| Basic Information | |
|---|---|
| Family ID | F050616 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MDVLRSVRARRARPRGVPGPDAASAALSWIGDERIAISGVPS |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 98.62 % |
| % of genes near scaffold ends (potentially truncated) | 99.31 % |
| % of genes from short scaffolds (< 2000 bps) | 89.66 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (51.724 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (22.069 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.897 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (32.414 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 14.29% β-sheet: 14.29% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF12697 | Abhydrolase_6 | 5.52 |
| PF16169 | DUF4872 | 4.14 |
| PF12146 | Hydrolase_4 | 2.76 |
| PF13561 | adh_short_C2 | 2.07 |
| PF03417 | AAT | 2.07 |
| PF10604 | Polyketide_cyc2 | 2.07 |
| PF09594 | GT87 | 1.38 |
| PF00378 | ECH_1 | 1.38 |
| PF00027 | cNMP_binding | 1.38 |
| PF00903 | Glyoxalase | 1.38 |
| PF00583 | Acetyltransf_1 | 1.38 |
| PF00501 | AMP-binding | 1.38 |
| PF03976 | PPK2 | 1.38 |
| PF03061 | 4HBT | 0.69 |
| PF01906 | YbjQ_1 | 0.69 |
| PF03466 | LysR_substrate | 0.69 |
| PF01969 | Ni_insertion | 0.69 |
| PF13160 | DUF3995 | 0.69 |
| PF02687 | FtsX | 0.69 |
| PF01872 | RibD_C | 0.69 |
| PF04012 | PspA_IM30 | 0.69 |
| PF00498 | FHA | 0.69 |
| PF00296 | Bac_luciferase | 0.69 |
| PF00005 | ABC_tran | 0.69 |
| PF09900 | DUF2127 | 0.69 |
| PF04493 | Endonuclease_5 | 0.69 |
| PF04229 | GrpB | 0.69 |
| PF00486 | Trans_reg_C | 0.69 |
| PF04343 | DUF488 | 0.69 |
| PF00491 | Arginase | 0.69 |
| PF00400 | WD40 | 0.69 |
| PF12680 | SnoaL_2 | 0.69 |
| PF12802 | MarR_2 | 0.69 |
| PF03551 | PadR | 0.69 |
| PF13847 | Methyltransf_31 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG4927 | Predicted choloylglycine hydrolase | General function prediction only [R] | 2.07 |
| COG1842 | Phage shock protein A | Transcription [K] | 1.38 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 1.38 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.69 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.69 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.69 |
| COG1515 | Deoxyinosine 3'-endonuclease (endonuclease V) | Replication, recombination and repair [L] | 0.69 |
| COG1641 | CTP-dependent cyclometallase, nickel-pincer nucleotide (NPN) cofactor biosynthesis | Coenzyme transport and metabolism [H] | 0.69 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.69 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.69 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.69 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.69 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.69 |
| COG2320 | GrpB domain, predicted nucleotidyltransferase, UPF0157 family | General function prediction only [R] | 0.69 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 51.72 % |
| All Organisms | root | All Organisms | 48.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_113894666 | Not Available | 682 | Open in IMG/M |
| 3300004092|Ga0062389_104228897 | Not Available | 540 | Open in IMG/M |
| 3300005332|Ga0066388_102394823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 957 | Open in IMG/M |
| 3300005332|Ga0066388_106604100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 584 | Open in IMG/M |
| 3300005332|Ga0066388_107943427 | Not Available | 531 | Open in IMG/M |
| 3300005334|Ga0068869_100376553 | Not Available | 1162 | Open in IMG/M |
| 3300005337|Ga0070682_100119129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1769 | Open in IMG/M |
| 3300005338|Ga0068868_100566788 | Not Available | 1002 | Open in IMG/M |
| 3300005355|Ga0070671_100276244 | Not Available | 1428 | Open in IMG/M |
| 3300005434|Ga0070709_10589791 | Not Available | 854 | Open in IMG/M |
| 3300005434|Ga0070709_10983629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 670 | Open in IMG/M |
| 3300005434|Ga0070709_11423467 | Not Available | 561 | Open in IMG/M |
| 3300005435|Ga0070714_100739626 | Not Available | 950 | Open in IMG/M |
| 3300005435|Ga0070714_101562561 | Not Available | 644 | Open in IMG/M |
| 3300005435|Ga0070714_101831683 | Not Available | 592 | Open in IMG/M |
| 3300005435|Ga0070714_102038890 | Not Available | 559 | Open in IMG/M |
| 3300005436|Ga0070713_100763575 | Not Available | 925 | Open in IMG/M |
| 3300005437|Ga0070710_11036114 | Not Available | 599 | Open in IMG/M |
| 3300005439|Ga0070711_100569673 | Not Available | 941 | Open in IMG/M |
| 3300005439|Ga0070711_101556342 | Not Available | 577 | Open in IMG/M |
| 3300005439|Ga0070711_101851202 | Not Available | 530 | Open in IMG/M |
| 3300005468|Ga0070707_102047742 | Not Available | 540 | Open in IMG/M |
| 3300005546|Ga0070696_100230016 | Not Available | 1395 | Open in IMG/M |
| 3300005546|Ga0070696_100862335 | Not Available | 749 | Open in IMG/M |
| 3300005764|Ga0066903_103498049 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005840|Ga0068870_10161685 | Not Available | 1328 | Open in IMG/M |
| 3300006028|Ga0070717_10375839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1274 | Open in IMG/M |
| 3300006028|Ga0070717_12076617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 511 | Open in IMG/M |
| 3300006163|Ga0070715_10001795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 6391 | Open in IMG/M |
| 3300006173|Ga0070716_100047755 | Not Available | 2416 | Open in IMG/M |
| 3300006173|Ga0070716_101546072 | Not Available | 543 | Open in IMG/M |
| 3300006175|Ga0070712_100202502 | Not Available | 1560 | Open in IMG/M |
| 3300006175|Ga0070712_100749230 | Not Available | 836 | Open in IMG/M |
| 3300006358|Ga0068871_101007359 | Not Available | 776 | Open in IMG/M |
| 3300006806|Ga0079220_10263003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1041 | Open in IMG/M |
| 3300006806|Ga0079220_10942628 | Not Available | 676 | Open in IMG/M |
| 3300007076|Ga0075435_101671794 | Not Available | 559 | Open in IMG/M |
| 3300009092|Ga0105250_10168426 | Not Available | 916 | Open in IMG/M |
| 3300009098|Ga0105245_10863874 | Not Available | 945 | Open in IMG/M |
| 3300009520|Ga0116214_1269092 | Not Available | 649 | Open in IMG/M |
| 3300009545|Ga0105237_12433185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
| 3300009698|Ga0116216_10073930 | All Organisms → cellular organisms → Bacteria | 2095 | Open in IMG/M |
| 3300009792|Ga0126374_10035482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2389 | Open in IMG/M |
| 3300010360|Ga0126372_11316420 | Not Available | 752 | Open in IMG/M |
| 3300010360|Ga0126372_11869635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 645 | Open in IMG/M |
| 3300010366|Ga0126379_10236189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1788 | Open in IMG/M |
| 3300010366|Ga0126379_10243330 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
| 3300010371|Ga0134125_12707849 | Not Available | 539 | Open in IMG/M |
| 3300010376|Ga0126381_100712216 | Not Available | 1436 | Open in IMG/M |
| 3300010376|Ga0126381_102861339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300010379|Ga0136449_101172411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1213 | Open in IMG/M |
| 3300010398|Ga0126383_11004793 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300012971|Ga0126369_11081502 | Not Available | 891 | Open in IMG/M |
| 3300013104|Ga0157370_10624184 | Not Available | 986 | Open in IMG/M |
| 3300013296|Ga0157374_12114943 | Not Available | 590 | Open in IMG/M |
| 3300014201|Ga0181537_11059214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter → unclassified Arthrobacter → Arthrobacter sp. ES1 | 548 | Open in IMG/M |
| 3300015373|Ga0132257_102154093 | Not Available | 721 | Open in IMG/M |
| 3300016319|Ga0182033_10344170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 1245 | Open in IMG/M |
| 3300016319|Ga0182033_11610735 | Not Available | 587 | Open in IMG/M |
| 3300016371|Ga0182034_11441229 | Not Available | 602 | Open in IMG/M |
| 3300016404|Ga0182037_10510378 | Not Available | 1009 | Open in IMG/M |
| 3300017821|Ga0187812_1073812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1130 | Open in IMG/M |
| 3300017924|Ga0187820_1308122 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300017926|Ga0187807_1056166 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300017928|Ga0187806_1000756 | All Organisms → cellular organisms → Bacteria | 8003 | Open in IMG/M |
| 3300017939|Ga0187775_10407949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
| 3300017943|Ga0187819_10184381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1235 | Open in IMG/M |
| 3300017948|Ga0187847_10061689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 2111 | Open in IMG/M |
| 3300017955|Ga0187817_10158731 | Not Available | 1439 | Open in IMG/M |
| 3300017961|Ga0187778_10318933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1008 | Open in IMG/M |
| 3300017975|Ga0187782_10176232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1597 | Open in IMG/M |
| 3300017995|Ga0187816_10159800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 976 | Open in IMG/M |
| 3300018042|Ga0187871_10129864 | Not Available | 1434 | Open in IMG/M |
| 3300018044|Ga0187890_10763471 | Not Available | 547 | Open in IMG/M |
| 3300018044|Ga0187890_10883301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 504 | Open in IMG/M |
| 3300018060|Ga0187765_10158719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1281 | Open in IMG/M |
| 3300018060|Ga0187765_10485564 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300021474|Ga0210390_10280340 | Not Available | 1411 | Open in IMG/M |
| 3300021478|Ga0210402_11023915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes brasiliensis | 753 | Open in IMG/M |
| 3300021560|Ga0126371_10161617 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| 3300024254|Ga0247661_1040991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 841 | Open in IMG/M |
| 3300025634|Ga0208589_1075742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 814 | Open in IMG/M |
| 3300025898|Ga0207692_10827574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 606 | Open in IMG/M |
| 3300025906|Ga0207699_11449712 | Not Available | 508 | Open in IMG/M |
| 3300025915|Ga0207693_10017010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 5806 | Open in IMG/M |
| 3300025915|Ga0207693_10414981 | Not Available | 1052 | Open in IMG/M |
| 3300025915|Ga0207693_11078526 | Not Available | 611 | Open in IMG/M |
| 3300025915|Ga0207693_11468792 | Not Available | 504 | Open in IMG/M |
| 3300025928|Ga0207700_10330347 | Not Available | 1323 | Open in IMG/M |
| 3300025939|Ga0207665_10009468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 6396 | Open in IMG/M |
| 3300026067|Ga0207678_11159193 | Not Available | 684 | Open in IMG/M |
| 3300026089|Ga0207648_12062716 | Not Available | 531 | Open in IMG/M |
| 3300027853|Ga0209274_10293605 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300028379|Ga0268266_10805354 | Not Available | 907 | Open in IMG/M |
| 3300028381|Ga0268264_12670759 | Not Available | 503 | Open in IMG/M |
| 3300028877|Ga0302235_10058456 | Not Available | 1831 | Open in IMG/M |
| 3300028906|Ga0308309_10696068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 883 | Open in IMG/M |
| 3300030509|Ga0302183_10423513 | Not Available | 509 | Open in IMG/M |
| 3300031543|Ga0318516_10266050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 991 | Open in IMG/M |
| 3300031544|Ga0318534_10819768 | Not Available | 522 | Open in IMG/M |
| 3300031573|Ga0310915_11304960 | Not Available | 500 | Open in IMG/M |
| 3300031640|Ga0318555_10050092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2115 | Open in IMG/M |
| 3300031640|Ga0318555_10279478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 903 | Open in IMG/M |
| 3300031713|Ga0318496_10683351 | Not Available | 566 | Open in IMG/M |
| 3300031715|Ga0307476_10524461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes brasiliensis | 878 | Open in IMG/M |
| 3300031744|Ga0306918_10245555 | All Organisms → cellular organisms → Bacteria | 1365 | Open in IMG/M |
| 3300031744|Ga0306918_10887887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 695 | Open in IMG/M |
| 3300031747|Ga0318502_10073797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Crossiella | 1846 | Open in IMG/M |
| 3300031748|Ga0318492_10570223 | Not Available | 603 | Open in IMG/M |
| 3300031751|Ga0318494_10026267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2938 | Open in IMG/M |
| 3300031751|Ga0318494_10256346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1004 | Open in IMG/M |
| 3300031770|Ga0318521_10563313 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 687 | Open in IMG/M |
| 3300031798|Ga0318523_10098264 | All Organisms → cellular organisms → Bacteria | 1434 | Open in IMG/M |
| 3300031832|Ga0318499_10014231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2659 | Open in IMG/M |
| 3300031835|Ga0318517_10510840 | Not Available | 541 | Open in IMG/M |
| 3300031897|Ga0318520_10365710 | Not Available | 877 | Open in IMG/M |
| 3300031897|Ga0318520_11067140 | Not Available | 511 | Open in IMG/M |
| 3300031912|Ga0306921_11907713 | Not Available | 635 | Open in IMG/M |
| 3300031942|Ga0310916_11603979 | Not Available | 528 | Open in IMG/M |
| 3300032008|Ga0318562_10480316 | Not Available | 721 | Open in IMG/M |
| 3300032008|Ga0318562_10654833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_57_11 | 605 | Open in IMG/M |
| 3300032008|Ga0318562_10816547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 533 | Open in IMG/M |
| 3300032025|Ga0318507_10511166 | Not Available | 523 | Open in IMG/M |
| 3300032063|Ga0318504_10117213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1206 | Open in IMG/M |
| 3300032063|Ga0318504_10413618 | Not Available | 643 | Open in IMG/M |
| 3300032065|Ga0318513_10430736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 644 | Open in IMG/M |
| 3300032066|Ga0318514_10515743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300032076|Ga0306924_10363846 | All Organisms → cellular organisms → Bacteria | 1658 | Open in IMG/M |
| 3300032089|Ga0318525_10184958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella speibonae | 1071 | Open in IMG/M |
| 3300032090|Ga0318518_10371631 | Not Available | 734 | Open in IMG/M |
| 3300032091|Ga0318577_10013391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3283 | Open in IMG/M |
| 3300032160|Ga0311301_10180810 | All Organisms → cellular organisms → Bacteria | 3687 | Open in IMG/M |
| 3300032174|Ga0307470_11906720 | Not Available | 506 | Open in IMG/M |
| 3300032205|Ga0307472_100408652 | Not Available | 1138 | Open in IMG/M |
| 3300032205|Ga0307472_102491694 | Not Available | 526 | Open in IMG/M |
| 3300032261|Ga0306920_103203317 | Not Available | 612 | Open in IMG/M |
| 3300032261|Ga0306920_103474848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 583 | Open in IMG/M |
| 3300032770|Ga0335085_12334896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 534 | Open in IMG/M |
| 3300032828|Ga0335080_10380836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1517 | Open in IMG/M |
| 3300032896|Ga0335075_10155270 | All Organisms → cellular organisms → Bacteria | 2842 | Open in IMG/M |
| 3300033290|Ga0318519_10463742 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300033544|Ga0316215_1021715 | Not Available | 655 | Open in IMG/M |
| 3300033548|Ga0316216_1008633 | Not Available | 775 | Open in IMG/M |
| 3300033807|Ga0314866_064764 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300033808|Ga0314867_115195 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 22.07% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 17.93% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.83% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.45% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.76% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.07% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.38% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.38% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.69% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Host-Associated | Open in IMG/M |
| 3300033548 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE6 | Host-Associated | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1138946661 | 3300000956 | Soil | MDLLQGLGVRRPRPRRVPGPDAASAALSWIGDERIAISGVPS |
| Ga0062389_1042288971 | 3300004092 | Bog Forest Soil | MEVLRSVRAGRTRPRGGPGPDAAGPLLSWIGDERIAISAVPPARTVAGLAGLGV |
| Ga0066388_1023948232 | 3300005332 | Tropical Forest Soil | MEVLRSVRAGRPRPREAPGPGAAGWALSWIGDERIAISGVPSPRAVAGLAGQGVTHVV |
| Ga0066388_1066041001 | 3300005332 | Tropical Forest Soil | MEVLRSVRAGRPRPRRAPGTGAGSAALSWIGDERIAISGVPSARAVAGLA |
| Ga0066388_1079434271 | 3300005332 | Tropical Forest Soil | MEVPRSVRAGRPRRRGAPGPGAAGPALSWIGDERIAISGVPSARAV |
| Ga0068869_1003765532 | 3300005334 | Miscanthus Rhizosphere | MDLLRGVRARRPRQVPGPDAAGVALSWIGGERIAISGVPSPQGV |
| Ga0070682_1001191291 | 3300005337 | Corn Rhizosphere | MDLLRGVQARRPRRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQG |
| Ga0068868_1005667881 | 3300005338 | Miscanthus Rhizosphere | MDLLRGVRARRPRQVPGPDAAGVALSWIGGERIAISGVPSPQGVPHL |
| Ga0070671_1002762443 | 3300005355 | Switchgrass Rhizosphere | MDLLRGVQARRPRRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQGVT |
| Ga0070709_105897911 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVLRSVRAGQWRSREVPGTAAVGLSLSWIGDERIAVSGVPSAQMVARLAEQGVTHV |
| Ga0070709_109836291 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLLRGVRARRPRQVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQGVT |
| Ga0070709_114234671 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLLRGVRARRPPRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQGVT |
| Ga0070714_1007396262 | 3300005435 | Agricultural Soil | VDVLRSMRPGQWRSREVPGTAAVGLSLSWIGDERIAVSGVPSAQMVARLAEQGVTHVV |
| Ga0070714_1015625611 | 3300005435 | Agricultural Soil | MDLLRGVQARRPRRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQGV |
| Ga0070714_1018316831 | 3300005435 | Agricultural Soil | MDVLRSVRARRARPRGVPGPDAASAALSWIGDERIAISGVPSARTVASLAGQGVT |
| Ga0070714_1020388901 | 3300005435 | Agricultural Soil | MDLLRGVRARRPPRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQGV |
| Ga0070713_1007635751 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VDVLRSMRPGQWRSREVPGTAAVGLSLSWIGDERIAVSGVPSAQMVARLAEQGVTHVVN |
| Ga0070710_110361141 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VDLLRSVRVRRPRRVPGPDAADAALSWIGGERIAISGVPSPQGWLSWQ |
| Ga0070711_1005696732 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVLRSVRAGQWRPREVPGPAAASLSLSWIGDERIAVSGVPSAQMVA |
| Ga0070711_1015563421 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLLRGVQARRPRRVPGPDAVGVALSWIGGERIAISGVPSPQGV |
| Ga0070711_1018512022 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | VTAEGDMGVLRYVSAGLPRPRGLPGPDAAGAGLSWIGDERIAISGV |
| Ga0070707_1020477422 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVLRSVRARRTRPRVVPGPDAAGAALSWIGDERIAISGV |
| Ga0070696_1002300163 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLLRGVRARRPRQVPGPDAAGVALSWIGGERIAISGVPSP |
| Ga0070696_1008623352 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVLRSVRARRARPRVVPGPDAASAALSWIGDERIAISGV |
| Ga0066903_1034980493 | 3300005764 | Tropical Forest Soil | MEVLRSVRADRLRPREVPGPGAVSPALSWIGDERIAISGVPSARA |
| Ga0068870_101616852 | 3300005840 | Miscanthus Rhizosphere | MDLLRGVQARRPRRVPGPDAAGVALSWIGGERIAISGVPSPQGV |
| Ga0070717_103758393 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVLRSVRARGHPRGVPGPDAAGPVLSWIGDERIAISAVPPTRMVA |
| Ga0070717_120766172 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLLRGVQARRPRRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAE |
| Ga0070715_100017957 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVLRSVRARRARPRGVPGPDAASAALSWIGDERIAISGVP |
| Ga0070716_1000477551 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVLRSVRARRTRPRGVPGPDAAGAALSWIGDERIAISGVPPARTVACLAGQGVTHV |
| Ga0070716_1015460721 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLLRGVRARRPPRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQG |
| Ga0070712_1002025022 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVLRSVRAGQWRPREVAGPAAAGLSLSWIGDERIAVSGVPSAQMVARLAEQGVT |
| Ga0070712_1007492301 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VDVLRSMRPGQWRSREVPGTAAVGLSLSWIGDERIAVSGVP |
| Ga0068871_1010073591 | 3300006358 | Miscanthus Rhizosphere | MDVLRSVRARRARPRVVPGPDAASAALSWIGDERIAISGVPSARTVASLAGQGVTHVV |
| Ga0079220_102630033 | 3300006806 | Agricultural Soil | VGVLRSVRAGQWRSREVPGTAAVGLSLSWIGDERIAVSGVPSAQMVARLAE |
| Ga0079220_109426283 | 3300006806 | Agricultural Soil | MDVRRSVRAPWARPRGVPSPDAAGAALSWIGDERIAI |
| Ga0075435_1016717941 | 3300007076 | Populus Rhizosphere | MDLLRGVRARRPPRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQGVTHVVN |
| Ga0105250_101684261 | 3300009092 | Switchgrass Rhizosphere | MDLLRGVQARRPRRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQGVTHVVN |
| Ga0105245_108638741 | 3300009098 | Miscanthus Rhizosphere | MDLLRGVQARRPRRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQGVTH |
| Ga0116214_12690921 | 3300009520 | Peatlands Soil | MDVLRSVRARWPRPRGVPGPDAAGPALSWIGDERIAISGVPLALMVPCLAEQGVTHV |
| Ga0105237_124331852 | 3300009545 | Corn Rhizosphere | MDLLRGVRARRPRQVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLA |
| Ga0116216_100739303 | 3300009698 | Peatlands Soil | MDVLRSVRAGRPGPRGVPGPGAAGPLLSWIGDERIAISGVPSARTVGR |
| Ga0126374_100354823 | 3300009792 | Tropical Forest Soil | MAVLRSGRAGRPRPRGAPGAGAAGPALSWIGDERVAISGAPSARAVAGLAGQGVTHVV |
| Ga0126372_113164201 | 3300010360 | Tropical Forest Soil | MDVLRSVRARRARPRGVPGPDAAGPPLSWIGDERIAISGVPSARAVASLAGQGVTHV |
| Ga0126372_118696351 | 3300010360 | Tropical Forest Soil | MEVPRSVRAGRPRRRGAPGPGAAGPALSWIGDERIAISGVPSARAVA |
| Ga0126379_102361891 | 3300010366 | Tropical Forest Soil | MDVLRSVRARRARPRGVPGPDAAGPPLSWIGDERIAISGVPSARAVAS |
| Ga0126379_102433302 | 3300010366 | Tropical Forest Soil | MEVLRSVRAGRPRPREAPGPGAAGPALSWIGDERI |
| Ga0134125_127078492 | 3300010371 | Terrestrial Soil | MDLLRGVRARRPPRVPGPDAAGVALSWIGGERIAISGVPS |
| Ga0126381_1007122161 | 3300010376 | Tropical Forest Soil | MGVLRSVRAGLPRPRGVPGPYAAGPALSWIGDERIAISGVP |
| Ga0126381_1028613391 | 3300010376 | Tropical Forest Soil | MDVPWSLRARGPRPRGKPGPDAASPALTWIGDERIAISGVPSARTV |
| Ga0136449_1011724111 | 3300010379 | Peatlands Soil | MDVLRSVRAGRRRPRPRGAPGPGAVGPLLSWIGDERIAISGVP |
| Ga0126383_110047931 | 3300010398 | Tropical Forest Soil | MEVRRSVRAGRPRPRGAPGAGAAGPALSWIGDERIAISGVPSARAVAGLAGQGVTHVVNC |
| Ga0126369_110815023 | 3300012971 | Tropical Forest Soil | MDLLRGLRVHRPRPRVMPGPDAASAALSWIGSERIAISGVPSPRAVARLAALL |
| Ga0157370_106241842 | 3300013104 | Corn Rhizosphere | MDLLRGVQARRPRRVPGPDAVGVALSWIGGERIAISGVPSP |
| Ga0157374_121149432 | 3300013296 | Miscanthus Rhizosphere | MDLLRGVQARRPRRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHL |
| Ga0181537_110592142 | 3300014201 | Bog | MGVLESLRAGLLRPRVMPGTHAAGPALSWIGDERIAISGVPSARVVAGLAEQGVT |
| Ga0132257_1021540931 | 3300015373 | Arabidopsis Rhizosphere | MEVLRSVRARWPRPRGAPGPDATGPALSWIGDERIA |
| Ga0182033_103441703 | 3300016319 | Soil | MDVRRSVRVRRPRPRGPGTGAAGPLLSWIGDERIAISGVPSAQ |
| Ga0182033_116107351 | 3300016319 | Soil | MEVLRSVRAGRPRPRAAPGPGAAAPVLSWIGDERIAISGVPPARAVP |
| Ga0182034_114412292 | 3300016371 | Soil | MDLLRGLRVHRPRPRGMPGPDAASAALSWIGSERIAISGVPSPRAVARLAEQ |
| Ga0182037_105103781 | 3300016404 | Soil | MDVLRSVRARRPRPREVPGPAAASPALSWIGEERIAISG |
| Ga0187812_10738121 | 3300017821 | Freshwater Sediment | MDVLRSVRVRRPLPREVPGPGAAGPALSWIGDERIAISGV |
| Ga0187820_13081222 | 3300017924 | Freshwater Sediment | MDVLRSVRAYRPRSRGVPGPDAARPLLTWIGDERIAISGVPSAR |
| Ga0187807_10561662 | 3300017926 | Freshwater Sediment | MDVLRSVRIRWPRPRGMPGPDAASPAVSWIGDERIAISGVPPARTVACLAEQG |
| Ga0187806_100075610 | 3300017928 | Freshwater Sediment | MDVLRSVRVRRPLPREVPGPGAAGPALSWIGDERIAISGVPLARMVPC |
| Ga0187775_104079491 | 3300017939 | Tropical Peatland | MDVLRSVRARRTSPRGVAGPVAAGAALSWIGDERIAISGVPPARAV |
| Ga0187819_101843811 | 3300017943 | Freshwater Sediment | MDVLRSVRARWLRAVPATDAASPALSWIGDERIAISGVPSAQAV |
| Ga0187847_100616893 | 3300017948 | Peatland | MEVLRGVRARWPRPRGGPGPDAGGPVLSWIGGERIAISGVPPAWAV |
| Ga0187817_101587312 | 3300017955 | Freshwater Sediment | MDVLRSVRIRWPRPRGMPGPDAASPAVSWIGDERIAISGVP |
| Ga0187778_103189331 | 3300017961 | Tropical Peatland | MDVLRSVRAARPRPRGVPAPAAAGPSLSWIGDERIAVSGVPPTQAVASLAEQ |
| Ga0187782_101762324 | 3300017975 | Tropical Peatland | MDVLRSMRADRPRPRGVPRPDAAGPLLSWIGYERIAISGVPSAR |
| Ga0187816_101598002 | 3300017995 | Freshwater Sediment | MDVLRSVRARWPRPRGVPGPDAAGPALSWIGDERIAISGVPLARMVPCLAEQGVT |
| Ga0187871_101298642 | 3300018042 | Peatland | MEVLRGVRWPRPRGAPGPDAAGLSMSWIGDERIAISGVPSAWAVARLAEQG |
| Ga0187890_107634711 | 3300018044 | Peatland | MEVLRGVRARWPRPRAGPGPDAGGPALSWIGGERIAIS |
| Ga0187890_108833011 | 3300018044 | Peatland | MEVLGSMRARWPRPRGGSGPDAGGPALSWIGGERIAIS |
| Ga0187765_101587191 | 3300018060 | Tropical Peatland | MDVLRSVRARRRSPRGVAGPAAAGAALSWIGDERIAISGVP |
| Ga0187765_104855641 | 3300018060 | Tropical Peatland | MDVLRSLRARRTSPRGVAGPAAADAALSWIGDERIAISGVPSARAVAR |
| Ga0210390_102803401 | 3300021474 | Soil | MDVLRSVVRACRQRWVPGPDAASPALTWIGNERIAI |
| Ga0210402_110239152 | 3300021478 | Soil | MGVLGSLGAGLPRPRGVPGPGAAGPKLSWIGDERIAVSGVPSA |
| Ga0126371_101616173 | 3300021560 | Tropical Forest Soil | VGVLRSVRAGQWRPREVPGPAAAALSLSWIGDERIAVSGVPSAQMVARLAE |
| Ga0247661_10409911 | 3300024254 | Soil | MDLLRVVRVRRPQPRRVSGPDAASAALSWIGDERIAISGVPSPQAVVHL |
| Ga0208589_10757422 | 3300025634 | Arctic Peat Soil | MEVLRGVRARWPRPRGRPGPDAAGPALSWIGDERIAISGVPPAWA |
| Ga0207692_108275741 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVLRSVRAGQRRPREVPDPAAVGPSLSWIGDERIAISGVPSA |
| Ga0207699_114497121 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MGVLRSVRAGLPCPRGMPGPYAAGPGLSWIGDERIAVSGVPPARMAAG |
| Ga0207693_100170101 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVLRSVRARRARPRVVPGPDAASAALSWIGDERIAISGVPPARTVACLAGQGVTHV |
| Ga0207693_104149811 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVLRSVRAGQWRPREVAGPAAAGLSLSWIGDERIAVSGVPSAQMVARLAEQGV |
| Ga0207693_110785261 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVLRSVRARRARPCGVPGPDAASPALSWIGDERIAISGVPPARTVACLAGQGVTHV |
| Ga0207693_114687921 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VDVLRSMRPGQWRSREVPGTAAVGLSLSWIGDERIAVS |
| Ga0207700_103303471 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VGVLRSVRAGQWRSREVPGTAAVGLSLSWIGDERIAVSGVPSAQMVARLAEQGVTHVV |
| Ga0207665_100094687 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MDVLRSVRARRARPRVVPGPDAASAALSWIGDERIAISGVPSARTVAS |
| Ga0207678_111591931 | 3300026067 | Corn Rhizosphere | MDVLRSVRARRARPRVVPGPDAASAALSWIGDERIAISGVP |
| Ga0207648_120627161 | 3300026089 | Miscanthus Rhizosphere | MDLLRGVQARRPRRVPGPDAVGVALSWIGGERIAISGVPSPQGVAHLAE |
| Ga0209274_102936051 | 3300027853 | Soil | LRALLLRLVGADAAGPALSWIGDERIAISAVPPVATVAGLAEQGVTHV |
| Ga0268266_108053542 | 3300028379 | Switchgrass Rhizosphere | MDLLRGVQARRPRRVPGPDAAGVALSWIGGERIAISGVPSPQGVPHLAEQGVTHV |
| Ga0268264_126707591 | 3300028381 | Switchgrass Rhizosphere | MDVLRSVRARRARPRGVPGPDAASAALSWIGDERIAISGVPS |
| Ga0302235_100584564 | 3300028877 | Palsa | MEVLRGVRWPRPRGAPGPDAAGLSLSWIGDERIAISGVPSAWAVARL |
| Ga0308309_106960681 | 3300028906 | Soil | MNVLRNVRAGWSYAHGGPGPDAAAPALSWIGDERIAISGVPSAA |
| Ga0302183_104235131 | 3300030509 | Palsa | MEVLRGVRVRWPRPRGAPGPDAAGLSLSWIGDERIAISGVPS |
| Ga0318516_102660501 | 3300031543 | Soil | MEVLRSVRAGRPRPREAPGPGAAGAALSWIGDERIAISGVPSARALAG |
| Ga0318534_108197681 | 3300031544 | Soil | MEVLRSVRAGRPRPREAPGPGAAGAALSWIGDERIAIS |
| Ga0310915_113049601 | 3300031573 | Soil | MDVRRSVGVRRPRPGGVPGPSAARPLLSWIGDERIAISGVPPARTV |
| Ga0318555_100500921 | 3300031640 | Soil | MDVRRSVGVRRPRPGGVPGPSAARPLLSWIGDERIAISGLPPAR |
| Ga0318555_102794781 | 3300031640 | Soil | MDVLRSVRARRTSPRGVAGPAAAGAALSWIGDERIAISSVPSA |
| Ga0318496_106833513 | 3300031713 | Soil | MEVLRSVRAGRPRPREAPGPGAAGAALSWIGDERIAISGVP |
| Ga0307476_105244611 | 3300031715 | Hardwood Forest Soil | MGVLGSLGAGRPRPRGVPVPGAAGQALSWIGDERIAVSGVPSARMVAGLAEQGV |
| Ga0306918_102455552 | 3300031744 | Soil | MEVLRSVRAGRPRPREAPGPGAAGAALSWIGDERIAISGVPSARAVAGLAGQGVTHVV |
| Ga0306918_108878873 | 3300031744 | Soil | MDVLRSLRAGGPRLRGMPGPEAASPALTWIGDERIAISGVPSSRTV |
| Ga0318502_100737971 | 3300031747 | Soil | MDVLRSVRVRRPRPPGMPGPGAAGPLLSWIGDERIA |
| Ga0318492_105702232 | 3300031748 | Soil | MEVLRSVRAGRPRPREAPGPGAAGAVLSWIGDERIAISGVPSARAPRA |
| Ga0318494_100262671 | 3300031751 | Soil | MDVRRSVRVRRPRPRGPGTGAAGPMLSWIGDARIAISGVPSAQTVAD |
| Ga0318494_102563462 | 3300031751 | Soil | MDLLRGLRVHRPRPRGMPGPDAVGAALSWIGSERIAISGVPSPR |
| Ga0318521_105633131 | 3300031770 | Soil | MDVLRSVRARRTSPRGVAGPAAAGAALSWIGDERIAISSVPSAQAMARLAEQGVTH |
| Ga0318523_100982641 | 3300031798 | Soil | MEVLRSVRAGRPRPREAPGPGAAGAALSWIGDERIAISGVPSARAPRV |
| Ga0318499_100142311 | 3300031832 | Soil | MDVLRSVRARRPRPREVPGPAAASPALSWIGEERIAISGVPPARTVAHR |
| Ga0318517_105108402 | 3300031835 | Soil | MDLLRGLRVHRPRPRGMPGPDAASAALSWIGSERIAISGVPS |
| Ga0318520_103657101 | 3300031897 | Soil | MDVLRSVRVRRPRPPGMPGPGAAGPLLSWIGDERIAISGVPSARTVA |
| Ga0318520_110671402 | 3300031897 | Soil | MDVLRSLRARGPRPRGMPGPDAASPALTWIGDERIAISGVPPARTVARLAE |
| Ga0306921_119077131 | 3300031912 | Soil | MDVLRSVRARRPRPREVPGPAAASPALSWIGEERIAISGVPPARTVARLAEQGVTHVV |
| Ga0310916_116039792 | 3300031942 | Soil | MDVLRSVRVRRPRPPGMPGPGAAGPLLSWIGDERIAISGVPSARTVAG |
| Ga0318562_104803162 | 3300032008 | Soil | MEVLRSVRAGRPRPRAAPGPGAAAPVLSWIGDERI |
| Ga0318562_106548331 | 3300032008 | Soil | MEVLRSVRAGRPRPREAPGPGAAGAALSWIGDERIAISGV |
| Ga0318562_108165472 | 3300032008 | Soil | MDVLRSLRAGGPRPRGMPGPEAASPALTWIGDERIAISGVP |
| Ga0318507_105111661 | 3300032025 | Soil | MDVLRSVRARRPRPREVPGPAAASPALSWIGEERIAISGVPPARA |
| Ga0318504_101172135 | 3300032063 | Soil | MDVLRSVRVRRPRPPGMPGPGAAGPLLSWIGDERIAISGVPSARTVAGLAEQGV |
| Ga0318504_104136181 | 3300032063 | Soil | MDVLRSVRARRPRPREVPGPAAASPALSWIGEERIAISGVPPARTVARLA |
| Ga0318513_104307361 | 3300032065 | Soil | MDVRRSVRVRRPRPRGPGTGAAGALLSWIGDERIAISGVPSAQTVADLAEQGVTHVVN |
| Ga0318514_105157431 | 3300032066 | Soil | MDVLRSLRAGGPRLRGMPGAEAASPALTWIGDERIAVSGVPSSRTVAR |
| Ga0306924_103638461 | 3300032076 | Soil | MEVLRSVRAGRPRLREAPRPGAASPALSWIGDERIAISGV |
| Ga0318525_101849583 | 3300032089 | Soil | MEVLRSVRAGRPRPREAPGPGAAGAALSWIGDERI |
| Ga0318518_103716312 | 3300032090 | Soil | MEVLRSVRAGRPRPRAAPGPGAAAPVLSWIGDERIAISGVPPARAVPGLAGQGVT |
| Ga0318577_100133914 | 3300032091 | Soil | MDVLRSVRARRPRPREVPGPAAASPALSWIGEERIAISGVPPARTVARLAEQGVTHVVN |
| Ga0311301_101808101 | 3300032160 | Peatlands Soil | MDVLRSVRAGRPRPRGVPGPGAAGPLLSWIGDERIAISGVPSARTVGRLAE |
| Ga0307470_119067201 | 3300032174 | Hardwood Forest Soil | MDVLRSVRARRARPRVVPGPDAAGAALSWIGDERIAISGVPPAR |
| Ga0307472_1004086523 | 3300032205 | Hardwood Forest Soil | MDVLWSVRARRTRPCGVPGPDAASAALSWIGDERIAISGVPPARTV |
| Ga0307472_1024916941 | 3300032205 | Hardwood Forest Soil | MDVLRSVRARRARPRGVPGPDAASAALSWIGDERIAISGV |
| Ga0306920_1032033171 | 3300032261 | Soil | MDVLRSVRARRPRPREVPGPAAASPALSWIGEERIAISGVPPARTVARLAE |
| Ga0306920_1034748482 | 3300032261 | Soil | MDVRRSVRVRRPRPRGPGTGAAGALLSWIGDERIAISGVPSAQTVADLAEQGVTHV |
| Ga0335085_123348961 | 3300032770 | Soil | MDLLRGVRARRPRRVPGPDAAAAALSWIGGERIAIS |
| Ga0335080_103808361 | 3300032828 | Soil | MDVLRGVRARWASPRGVAGPAAAGAALSWIGDERIAISGVPSARAVAR |
| Ga0335075_101552705 | 3300032896 | Soil | MDVLRSVRTGRPRLRPVPGPDAASPLLTWIGDERIAISGVPSALAVACLGDRA |
| Ga0318519_104637422 | 3300033290 | Soil | MEVLRSVRAGRPRPREAPGPGAAGAVLSWIGDERIAISGVPSA |
| Ga0316215_10217152 | 3300033544 | Roots | MGVLESLRAGLPRPRVMPGPVAASPVLSWIGDERIAISSVPSARVV |
| Ga0316216_10086333 | 3300033548 | Roots | MGVLESLRAGLPRPRVMPGPVAASPVLSWIGDERIAI |
| Ga0314866_064764_435_617 | 3300033807 | Peatland | MTVIPEAGMDVLRSLLAGRPRPRAESGPAAPFTALSWIAGERIAISGVPPAAAVPGLAAH |
| Ga0314867_115195_3_191 | 3300033808 | Peatland | MTVILEAGMDVLRSLLAGRPRPRAESGPAAPFTALSWIAGERIAISGVPPAAAVPGLAGHGVT |
| ⦗Top⦘ |