NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F050622

Metagenome Family F050622

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050622
Family Type Metagenome
Number of Sequences 145
Average Sequence Length 43 residues
Representative Sequence RNNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Number of Associated Samples 85
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 95.17 %
% of genes from short scaffolds (< 2000 bps) 93.10 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.655 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(29.655 % of family members)
Environment Ontology (ENVO) Unclassified
(44.138 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(66.207 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.00%    β-sheet: 0.00%    Coil/Unstructured: 60.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF02586SRAP 2.07
PF06411HdeA 1.38
PF00589Phage_integrase 1.38
PF00216Bac_DNA_binding 1.38
PF01527HTH_Tnp_1 0.69
PF03080Neprosin 0.69
PF01068DNA_ligase_A_M 0.69
PF07813LTXXQ 0.69
PF13676TIR_2 0.69
PF02518HATPase_c 0.69
PF12840HTH_20 0.69
PF13683rve_3 0.69
PF13358DDE_3 0.69
PF00593TonB_dep_Rec 0.69
PF08924DUF1906 0.69
PF01565FAD_binding_4 0.69
PF06078DUF937 0.69
PF02371Transposase_20 0.69
PF04226Transgly_assoc 0.69
PF13586DDE_Tnp_1_2 0.69
PF04860Phage_portal 0.69
PF00816Histone_HNS 0.69
PF00873ACR_tran 0.69
PF00106adh_short 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG3678Periplasmic chaperone Spy, Spy/CpxP familyPosttranslational modification, protein turnover, chaperones [O] 2.76
COG2135ssDNA abasic site-binding protein YedK/HMCES, SRAP familyReplication, recombination and repair [L] 2.07
COG0776Bacterial nucleoid DNA-binding protein IHF-alphaReplication, recombination and repair [L] 1.38
COG1423ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) familyReplication, recombination and repair [L] 0.69
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.69
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 0.69
COG2916DNA-binding protein H-NSTranscription [K] 0.69
COG3547TransposaseMobilome: prophages, transposons [X] 0.69
COG3753Uncharacterized conserved protein YidB, DUF937 familyFunction unknown [S] 0.69


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.66 %
UnclassifiedrootN/A30.34 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000655|AF_2010_repII_A100DRAFT_1060634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium670Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10072776Not Available741Open in IMG/M
3300004633|Ga0066395_10232941Not Available980Open in IMG/M
3300004633|Ga0066395_10556556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium667Open in IMG/M
3300005332|Ga0066388_101947036Not Available1051Open in IMG/M
3300005332|Ga0066388_102584913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae924Open in IMG/M
3300005332|Ga0066388_105232266Not Available658Open in IMG/M
3300005332|Ga0066388_105658146All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7632Open in IMG/M
3300005332|Ga0066388_105801039Not Available624Open in IMG/M
3300005332|Ga0066388_106200777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium603Open in IMG/M
3300005332|Ga0066388_107520424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium546Open in IMG/M
3300005536|Ga0070697_101426068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7618Open in IMG/M
3300005713|Ga0066905_100558231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium962Open in IMG/M
3300005713|Ga0066905_101422118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium628Open in IMG/M
3300005764|Ga0066903_100773893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1710Open in IMG/M
3300005764|Ga0066903_102053154All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1099Open in IMG/M
3300005764|Ga0066903_102084622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium pachyrhizi1091Open in IMG/M
3300005764|Ga0066903_102828352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium941Open in IMG/M
3300005764|Ga0066903_103711793Not Available821Open in IMG/M
3300005764|Ga0066903_103765701Not Available815Open in IMG/M
3300005764|Ga0066903_104537130All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium740Open in IMG/M
3300005764|Ga0066903_105505734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria667Open in IMG/M
3300005764|Ga0066903_105802985Not Available648Open in IMG/M
3300005764|Ga0066903_107276127Not Available572Open in IMG/M
3300005764|Ga0066903_107417334Not Available566Open in IMG/M
3300005764|Ga0066903_108206873Not Available534Open in IMG/M
3300005764|Ga0066903_108830417Not Available511Open in IMG/M
3300006028|Ga0070717_10340918All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_71338Open in IMG/M
3300006028|Ga0070717_11398462All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium635Open in IMG/M
3300006173|Ga0070716_100002977All Organisms → cellular organisms → Bacteria → Proteobacteria7898Open in IMG/M
3300006852|Ga0075433_11817010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → Afipia birgiae524Open in IMG/M
3300009162|Ga0075423_10188591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales2164Open in IMG/M
3300009162|Ga0075423_12779219Not Available536Open in IMG/M
3300009792|Ga0126374_10536305All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium851Open in IMG/M
3300009792|Ga0126374_10899757All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium686Open in IMG/M
3300010046|Ga0126384_10236499All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1468Open in IMG/M
3300010046|Ga0126384_10622707All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria947Open in IMG/M
3300010046|Ga0126384_12215979Not Available529Open in IMG/M
3300010047|Ga0126382_10207955All Organisms → cellular organisms → Bacteria → Proteobacteria1398Open in IMG/M
3300010047|Ga0126382_10549801All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium939Open in IMG/M
3300010048|Ga0126373_10591220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1161Open in IMG/M
3300010360|Ga0126372_11944741Not Available634Open in IMG/M
3300010360|Ga0126372_12512028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria566Open in IMG/M
3300010362|Ga0126377_12804634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium562Open in IMG/M
3300010366|Ga0126379_11026628Not Available930Open in IMG/M
3300010366|Ga0126379_12639522Not Available600Open in IMG/M
3300010366|Ga0126379_12873754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300010366|Ga0126379_13648518Not Available516Open in IMG/M
3300010376|Ga0126381_100869392All Organisms → cellular organisms → Bacteria1297Open in IMG/M
3300010376|Ga0126381_103645017Not Available603Open in IMG/M
3300010396|Ga0134126_12646994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300010398|Ga0126383_11259047Not Available830Open in IMG/M
3300010398|Ga0126383_11441824Not Available778Open in IMG/M
3300010398|Ga0126383_12708938Not Available578Open in IMG/M
3300010398|Ga0126383_12855005All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium564Open in IMG/M
3300010398|Ga0126383_13432411All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300010398|Ga0126383_13594211Not Available506Open in IMG/M
3300011269|Ga0137392_11203325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium616Open in IMG/M
3300012211|Ga0137377_11741740Not Available544Open in IMG/M
3300012360|Ga0137375_10966920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium672Open in IMG/M
3300012971|Ga0126369_11501770Not Available763Open in IMG/M
3300012971|Ga0126369_13020233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300012985|Ga0164308_10740695All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales851Open in IMG/M
3300012987|Ga0164307_11204000All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria628Open in IMG/M
3300015371|Ga0132258_10514397All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2996Open in IMG/M
3300016270|Ga0182036_11170673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium638Open in IMG/M
3300016270|Ga0182036_11624609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7545Open in IMG/M
3300016294|Ga0182041_10915186Not Available789Open in IMG/M
3300016294|Ga0182041_12313088All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium jicamae503Open in IMG/M
3300016319|Ga0182033_11501318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium608Open in IMG/M
3300016357|Ga0182032_10971735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium724Open in IMG/M
3300016371|Ga0182034_10532518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium984Open in IMG/M
3300016371|Ga0182034_11523250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300016387|Ga0182040_10163507All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1600Open in IMG/M
3300016387|Ga0182040_11207870All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium636Open in IMG/M
3300016387|Ga0182040_11376181All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300016404|Ga0182037_10433583All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300016404|Ga0182037_10523540Not Available997Open in IMG/M
3300016422|Ga0182039_12168696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium512Open in IMG/M
3300016445|Ga0182038_10680302Not Available894Open in IMG/M
3300020579|Ga0210407_10550506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium901Open in IMG/M
3300020580|Ga0210403_10239913All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1487Open in IMG/M
3300021082|Ga0210380_10055452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1715Open in IMG/M
3300021170|Ga0210400_10268072All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300021178|Ga0210408_10340448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1196Open in IMG/M
3300021372|Ga0213877_10096881Not Available893Open in IMG/M
3300021406|Ga0210386_11200058All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium642Open in IMG/M
3300021478|Ga0210402_10214713Not Available1770Open in IMG/M
3300021478|Ga0210402_11114431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium716Open in IMG/M
3300021479|Ga0210410_11566170Not Available552Open in IMG/M
3300021560|Ga0126371_10061537All Organisms → cellular organisms → Bacteria3624Open in IMG/M
3300021560|Ga0126371_13892021Not Available503Open in IMG/M
3300025898|Ga0207692_10272755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1021Open in IMG/M
3300027874|Ga0209465_10248867All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium889Open in IMG/M
3300027874|Ga0209465_10382250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium705Open in IMG/M
3300028880|Ga0307300_10302582All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium542Open in IMG/M
3300031543|Ga0318516_10445758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium744Open in IMG/M
3300031546|Ga0318538_10578026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300031573|Ga0310915_10162175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1550Open in IMG/M
3300031573|Ga0310915_10983006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300031679|Ga0318561_10484937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300031680|Ga0318574_10886433Not Available522Open in IMG/M
3300031681|Ga0318572_10575157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium671Open in IMG/M
3300031682|Ga0318560_10276276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium904Open in IMG/M
3300031719|Ga0306917_11431788All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium533Open in IMG/M
3300031719|Ga0306917_11447414Not Available529Open in IMG/M
3300031724|Ga0318500_10196726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium964Open in IMG/M
3300031765|Ga0318554_10571922Not Available638Open in IMG/M
3300031768|Ga0318509_10231064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1031Open in IMG/M
3300031793|Ga0318548_10407539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium666Open in IMG/M
3300031795|Ga0318557_10520832Not Available546Open in IMG/M
3300031797|Ga0318550_10089293All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300031833|Ga0310917_10057508Not Available2405Open in IMG/M
3300031835|Ga0318517_10500969All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium547Open in IMG/M
3300031879|Ga0306919_10652067All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium811Open in IMG/M
3300031879|Ga0306919_10909387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium674Open in IMG/M
3300031880|Ga0318544_10187930All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium796Open in IMG/M
3300031880|Ga0318544_10413951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium524Open in IMG/M
3300031897|Ga0318520_10164117All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp.1295Open in IMG/M
3300031910|Ga0306923_10103872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3209Open in IMG/M
3300031910|Ga0306923_11007350Not Available904Open in IMG/M
3300031912|Ga0306921_10237673All Organisms → cellular organisms → Bacteria2134Open in IMG/M
3300031912|Ga0306921_10467497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1468Open in IMG/M
3300031912|Ga0306921_11462835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium748Open in IMG/M
3300031912|Ga0306921_12432606Not Available545Open in IMG/M
3300031941|Ga0310912_11415026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300031942|Ga0310916_10383525Not Available1195Open in IMG/M
3300031942|Ga0310916_10468357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1073Open in IMG/M
3300031946|Ga0310910_10198920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1554Open in IMG/M
3300031946|Ga0310910_10419064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium pachyrhizi1061Open in IMG/M
3300031947|Ga0310909_10268302All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira → unclassified Nitrosospira → Nitrosospira sp.1427Open in IMG/M
3300031947|Ga0310909_11340844Not Available574Open in IMG/M
3300031954|Ga0306926_10343006All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1847Open in IMG/M
3300031954|Ga0306926_11450741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium794Open in IMG/M
3300031981|Ga0318531_10004758All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4728Open in IMG/M
3300032001|Ga0306922_10222312All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium2027Open in IMG/M
3300032001|Ga0306922_10622999Not Available1141Open in IMG/M
3300032035|Ga0310911_10533168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300032063|Ga0318504_10142062Not Available1101Open in IMG/M
3300032065|Ga0318513_10630392All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium525Open in IMG/M
3300032066|Ga0318514_10453800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300032094|Ga0318540_10559200All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300033289|Ga0310914_10112213All Organisms → cellular organisms → Bacteria2361Open in IMG/M
3300033290|Ga0318519_10480354All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium747Open in IMG/M
3300033290|Ga0318519_10705099Not Available617Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil29.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil20.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil18.62%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil17.93%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.07%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.07%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.07%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.38%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.69%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.69%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021372Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01EnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A100DRAFT_106063413300000655Forest SoilLNIDLESFEENVNKLTNYCYDEKNFKVPIIEAIVRVLGK*
AF_2010_repII_A001DRAFT_1007277623300000793Forest SoilAKTSNLNIALESFEENVNKLNNYCYDEKNFKVPIMEAIVRVLGK*
Ga0066395_1023294123300004633Tropical Forest SoilANLNIALESFEENVNKLNNYCYDEKNFKVPIMEAIVKVLGK*
Ga0066395_1055655613300004633Tropical Forest SoilKIIDLDTFEDNVSKVQSYCYEEKNFKVPIMKAVETVLGGRK*
Ga0066388_10194703633300005332Tropical Forest SoilVAAVQRTNLVIALESFEENVNKLTNYCYDEKNFKMPIMEAIVRVLGK*
Ga0066388_10258491313300005332Tropical Forest SoilSGYYHAKRNNWIIDTESFENNVNKLNNYYDEKNFKVPIMEAIERVLGK*
Ga0066388_10523226623300005332Tropical Forest SoilLIATWLSGYSHSKRDNLIIALESFEENVNKLNNYCYDEKNFKVPIMEAIVRIVGK*
Ga0066388_10565814613300005332Tropical Forest SoilNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIERIVGK*
Ga0066388_10580103923300005332Tropical Forest SoilNLNIALESFEENVNKLNNYCYDEKNFKVPIMEAIVRVLGK*
Ga0066388_10620077723300005332Tropical Forest SoilATFLSGYSHAKRTNLTIDLESFEENVNKLTTYCYDEKNFKLPIMEAIVRVLGK*
Ga0066388_10752042423300005332Tropical Forest SoilWIINVESFEDNVSKLTNYCYDEKNFKVPLMEAIERVLGN*
Ga0070697_10142606823300005536Corn, Switchgrass And Miscanthus RhizosphereLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIERIVGK*
Ga0066905_10055823133300005713Tropical Forest SoilMPKRNNWIIDLESFEDNVSKLTNYCYDEKNFKVPIVEAVETVLGK*
Ga0066905_10142211813300005713Tropical Forest SoilLESFENNVNKLNNYCYDEKNFKVPIMEAVERILGK*
Ga0066903_10077389343300005764Tropical Forest SoilMGFGISGYYHAKRNKTIIDLDTFEDNVSKVRNYCYDEKNFKVPIMEAIERVLGK*
Ga0066903_10205315413300005764Tropical Forest SoilWFIDLESFEDNVSKLTNYCYDEKNFKVPIVEAVETVLGK*
Ga0066903_10208462213300005764Tropical Forest SoilLESFEENVNKLTNYCYDEKNFKVPIMEAIERIVGK*
Ga0066903_10282835233300005764Tropical Forest SoilNAKRNNKIIDLDTFEDNVSKVQSYCYEEKNFKVPIMKAVETVLGKSSNAR*
Ga0066903_10371179333300005764Tropical Forest SoilLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVLGK*
Ga0066903_10376570113300005764Tropical Forest SoilTIDLESFEENVNKLTTYCYDEKNFKVPIMEAIVRIVGK*
Ga0066903_10453713033300005764Tropical Forest SoilAWLSGYHHAKRNNWIIALESFEDTVSKLTNYCYDEKNFKVPIMKAVERVLGK*
Ga0066903_10550573423300005764Tropical Forest SoilWLSGYYHAKRNNWIIGSESFENNVNKLNNYCYDEKNFKVPIIEAIERVLGK*
Ga0066903_10580298513300005764Tropical Forest SoilIDLESFEENVHKLTTLCYDEKNFKVPIMEAIVRVVGK*
Ga0066903_10727612733300005764Tropical Forest SoilRWLIAAWLSGYSHAKSTNLTIDLESFEENVHKLTTLCYDEKNFKVPIMEAIVRVVGK*
Ga0066903_10741733413300005764Tropical Forest SoilNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIVRVVGK*
Ga0066903_10820687313300005764Tropical Forest SoilKSTNLNIDLESFEENVHKLTTLCYDEKNFKVPLMEAIVRVVGK*
Ga0066903_10883041713300005764Tropical Forest SoilAKRNNSIIDLESFENNVNKLNNYCYDEKNFKVPIMEAIERVLK*
Ga0070717_1034091813300006028Corn, Switchgrass And Miscanthus RhizosphereNKRNNLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIERIVGK*
Ga0070717_1139846213300006028Corn, Switchgrass And Miscanthus RhizosphereIIQTESFEDNVNKLNNYCYDEKNFKVPIMEAIERVLGK*
Ga0070716_100002977113300006173Corn, Switchgrass And Miscanthus RhizosphereHAKRNNWIIQTESFEDNVNKLNNYCYDEKNFKVLIMDAIERVLGK*
Ga0075433_1181701023300006852Populus RhizosphereIIQTESFEDNVNKLNNYCYDEKNFKAPIMEAIERVLGK*
Ga0075423_1018859143300009162Populus RhizosphereMNPNLPDGLLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK*
Ga0075423_1277921913300009162Populus RhizosphereGFYHGKRNNWIINVESFEDNVTKLTNYCYDEKNFNVPLTEAIERVLGK*
Ga0126374_1053630533300009792Tropical Forest SoilDLESFEENVNKLTNYCYDEKNFKVPIMEAIVRVVGK*
Ga0126374_1089975713300009792Tropical Forest SoilNTFEDSVSKVQSYCYEEKNFKVPIMKAVETVLGGRK*
Ga0126384_1023649943300010046Tropical Forest SoilESFENNVNKLNNYCYDEKNFKVPIMEAVERVLGK*
Ga0126384_1062270713300010046Tropical Forest SoilNNLIIDLESFEENVNKLNNYCYDEKNFKTPIMEAIVRVVGK*
Ga0126384_1221597923300010046Tropical Forest SoilIALESFEENVNKLTNYCYDEKNFKVPIMEAIVKVLGK*
Ga0126382_1020795513300010047Tropical Forest SoilNWLSGYYHAKRNNWIIDSESFENNVNKLNNYCYDETNFKVPIMEAIERVLGK*
Ga0126382_1054980133300010047Tropical Forest SoilSGYYHAKRNNWIIDLESFEDNVSKLTNYCYDEKNFKVPIVEAVETVLGK*
Ga0126373_1059122013300010048Tropical Forest SoilHAKRNNWIIALESFEDTVSKLTNYCYDEKNFKVPIMKAVERVLGK*
Ga0126372_1194474123300010360Tropical Forest SoilLSGYSHAKSNNLIIALESFEENVNKLNNYCYDEKNFKTPIMEAIVRVVGK*
Ga0126372_1251202823300010360Tropical Forest SoilNNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIERIVGK*
Ga0126377_1280463413300010362Tropical Forest SoilWIIQTESFEDNVNKLNNYCYDEKNFKVPIMEAIERVLGK*
Ga0126379_1102662813300010366Tropical Forest SoilTANLNIALESFEENVNKLNNYCYDEKNFKVPIMEAIVRVLGK*
Ga0126379_1263952233300010366Tropical Forest SoilSHAKTANLNIALESFEENVNKLNNYCYDEKNFKVPIMEAIVKVLGK*
Ga0126379_1287375413300010366Tropical Forest SoilIVDSESFENNVNKLNNYCYDEKNFKVPITEAVERVLGK*
Ga0126379_1364851813300010366Tropical Forest SoilNNRIVDSESFENNVNKLNNYCYDEKNFKVPIMEALGRVLGK*
Ga0126381_10086939233300010376Tropical Forest SoilLSGYYHAKRNNWIVDSESFENNVNKLNNYCYDEKNFKVPIIEAIERVLGK*
Ga0126381_10364501713300010376Tropical Forest SoilNLIIALESFEENVNKLNNYCYDEKNFKTPIMEAIVRVVGK*
Ga0134126_1264699433300010396Terrestrial SoilIDSESFENNVNKLNNYCYDEKNFKVPIMDAIERVLGK*
Ga0126383_1125904713300010398Tropical Forest SoilIDTESFENNVNKLNNYCYDEKNFKVPIMEAVERVLGK*
Ga0126383_1144182433300010398Tropical Forest SoilGYYHAKRNNWIINLESFEDNVNKLTNYCYDEKNFEVPLMEAIERVLGK*
Ga0126383_1270893823300010398Tropical Forest SoilWLIATFLSGYSHAKRTNLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVKVVGK*
Ga0126383_1285500523300010398Tropical Forest SoilWLSGYYHAKRNNWIIDSESFENNVNKLNNYCYDEKNFKVPIMEAVERVLGK*
Ga0126383_1343241123300010398Tropical Forest SoilYYHAKRNNKIIDLDTLEDNVSKLTNYCYDEKNFKVPIMEAVERVLGK*
Ga0126383_1359421113300010398Tropical Forest SoilLESFEENVHKLTTLCYDEKNFKVPIMEAIVRVVGK*
Ga0137392_1120332523300011269Vadose Zone SoilWLIAAWLSGYSHNKRNNLIIDLSSFEENVNKLNNYCYDEKNFKVPIMEAIERIVGK*
Ga0137377_1174174013300012211Vadose Zone SoilNNVNKLNNYCYDENNFKVPIIEAIERVLGKSSSTR*
Ga0137375_1096692023300012360Vadose Zone SoilIIDLETLEGNVSKVKNYCYDEKNFKVPIMKAVERVLGK*
Ga0126369_1150177033300012971Tropical Forest SoilALESFEENVNKLNNYCYDEKNFKVPIMEAIVRVLGK*
Ga0126369_1302023313300012971Tropical Forest SoilWIIDSESFENNVNKLNNYCYDEKNFKVPIMEAIERVLGK*
Ga0164308_1074069513300012985SoilRNNWIVDSESFENNVNKLNNYCYDEKNFKVPIIEAVERVLGK*
Ga0164307_1120400013300012987SoilIDLESFEDNVSKLTNYCYDEKNFKVPIMEAVGQVLGGRK*
Ga0132258_1051439713300015371Arabidopsis RhizosphereAAWLSGYSHAKSNNLIIDLESFEENVNKLNNYCYDEKNFKTPIMEAIVRVVGK*
Ga0182036_1117067313300016270SoilKIIDLETLEDNVSKVTNYCYDEKNFKVPIMKAIETVLGKSSNTR
Ga0182036_1162460923300016270SoilIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRIVGK
Ga0182041_1091518613300016294SoilHAKSNNLIIALESFEENVNKLTNYCYDEKNFKVPIMEAIVKVLGK
Ga0182041_1231308813300016294SoilSHNKRNNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIERIVGK
Ga0182033_1150131813300016319SoilALESFEENVNKLNNYCYDEKNFKVPIMAAIERIVGK
Ga0182032_1097173513300016357SoilNLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRIVGK
Ga0182034_1053251813300016371SoilNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIERIVGK
Ga0182034_1152325013300016371SoilENLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRIVGK
Ga0182040_1016350713300016387SoilNAKRNNKIIDLETLEDNVSKVTNYCYDEKNFKVPIMKAIETVLGKSSNTR
Ga0182040_1120787023300016387SoilLESFENNVNKLNNYCYDEKNFKVPIMEAVERVLGK
Ga0182040_1137618113300016387SoilIMDTESFENNVNKLNNYCYDEKNFKVPIMEAVERVLGK
Ga0182037_1043358313300016404SoilNNSIVDLESFENNVNKLNNYCYDEKNFKVPIMEAVERVLGK
Ga0182037_1052354033300016404SoilGYSHAKSNNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIVRVVGK
Ga0182039_1216869613300016422SoilWLSGYSHAKSNNLIIDLESFEENVNKLTNYCYDEKNFKTPIMEAIVRVVGK
Ga0182038_1068030213300016445SoilKSNNLIIALESFEENVNKLTNYCYDEKNFKVPIMEAIVKVLGK
Ga0210407_1055050623300020579SoilNWTIQTESFEDNVNKLTNYCYDEKNFKVPIMEAIERVLGK
Ga0210403_1023991323300020580SoilMPNANNWTIQTESFEDNVNKLTNYCYDEKNFKVPIMEAIERVLGK
Ga0210380_1005545213300021082Groundwater SedimentINLESFEDNVNKLNNYCYDEKNFKVPIMEAIERVLGK
Ga0210400_1026807243300021170SoilLSGYSHNKRNNLIIALESFEENVNKLTNYCYDEKNFKVPIMEAIVRVVGK
Ga0210408_1034044833300021178SoilGYYHAKRNNWIADPESFENNVNKLNNYCYDEKNFKVPIMEAVERVLGK
Ga0213877_1009688113300021372Bulk SoilLSGYSHNKRNNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Ga0210386_1120005813300021406SoilNWLSGYYHAKRNNWIADPESFENNVNKLNNYCYDEKNFKVPIMEAVGQVLGGRK
Ga0210402_1021471313300021478SoilMPNANNWTIQTESFEDNVNKLTNYCYDEKNFKVPIM
Ga0210402_1111443123300021478SoilTIMPNANNWTIQTESFEDNVNKLTNYCYDEKNFKVPIMEAIERVLGK
Ga0210410_1156617033300021479SoilKRNNWIIQTESFEDNVNKLNNYCYDEKNFKVPIVEAIERVLGK
Ga0126371_1006153723300021560Tropical Forest SoilMGFGISGYYHAKRNKTIIDLDTFEDNVSKVRNYCYDEKNFKVPIMEAIERVLGK
Ga0126371_1389202133300021560Tropical Forest SoilALESFEENVNKLNNYCYDEKNFKVPIMEAIVRVLGK
Ga0207692_1027275533300025898Corn, Switchgrass And Miscanthus RhizosphereHAKRNNRIVDSESFENNVNKLNNYCYDEKNFKVPIIEAVERVLGK
Ga0209465_1024886723300027874Tropical Forest SoilNKIIDLDTFEDNVSKVQSYCYEEKNFKVPIMKAVETVLGGRK
Ga0209465_1038225023300027874Tropical Forest SoilNKIIDLDTFEDNVSKVQSYCYEEKNFKVPIMKAVETVLGKSSNAR
Ga0307300_1030258213300028880SoilIINLESFEDNVNKLNNYCYDEKNFKVPIMEAIERVLGK
Ga0318516_1044575833300031543SoilDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0318538_1057802613300031546SoilRNNLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0310915_1016217513300031573SoilLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0310915_1098300623300031573SoilYYHAKRNNWIIDSESFEDNVSKLTSYCYDEKNFKVPIMEAVERVLSK
Ga0318561_1048493713300031679SoilLESFEENVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Ga0318574_1088643313300031680SoilSHAKTSNLNIALESFEENVNKLNNYCYDEKNFKVPIMEAIVRVLGK
Ga0318572_1057515733300031681SoilWLSGYSHAKSANLIIALESVEENVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Ga0318560_1027627613300031682SoilLLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0306917_1143178813300031719SoilIDLESFEDNVSKLTNYYYDEKNFKVPIMEAVEQVLGGRK
Ga0306917_1144741413300031719SoilSGYSHAKSTNLTIDLESFEENVHKLTTYCYDEKNFKVPIMEAIVRVLGK
Ga0318500_1019672613300031724SoilLSGYSHAKRNNLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0318554_1057192223300031765SoilAKRNNWIIALESFEDTVSKLTNYCYDEKNFQVPIVEAVERVLGK
Ga0318509_1023106413300031768SoilSHAKRENLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0318548_1040753933300031793SoilIIALESVEENVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Ga0318557_1052083213300031795SoilLSGYHHAKRNNWIIALESFEDTVSKLTNYCYDEKNFQVPIVEAVERVLGK
Ga0318550_1008929343300031797SoilIIDLETLEDNVSKVKNYCYDEKNFKVPIMKAVETVLGKSSNAR
Ga0310917_1005750873300031833SoilHAKRNNLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0318517_1050096923300031835SoilCYSHAKRNNLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0306919_1065206733300031879SoilAAWLSGYSHAKSANLIIALESFGENVNKLTNHCYDEKNFKVPIMEAIVRVLGK
Ga0306919_1090938723300031879SoilLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0318544_1018793023300031880SoilNLIIALESFEENVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Ga0318544_1041395133300031880SoilSHAKRENLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRIVGK
Ga0318520_1016411713300031897SoilIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0306923_1010387213300031910SoilSHAKSNNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIERIVGK
Ga0306923_1100735023300031910SoilDLESFEENVNKLTNYCYDEKNFKVPIMEAIVRIVGK
Ga0306921_1023767363300031912SoilGYSHAKSNNLIIALESFEENVNKLTNYCYDEKNFKVPIMEAIVKVLGK
Ga0306921_1046749713300031912SoilAKRNNKIIDLDTFEDKASKLTNYCYDEKNFKVPIMEAVERVLSK
Ga0306921_1146283513300031912SoilWLSGYSHAKRENLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRIVGK
Ga0306921_1243260613300031912SoilALESFEENVNKLNNYCYDEKNFKVPIMEAIVRILGK
Ga0310912_1141502613300031941SoilDLQAFEENMNKVQNYCYDEKNFKVPIMEAVERVLGK
Ga0310916_1038352533300031942SoilKSNNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIVRVVGK
Ga0310916_1046835713300031942SoilIIDTESFENNVNKLNNYCYDEKNFKVPIMEAVERVLGK
Ga0310910_1019892013300031946SoilLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIERIVGK
Ga0310910_1041906413300031946SoilNRRLVKWLLSYKRNNLIIDLESFEENVNKLTSYCYDEKNFKVPIMEAIERIVGK
Ga0310909_1026830243300031947SoilYSHAKRNNLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0310909_1134084413300031947SoilWLIAAWLSGYSHAKTSNLNIALESFEENVNKLNNYCYDEKNFKVPIMEAIVRILGK
Ga0306926_1034300613300031954SoilLANRRLVKCYSHAKRNNLIIDLESFEENVNKLNNYCYDEKNFKVPIMEAIVRVVGK
Ga0306926_1145074123300031954SoilHAKRNNWIIDLESFEDNVSKLTNYCYDEKNFKVPIMEAVEQVLGGRK
Ga0318531_1000475813300031981SoilSHAKSNNLIIALESFEENVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Ga0306922_1022231243300032001SoilNLIIALESFEANVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Ga0306922_1062299933300032001SoilDLESFEENVNKLTNYCYDEKNFKVPIMEAIVRVVGK
Ga0310911_1053316813300032035SoilHAKRNNSIVDLESFENNVNKLNNYCYDEKNFKVPIMEAVERVLGK
Ga0318504_1014206243300032063SoilHNKRNNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIERIVGK
Ga0318513_1063039213300032065SoilSRWLIAAWLSGYSHAKRTNLIIELESFEENVNKLTNYCYDEQNFKVPIMEAIVRVLGK
Ga0318514_1045380013300032066SoilLIIALESVEENVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Ga0318540_1055920023300032094SoilRNNLIIDLESFEENVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Ga0310914_1011221353300033289SoilLIIALESFEANVNKLTNYCYDEKNFKVPIMEAIVRVLGK
Ga0318519_1048035413300033290SoilNRTLDLQAFEENMNKVQNYCYDEKNSKVPIMEAVERVLDK
Ga0318519_1070509913300033290SoilGYSHAKTSNLNIALESFEENVNKLNNYCYDEKNFKVPIMEAIVRILGK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.