGRRTRRSRPARS |
| Ga0335069_125335012 | 3300032893 | Soil | LEQAFLAVACEQLNQSVEGFKKKHAGGRRTRRSRRTRSLK |
| Ga0310914_108112672 | 3300033289 | Soil | RLYVARRAKEALADTHMELALERAFLAVACEELDQSLADFKKKHAGGRRTRRSRPSRS |
| Ga0316619_109661692 | 3300033414 | Soil | LEKAFLAVACEQLDQTVEGFKKKHGGRRRTGRCKATRN |
| Ga0316619_111107411 | 3300033414 | Soil | YMELALEKAFLVVACERLDQTVEGFKKKHGGRPRTRRSKATRS |
| Ga0316622_1006575661 | 3300033416 | Soil | LVLEQGFLAVACEELDQSLEEFKKKHAGGRRTRRSKPTRS |
| Ga0316625_1016057251 | 3300033418 | Soil | QLQLAKEALADAHMELALEKAFLTAACGQLDQTVEGFKKKHGGRPRTRRSSSTRS |
| Ga0316601_1020273511 | 3300033419 | Soil | RSQLRQAKEALADTHMELALEKAFLVVACEQLDQTVEGFKKRHGGRPRTKRSKPTRNGAWSGFANGRR |
| Ga0316629_103581721 | 3300033483 | Soil | ERAFLAVACEELDQSLEDFKKKHAGGRRTRRSRPSRS |
| Ga0316629_104881461 | 3300033483 | Soil | LADAHMELALEKAFLAVACEQMDQTVEGFKKKQAGGRRTRRSKPTRN |
| Ga0316629_109424802 | 3300033483 | Soil | HMELVLEQGFLAVACEELDQSVEAFKKKHAGGRRTRRSKPTRS |
| Ga0316626_116674292 | 3300033485 | Soil | KEALADTHMELVLEQGFLAVACEELDQSLEEFKKKHAGGRRTRRSKPTRS |
| Ga0316621_112657522 | 3300033488 | Soil | LADAHMELALEKAFLTVACEQVDQTVEAFKKKHGGRPRTRRSRSTRS |
| Ga0316631_104169131 | 3300033493 | Soil | LRRVKEALADTHMELVLEQAFLAVACEELDQSLEEFKKKHAGGRRTRRSKPTRS |
| Ga0316617_1003597041 | 3300033557 | Soil | AKEALADTHMELALEQAFLAVACEELDQSVEGFKKKHAGGRRTRRSRPTRS |
| Ga0316617_1005161283 | 3300033557 | Soil | EALADTHMELALEQAFLAVACEELDQSLEGFKKKHAGGRRTKRSRPTLS |
| Ga0316617_1020299742 | 3300033557 | Soil | AHMELALEKAFLTVACEQLDQTVEGFKKKHGGRPRTGRSRSTRS |
| Ga0316617_1022150541 | 3300033557 | Soil | EKAFLVVACERMDQTVEGFKKKHGGRPRTRRRKPTRS |
| Ga0334821_108403_15_143 | 3300033798 | Soil | MELALEQAFLAVACEELDQSLEDFKKKHAGGRRTRRSKPTRS |
| Ga0370493_0371138_366_500 | 3300034129 | Untreated Peat Soil | TYMELALEKAFLVVACERLDQTVEGFKKKHGGRPRTRRCKPTRN |
| Ga0372943_0300433_883_1011 | 3300034268 | Soil | MELALERAYLAEACEQMEQSVEGFKKKHAGRPRTGRSKPTRN |
| Ga0370481_0211169_2_133 | 3300034281 | Untreated Peat Soil | YMELALEKAFLVVACERMDQTVEGFKKKHGGRPRARRSKPTRN |
| ⦗Top⦘ |