 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F050672 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MPNDPIIIGIAVLAIAVLGYTAISGMMNGTKSSKDKTDKGA |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 84.83 % |
| % of genes near scaffold ends (potentially truncated) | 24.83 % |
| % of genes from short scaffolds (< 2000 bps) | 80.69 % |
| Associated GOLD sequencing projects | 94 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (88.276 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (55.172 % of family members) |
| Environment Ontology (ENVO) | Unclassified (89.655 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (82.759 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00902 | TatC | 50.34 |
| PF09335 | SNARE_assoc | 2.07 |
| PF13481 | AAA_25 | 1.38 |
| PF07728 | AAA_5 | 1.38 |
| PF00145 | DNA_methylase | 0.69 |
| PF05866 | RusA | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0805 | Twin-arginine protein secretion pathway component TatC | Intracellular trafficking, secretion, and vesicular transport [U] | 50.34 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 2.07 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 2.07 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 2.07 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.69 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 88.28 % |
| All Organisms | root | All Organisms | 11.72 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 55.17% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 11.03% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 4.83% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 3.45% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.45% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.76% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 2.07% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.07% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 2.07% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.07% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.38% |
| Hydrothermal Vent Fluids | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Hydrothermal Vent Fluids | 1.38% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.69% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.69% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.69% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.69% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.69% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.69% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.69% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.69% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.69% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.69% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.69% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001728 | Marine viral communities from the Pacific Ocean - LP-46 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300002511 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 | Environmental | Open in IMG/M |
| 3300002514 | Marine viral communities from the Pacific Ocean - ETNP_6_85 | Environmental | Open in IMG/M |
| 3300003542 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS900_Dependable_DNA | Environmental | Open in IMG/M |
| 3300004280 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100m | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005423 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006090 | Marine microbial communities from the Eastern Tropical South Pacific Oxygen Minumum Zone, cruise NBP1315, 2013 - sample NBP124 | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006736 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG | Environmental | Open in IMG/M |
| 3300006738 | Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006926 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG | Environmental | Open in IMG/M |
| 3300006927 | Marine viral communities from the Subarctic Pacific Ocean - 2_ETSP_OMZ_AT15125 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009412 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s2 | Environmental | Open in IMG/M |
| 3300009413 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s12 | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009605 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 | Environmental | Open in IMG/M |
| 3300009612 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3651_4511 | Environmental | Open in IMG/M |
| 3300009619 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3827_250 | Environmental | Open in IMG/M |
| 3300009622 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300014973 | Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0116 : 2 days incubation | Environmental | Open in IMG/M |
| 3300017702 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_10 viral metaG | Environmental | Open in IMG/M |
| 3300017703 | Marine viral communities from the Subarctic Pacific Ocean - ?Lowphox_02 viral metaG | Environmental | Open in IMG/M |
| 3300017704 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_07 viral metaG | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017715 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_06 viral metaG | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
| 3300020477 | Marine microbial communities from Tara Oceans - TARA_B100001123 (ERX555935-ERR599156) | Environmental | Open in IMG/M |
| 3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
| 3300021791 | Hydrothermal fluids microbial communities from Mariana Back-Arc Basin vent fields, Pacific Ocean - Daikoku_FS921 150_kmer | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022227 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_150_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024052 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5 | Environmental | Open in IMG/M |
| 3300024057 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_9 | Environmental | Open in IMG/M |
| 3300024259 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_200_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024517 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3 | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300024520 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1 | Environmental | Open in IMG/M |
| 3300025045 | Marine viral communities from the Pacific Ocean - LP-46 (SPAdes) | Environmental | Open in IMG/M |
| 3300025046 | Marine viral communities from the Pacific Ocean - LP-45 (SPAdes) | Environmental | Open in IMG/M |
| 3300025049 | Marine viral communities from the Pacific Ocean - LP-55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025066 | Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025072 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025082 | Marine viral communities from the Subarctic Pacific Ocean - 1_ETSP_OMZ_AT15124 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025109 | Marine viral communities from the Subarctic Pacific Ocean - 6_ETSP_OMZ_AT15160 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025112 | Marine viral communities from the Pacific Ocean - ETNP_2_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300025118 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025122 | Marine viral communities from the Pacific Ocean - ETNP_2_300 (SPAdes) | Environmental | Open in IMG/M |
| 3300025125 | Marine viral communities from the Pacific Ocean - ETNP_2_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025133 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025141 | Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025251 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906 (SPAdes) | Environmental | Open in IMG/M |
| 3300025257 | Marine viral communities from the Deep Pacific Ocean - MSP-134 (SPAdes) | Environmental | Open in IMG/M |
| 3300025260 | Marine viral communities from the Deep Pacific Ocean - MSP112 (SPAdes) | Environmental | Open in IMG/M |
| 3300025280 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 (SPAdes) | Environmental | Open in IMG/M |
| 3300025286 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 (SPAdes) | Environmental | Open in IMG/M |
| 3300025873 | Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes) | Environmental | Open in IMG/M |
| 3300026103 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300031167 | Marine microbial communities from water near the shore, Antarctic Ocean - #418 | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| 3300031675 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_SCM | Environmental | Open in IMG/M |
| 3300031693 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_33.1 | Environmental | Open in IMG/M |
| 3300031701 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Bottom | Environmental | Open in IMG/M |
| 3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
| 3300032278 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MG | Environmental | Open in IMG/M |
| 3300033742 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawater | Environmental | Open in IMG/M |
| 3300034656 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 502_2477 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24006J15134_100411802 | 3300001450 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNGTKSSKDKTDKGA* |
| JGI24006J15134_101225932 | 3300001450 | Marine | MPSDPIIIGISVLAIAILGYTAINGMMSGAKSNKDKTDKGA* |
| JGI24521J20086_10184872 | 3300001728 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNSAKSSKDKTDKGA* |
| KVRMV2_1006855353 | 3300002231 | Marine Sediment | MPNDPIIIGIAVLAIAVLGYTAINGMMSSTKSKDKT |
| JGI25129J35166_10133763 | 3300002484 | Marine | MPNDPIIIGIAVIAIAILGYTAINGMMSGVKXSKDKTNKGA* |
| JGI25131J35506_10539091 | 3300002511 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNSSKSAKDKTDKGV* |
| JGI25133J35611_100654281 | 3300002514 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGSKSKDKTDKGA* |
| JGI25133J35611_101363611 | 3300002514 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGSKGKDKTDKGA* |
| FS900DNA_106139902 | 3300003542 | Diffuse Hydrothermal Flow Volcanic Vent | MPNDPIIIGIAVIAIAILGYTAINGMMSGAKSSKDKTNKGA* |
| Ga0066606_103152842 | 3300004280 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGTKSKDKTDKGA* |
| Ga0068513_100000722 | 3300004951 | Marine Water | MPNDPIIIGIAVLAIAVLGYTAISGVMNGTKSKDKTDKGA* |
| Ga0073579_14868602 | 3300005239 | Marine | MPNDPIIIGIAVVAIAVLGYTAINGMMGSTKSKDKTDKGA* |
| Ga0066828_102160741 | 3300005423 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNNSRSSKDKTDKGA* |
| Ga0075466_10538822 | 3300006029 | Aqueous | MPNDPIIIGIAVLAIAVLGYTAINGMMSGTKSKDKTDKGA* |
| Ga0082015_10173271 | 3300006090 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGTKSSKDKTDKGA* |
| Ga0075441_101125483 | 3300006164 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNSTKSSKDKTDKGA* |
| Ga0068500_11060275 | 3300006332 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMNSSKGKDKTDKGA* |
| Ga0068500_11251468 | 3300006332 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMNGAKSSNKDKPNKGA* |
| Ga0068500_11715942 | 3300006332 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMLNSGKSGKDKTNKGA* |
| Ga0075461_100161865 | 3300006637 | Aqueous | MPNDPIIIGIAVLAIAILGYTAINGMMSGGKSSKDKTDKGA* |
| Ga0098033_10579792 | 3300006736 | Marine | MPNDPIIIGIAVIAIAILGYTAINGMMSGVKSSKDKTNKGA* |
| Ga0098035_100074826 | 3300006738 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMLSNSKSSKDKTNKGA* |
| Ga0098035_100692811 | 3300006738 | Marine | MPNDPIIIGIAVLAIAVLGYTAINGMLNNNKGSKDKPNKGA* |
| Ga0098035_10412544 | 3300006738 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMSGTKSKDKTDKGA* |
| Ga0098035_10956003 | 3300006738 | Marine | MPNDPIIIGIAIIAIAVLGYTTINGMLNGSKGSKKKPDKGA* |
| Ga0098035_11840291 | 3300006738 | Marine | PIIIGIAVLAIAVLGYTAISGMMNNSRSSKDKTDKGA* |
| Ga0098058_10638474 | 3300006750 | Marine | MPNDPIIIGIAVIAIAVLGYTAISGMMSGTKSSKDKTDKGA* |
| Ga0098058_11888251 | 3300006750 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNNSRGGKDKTDKGA* |
| Ga0098040_11488492 | 3300006751 | Marine | VPNDPIIIGIAIIAIAVLGYTTINGMLNGSKGSKKKPDKGA* |
| Ga0098044_12040303 | 3300006754 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNNSRSSKDKTDKG |
| Ga0098044_13746402 | 3300006754 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMSSSKSAKDKTDKGV* |
| Ga0098054_11057242 | 3300006789 | Marine | MPNDPIIIGIAVLAIAVLGYTAINGMLNNSKGSKNKTDKGA* |
| Ga0098054_12301121 | 3300006789 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGSKGGKDKTNKGA* |
| Ga0098060_10555262 | 3300006921 | Marine | MPNDPIIIGIAVIAIAVLGYTAISGMMNSGKSGKDKTNKGA* |
| Ga0098057_10789284 | 3300006926 | Marine | MPNDPIIIGIAVLAIAVLGYTAINGMMNSTKSKDKTDKG |
| Ga0098034_12221033 | 3300006927 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNNSRSSKDK |
| Ga0098034_12282402 | 3300006927 | Marine | MPSDPFIIGIAVLAIAVLGYTAINGMMSSTKSKDKTDKGA* |
| Ga0098036_10188896 | 3300006929 | Marine | PNDPIIIGIAVIAIAVLGYTAINGMMNGTKSKDKTDKGA* |
| Ga0098036_12005951 | 3300006929 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGVMNGTKSSKDKTDKGA* |
| Ga0075444_103989512 | 3300006947 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMGSTKKSGSDKPDKGA* |
| Ga0110931_10102343 | 3300007963 | Marine | VFSTSGIPRKNKREIFTMPNDPIIIGIAVLAIAVLGYTAISGMMNGTKSKDKTDKGA* |
| Ga0114899_12537082 | 3300008217 | Deep Ocean | MPNDPIIIGIAVIAIAVLGYTAINGMLNSSKDSKKKTDKGV* |
| Ga0114905_10241463 | 3300008219 | Deep Ocean | MPNDPIIIGIAVLAIAILGYTAISGMMNSSKSAKDKTDKGA* |
| Ga0114918_100184836 | 3300009149 | Deep Subsurface | MPNDPIIIGIAVIAIAVLGYTAISSMVNGKKSGGDKPDKGA* |
| Ga0114918_102248662 | 3300009149 | Deep Subsurface | MPNDPIIIGIAVLAIAVLGYTAINSIMGSTKKSGSDKTDKGA* |
| Ga0114996_100596521 | 3300009173 | Marine | MPSDPIIIGICVLAIAVLGYTAINGVMSGTKSKDKTDKGA* |
| Ga0114996_102004371 | 3300009173 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGVMSGTKSKDKTDKGA* |
| Ga0114996_102552575 | 3300009173 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMLGSSKGSSKSSKDKTD |
| Ga0114993_105636351 | 3300009409 | Marine | KIEGTSMPNDPIIIGIAVLAIAVLGYTAINGMMGASKSSKDKTDKGA* |
| Ga0114993_108255843 | 3300009409 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGTKSSKDK |
| Ga0114993_113091462 | 3300009409 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNGTKSKDKTDKGA* |
| Ga0114903_10308812 | 3300009412 | Deep Ocean | MPNDPIIIGIAVLAIAVLGYTAINGMMNSTKRKDKTDKGA* |
| Ga0114903_10599553 | 3300009412 | Deep Ocean | VPNDPIIIGIAVIAIAVLGYTAINGMLNSSKDSKKKTDKGV* |
| Ga0114902_10173861 | 3300009413 | Deep Ocean | MPNDPIIIGIAVLAIAVLGYTAINGMMSSTKSKDKTDKGA* |
| Ga0114908_11495412 | 3300009418 | Deep Ocean | MPNDPIIIGIAVLAIAVLGYTAISGMMNGAKSKDKTDKGA* |
| Ga0114997_104209252 | 3300009425 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGAKSSKDKTDKGA* |
| Ga0114900_11644903 | 3300009602 | Deep Ocean | MPNDPIIIGIAVLAIAVLGYTAISGMMNSSKSAKDKTDKGA* |
| Ga0114901_10055629 | 3300009604 | Deep Ocean | MPNDPIIIGIAVIAIAVLGYTAINGMLNSSKGSKKKTDKGV* |
| Ga0114906_11045852 | 3300009605 | Deep Ocean | PIIIGIAVIAIAVLCYTAISGMMSGTKCSKDKTEKGA* |
| Ga0105217_1136722 | 3300009612 | Marine Oceanic | MPNDPIIIGIAVLAIAVLGYTAISGMMSSSKSAKDKTDKGA* |
| Ga0105236_10382642 | 3300009619 | Marine Oceanic | MPNDPIIIGIAVIAIAVLGYTAISGMMNSKGSSRDKTDKGV* |
| Ga0105173_10167002 | 3300009622 | Marine Oceanic | MPNDPIIIGIAVLAIAILGYTAITSMLPKSKGADKTDKEA* |
| Ga0105173_10193332 | 3300009622 | Marine Oceanic | MPNDPIIIGIAVLAIAVLGYTAISGMMSSTKSGKDKTDKGA* |
| Ga0115002_104631891 | 3300009706 | Marine | MPNDPIIIGIAVLAIAVLGYTAINGMMSGTKGSKDKTDKGA* |
| Ga0115002_109079991 | 3300009706 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMLGSSKGSSKSSKDKTDKGA* |
| Ga0114999_103176932 | 3300009786 | Marine | MPNDPIIIGIAVLAIAVLGYTAINGMLGASKSSKDKTDKGA* |
| Ga0098061_12330683 | 3300010151 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNGTKSKDKTD |
| Ga0098059_14165732 | 3300010153 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGTKSSKDKTNKGA* |
| Ga0129345_10765143 | 3300010297 | Freshwater To Marine Saline Gradient | DPIIIGIAVLAIAILGYTAINGMMSGGKSSKDKTDKGA* |
| Ga0133547_117181773 | 3300010883 | Marine | MPNDPIIIGIAVLAIAVLGYTAINSLMGSTKKSSSDKPKKEA* |
| Ga0134293_10226991 | 3300014973 | Marine | IIIGIAVLAIAVLGYTAISGMMNGTKSKDKTDKGA* |
| Ga0181374_10500962 | 3300017702 | Marine | PRKNKRENLMPNDPIIIGIAVLAIAVLGYTAISGMMNGTKSKDKTDKGA |
| Ga0181367_10729693 | 3300017703 | Marine | MPNDPIIIGIAVIAIAILGYTAINGMMSGTKSSKDKT |
| Ga0181371_10115782 | 3300017704 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMSGTKSKDKTDKGA |
| Ga0181387_10405123 | 3300017709 | Seawater | MPNDPIIIGIAVLAIAILGYTAISGMMNGTKSSKDKTDKGA |
| Ga0181403_11347982 | 3300017710 | Seawater | MPNDPIIIGIAVLAIAILGYTAISGMMNGAKSKDKTDKGA |
| Ga0181370_10093122 | 3300017715 | Marine | MPNDPIIIGIAVLAIAVLGYTAINGMMNSTKSKDKTDKGA |
| Ga0181375_10691031 | 3300017718 | Marine | KNKRENLMPNDPIIIGIAVLAIAILGYTAISGMMNGTKSKDKTDKGA |
| Ga0181396_10471601 | 3300017729 | Seawater | EAIMPNDPIIIGIAVLAIAVLGYTAISGMMNGAKSKDKTDKGA |
| Ga0181432_10459121 | 3300017775 | Seawater | MPNDPIIIGIAVIAIAVLGYTAINGMMSGTKSSKDKTDK |
| Ga0181432_12945312 | 3300017775 | Seawater | MPSDPIIIGIAVLAIAVLGYTAINGMMNSTKSKDKTDKGA |
| Ga0181577_100261382 | 3300017951 | Salt Marsh | MPNDPIIIGIAVLAIAILGYTAINGMMSGGKGKDKTDKGA |
| Ga0194024_10207991 | 3300019765 | Freshwater | MPNDPIIIGIAVLAIAILGYTAINGMMSGGKSSKDKTDKGA |
| Ga0211585_100011546 | 3300020477 | Marine | MPNDPIIIGIAVIAIAVLGYTAISGMMNSGKSGKDKTNKGA |
| Ga0206685_101204091 | 3300021442 | Seawater | MPNDPIIIGIAVIAIAVLGYTAINGMMSGTKSSKDKTDKGA |
| Ga0226832_100326102 | 3300021791 | Hydrothermal Vent Fluids | MPNDPIIIGIAVLAIAVLGYTAINGMMSSTKSKDKTDKGA |
| Ga0226832_105290062 | 3300021791 | Hydrothermal Vent Fluids | MPNDPIIIGIAVLAIAVLGYTAISGMMNGTKSKDKTDKGA |
| Ga0222717_100114974 | 3300021957 | Estuarine Water | MPNDPIIIGIAVLAIAVLGYTAINGMMSGTKSKDKTDKGA |
| Ga0196891_10767041 | 3300022183 | Aqueous | MPNDPIIIGIAVLAIAILGYTAINGMMSGGKSSKDK |
| Ga0187827_101481722 | 3300022227 | Seawater | MPNDPIIIGIAVLAIAVLGYTAISGMMNNSRSSKDKTDKGA |
| Ga0187827_104315782 | 3300022227 | Seawater | MPNDPIIIGIAVIAIAVLGYTAISGMMSGTKSSKDKTDKGA |
| (restricted) Ga0255050_101529471 | 3300024052 | Seawater | MPNDPIIIGIAVIAIAVLGYTAINGMMSGTKSKDKTDKGA |
| (restricted) Ga0255051_103376732 | 3300024057 | Seawater | MPNDPIIIGIAVLAIAVLGYTAISGVMNGTKSSKDKTDKGA |
| (restricted) Ga0233437_12700842 | 3300024259 | Seawater | MPNDPIIIGIAVLAIAVLGYTAISGMMNGTKNKDKTDKGA |
| Ga0210003_10948502 | 3300024262 | Deep Subsurface | MPNDPIIIGIAVIAIAVLGYTAISSMVNGKKSGGDKPDKGA |
| (restricted) Ga0255049_106309282 | 3300024517 | Seawater | MPNDPIIIGIAVLAIAVLGYTAISGMMNGTKSSKDKTDKGA |
| (restricted) Ga0255048_102159383 | 3300024518 | Seawater | MPNDPIIIGIAVIAIAVLGYTAISGMMSGVKSSKDKTDKGA |
| (restricted) Ga0255048_103726562 | 3300024518 | Seawater | MPNDPIIIGIAVLAIAVLGYTAISSFVNKSSNKSKKPGE |
| (restricted) Ga0255047_107025211 | 3300024520 | Seawater | MPNDPIIIGIAVIAIAVLGYTAISGMMNGTKSKDKTDKGA |
| Ga0207901_10264362 | 3300025045 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNSAKSSKDKTDKGA |
| Ga0207902_10320172 | 3300025046 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMSSTKSSKDKTDKGA |
| Ga0207898_10182553 | 3300025049 | Marine | MPNDPIIIGIAVIAIAILGYTAINGMMSGTKSSKDKTNKGA |
| Ga0208012_10330642 | 3300025066 | Marine | MPNDPIIIGIAVLAIAVLGYTAINGMLNNSKGSKNKTDKGA |
| Ga0208012_10599751 | 3300025066 | Marine | MPNDPIIIGIAVLAIAILGYTAISGMMNGTKSKDKTDKGA |
| Ga0208920_100005941 | 3300025072 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMLSNSKSSKDKTNKGA |
| Ga0208920_10988932 | 3300025072 | Marine | PNDPIIIGIAVIAIAVLGYTAINGMMSGTKSSKDKTDKGA |
| Ga0208156_10622952 | 3300025082 | Marine | IIGIAVLAIAVLGYTAISGMMNNSRSSKDKTDKGA |
| Ga0208434_10151841 | 3300025098 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNGTKSKDKTDKG |
| Ga0208013_10899531 | 3300025103 | Marine | MPNDPIIIGIAVLAIAVLGYTAINGMLNNNKGSKDKPNKGA |
| Ga0208553_11415163 | 3300025109 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGTKSSKDKT |
| Ga0209349_10768182 | 3300025112 | Marine | MPNDPIIIGIAVIAIAVLGYTAISGMMNGTKSSKDKTNKGA |
| Ga0209349_11768582 | 3300025112 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGTKSSKDKTNKGA |
| Ga0208790_11891881 | 3300025118 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMNNSRSSKDKT |
| Ga0209434_10263343 | 3300025122 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMSSSKSAKDKTDKGV |
| Ga0209644_11050182 | 3300025125 | Marine | PNDPIIIGIAIIAIAVLGYTAISGIMSSNKSSKEKTDKGA |
| Ga0208919_10374796 | 3300025128 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGVKSSKD |
| Ga0209128_10168205 | 3300025131 | Marine | DPIIIGIAVIAIAVLGYTAISGMMNGTKSSKDKTNKGA |
| Ga0209128_12257282 | 3300025131 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGSKSKDKTDKGA |
| Ga0208299_11326073 | 3300025133 | Marine | VPNDPIIIGIAVIAIAVLGYTAINGMMSGSKGGKDKTNKGA |
| Ga0209756_11729261 | 3300025141 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMNSGKGDKDKTNKGA |
| Ga0209645_10448453 | 3300025151 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMSGSKGKDKTDKGA |
| Ga0209337_10149827 | 3300025168 | Marine | MPSDPIIIGISVLAIAILGYTAINGMMSGAKSNKDKTDKGA |
| Ga0208182_100069718 | 3300025251 | Deep Ocean | MPNDPIIIGIAVIAIAVLGYTAINGMLNSSKGSKKKTDKGV |
| Ga0207899_10024725 | 3300025257 | Deep Ocean | MPNDPIIIGIAVLAIAVLGYTAISGMMSSTKSGKDKTDKGA |
| Ga0207899_10071957 | 3300025257 | Deep Ocean | MPNDPIIIGIAVLAIAILGYTAITSMLPKSKGGDKADKEA |
| Ga0207895_10445431 | 3300025260 | Deep Ocean | IIGIAVLAIAVLGYTAISGMMSSTKSGKDKTDKGA |
| Ga0208449_10166991 | 3300025280 | Deep Ocean | MPNDPIIIGIAVLAIAVLGYTAINGMMNSTKSKDKTDEDA |
| Ga0208315_10162533 | 3300025286 | Deep Ocean | MPNDPIIIGIAVLAIAVLGYTAINGMMNSTKRKDKTDKGA |
| Ga0208315_10721412 | 3300025286 | Deep Ocean | VPNDPIIIGIAIIAIAVLGYTTINGMLNGSKGSKKKPDKGA |
| Ga0209757_101654261 | 3300025873 | Marine | DPIIIGIAVIAIAILGYTAINGMMSGVKSSKDKTNKGA |
| Ga0209757_102572192 | 3300025873 | Marine | MPSDPFIIGIAVLAIAVLGYTAINGMMSSTKSKDKTDKGA |
| Ga0208451_10156342 | 3300026103 | Marine Oceanic | MPNDPIIIGIAVLAIAILGYTAITSMLPKSKGADKTDKEA |
| Ga0209709_101113072 | 3300027779 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGVMNGTKSKDKTDKGA |
| Ga0209089_107393612 | 3300027838 | Marine | KRGNMPNDPIIIGIAVIAIAVLGYTAINGMMSGTKSSKDKTDKGA |
| Ga0209402_100879943 | 3300027847 | Marine | MPNDPIIIGIAVLAIAVLGYTAINGMLGASKSSKDKTDKGA |
| Ga0308023_10593762 | 3300031167 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMMGSTKSKDKTDKGA |
| Ga0302132_104974081 | 3300031605 | Marine | MPNDPIIIGIAVIAIAVLGYTAINGMLGSSKGSSKSSKDKTDKGA |
| Ga0302118_101490832 | 3300031627 | Marine | MPNDPIIIGIAVLAIAVLGYTAINGMMSGTKSGKDKTDKGA |
| Ga0302122_101048631 | 3300031675 | Marine | NDPIIIGIAVLAIAVLGYTAISGVMNGTKSKDKTDKGA |
| Ga0302139_103460351 | 3300031693 | Marine | NDPIIIGIAVIAIAVLGYTAINGMMSGTKSSKDKTDKGA |
| Ga0302120_101255882 | 3300031701 | Marine | PNDPIIIGIAVLAIAVLGYTAISGMMSNSKSVKDKTDKGA |
| Ga0310121_103251043 | 3300031801 | Marine | MPNDPIIIGIAVLAIAVLGYTAISGMMSNSKSVKDKTDKGA |
| Ga0310345_105934732 | 3300032278 | Seawater | MPNDPIIIGIAVIAIAVLGYTAISGMMSGVKSSKDKTNKGA |
| Ga0314858_086435_277_402 | 3300033742 | Sea-Ice Brine | MPNDPIIIGIAVLAIAVLGYTAINGMMGATKSSKDKTDKGA |
| Ga0326748_050923_472_582 | 3300034656 | Filtered Seawater | MPNDPIIIGIAVLAIAVLGYTAISGMMNSTKSSKDKT |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |