NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050570

Metagenome / Metatranscriptome Family F050570

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050570
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 44 residues
Representative Sequence SILKRSLDRQTTLELESGKPGPRHENVRGAGYYDPPTTLLQ
Number of Associated Samples 130
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.69 %
% of genes near scaffold ends (potentially truncated) 98.62 %
% of genes from short scaffolds (< 2000 bps) 99.31 %
Associated GOLD sequencing projects 124
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.552 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(13.793 % of family members)
Environment Ontology (ENVO) Unclassified
(26.207 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.379 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.59%    β-sheet: 0.00%    Coil/Unstructured: 88.41%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF08483Obsolete Pfam Family 95.86
PF01695IstB_IS21 2.07
PF13602ADH_zinc_N_2 0.69
PF03781FGE-sulfatase 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 2.07
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.69

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.55 %
UnclassifiedrootN/A23.45 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_13724526All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300004081|Ga0063454_101427014All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300004092|Ga0062389_101418533All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300004153|Ga0063455_101251268All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005093|Ga0062594_102534462All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005186|Ga0066676_10490100All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300005354|Ga0070675_100833965All Organisms → cellular organisms → Bacteria843Open in IMG/M
3300005556|Ga0066707_10341399All Organisms → cellular organisms → Bacteria980Open in IMG/M
3300005557|Ga0066704_10999069All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300005591|Ga0070761_10902685All Organisms → cellular organisms → Bacteria558Open in IMG/M
3300005610|Ga0070763_10242024All Organisms → cellular organisms → Bacteria975Open in IMG/M
3300005618|Ga0068864_101850287All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300006174|Ga0075014_100660396All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300007004|Ga0079218_12196255All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300009089|Ga0099828_11840873All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300009100|Ga0075418_11427845All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300009635|Ga0116117_1145840All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300009640|Ga0116126_1250130Not Available556Open in IMG/M
3300009645|Ga0116106_1251262All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300009701|Ga0116228_10463874All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300009709|Ga0116227_11366788Not Available532Open in IMG/M
3300009839|Ga0116223_10398056Not Available810Open in IMG/M
3300010047|Ga0126382_11002162All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300010337|Ga0134062_10101839All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1233Open in IMG/M
3300010361|Ga0126378_10191077All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2119Open in IMG/M
3300010366|Ga0126379_13209283Not Available547Open in IMG/M
3300010396|Ga0134126_11529399All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300010398|Ga0126383_11033373Not Available911Open in IMG/M
3300010398|Ga0126383_13697839All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300011269|Ga0137392_11239398All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300011269|Ga0137392_11517424All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300012096|Ga0137389_10489059Not Available1055Open in IMG/M
3300012198|Ga0137364_10980485All Organisms → cellular organisms → Bacteria639Open in IMG/M
3300012210|Ga0137378_10669146All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300012210|Ga0137378_10747413Not Available890Open in IMG/M
3300012211|Ga0137377_10293591All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1560Open in IMG/M
3300012349|Ga0137387_10765768All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300012349|Ga0137387_11145715All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300012582|Ga0137358_10656458All Organisms → cellular organisms → Bacteria702Open in IMG/M
3300012930|Ga0137407_11674467All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300012944|Ga0137410_11532659All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300012988|Ga0164306_11278439Not Available619Open in IMG/M
3300013105|Ga0157369_12338857All Organisms → cellular organisms → Bacteria541Open in IMG/M
3300013307|Ga0157372_12357456All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300013307|Ga0157372_13215528All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300014165|Ga0181523_10110885All Organisms → cellular organisms → Bacteria → Acidobacteria1641Open in IMG/M
3300014201|Ga0181537_10819040Not Available631Open in IMG/M
3300014501|Ga0182024_11735998All Organisms → cellular organisms → Bacteria701Open in IMG/M
3300014838|Ga0182030_10269306All Organisms → cellular organisms → Bacteria1920Open in IMG/M
3300015089|Ga0167643_1009515All Organisms → cellular organisms → Bacteria1407Open in IMG/M
3300015206|Ga0167644_1061793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1274Open in IMG/M
3300016294|Ga0182041_10688729All Organisms → cellular organisms → Bacteria905Open in IMG/M
3300016404|Ga0182037_11649238All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300017928|Ga0187806_1350758All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300017930|Ga0187825_10238424All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300017931|Ga0187877_1070210Not Available1529Open in IMG/M
3300017946|Ga0187879_10652940All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300017955|Ga0187817_11083427All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300018014|Ga0187860_1390793Not Available523Open in IMG/M
3300018016|Ga0187880_1308727All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300018026|Ga0187857_10142203Not Available1144Open in IMG/M
3300018034|Ga0187863_10441170All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300018047|Ga0187859_10079195All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1730Open in IMG/M
3300018062|Ga0187784_11699450All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300020002|Ga0193730_1113876All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300020004|Ga0193755_1134855All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300020018|Ga0193721_1110110All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300020583|Ga0210401_11237947All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300021170|Ga0210400_11667079All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300021344|Ga0193719_10151409All Organisms → cellular organisms → Bacteria1001Open in IMG/M
3300021401|Ga0210393_10883220All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300021402|Ga0210385_10985214All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300021403|Ga0210397_11356026All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300021432|Ga0210384_10330058All Organisms → cellular organisms → Bacteria → Acidobacteria1374Open in IMG/M
3300021560|Ga0126371_13041088All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300024288|Ga0179589_10306735All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300025454|Ga0208039_1049033All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300025457|Ga0208850_1077700Not Available534Open in IMG/M
3300025500|Ga0208686_1114753All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300025898|Ga0207692_10583136All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300025906|Ga0207699_11228012All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300025920|Ga0207649_10672502All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300025927|Ga0207687_11498712All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300025932|Ga0207690_10514114Not Available970Open in IMG/M
3300025961|Ga0207712_10484159All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300026095|Ga0207676_10548118All Organisms → cellular organisms → Bacteria → Acidobacteria1104Open in IMG/M
3300026291|Ga0209890_10134872Not Available831Open in IMG/M
3300026322|Ga0209687_1306154Not Available506Open in IMG/M
3300026515|Ga0257158_1008846All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1509Open in IMG/M
3300026552|Ga0209577_10786052All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300027370|Ga0209010_1037604Not Available827Open in IMG/M
3300027678|Ga0209011_1182645All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300027879|Ga0209169_10307425All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300027879|Ga0209169_10332223All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300027882|Ga0209590_10203920All Organisms → cellular organisms → Bacteria1250Open in IMG/M
3300027884|Ga0209275_10660602All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300027915|Ga0209069_10221480Not Available973Open in IMG/M
3300028566|Ga0302147_10035831Not Available1779Open in IMG/M
3300028747|Ga0302219_10269043All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300028759|Ga0302224_10329430All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300028819|Ga0307296_10800887All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300028906|Ga0308309_10448117All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300028906|Ga0308309_11255485All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300029922|Ga0311363_11312418All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300029945|Ga0311330_10723885Not Available764Open in IMG/M
3300029955|Ga0311342_11344351Not Available506Open in IMG/M
3300030007|Ga0311338_11311551All Organisms → cellular organisms → Bacteria679Open in IMG/M
3300030007|Ga0311338_11612582All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300030013|Ga0302178_10127943Not Available1280Open in IMG/M
3300030057|Ga0302176_10210336All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300030058|Ga0302179_10092545All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1337Open in IMG/M
3300030058|Ga0302179_10138950Not Available1073Open in IMG/M
3300030294|Ga0311349_12048089All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300030399|Ga0311353_10843121All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300030503|Ga0311370_11763278All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300030509|Ga0302183_10225335All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300030617|Ga0311356_10438113Not Available1285Open in IMG/M
3300030617|Ga0311356_11286033All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300030618|Ga0311354_11411713Not Available620Open in IMG/M
3300030659|Ga0316363_10418838Not Available518Open in IMG/M
3300030688|Ga0311345_10247532All Organisms → cellular organisms → Bacteria → Acidobacteria1745Open in IMG/M
3300030746|Ga0302312_10119931Not Available1059Open in IMG/M
3300030815|Ga0265746_1026648All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300031233|Ga0302307_10152707All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1198Open in IMG/M
3300031233|Ga0302307_10168953Not Available1132Open in IMG/M
3300031234|Ga0302325_11414534Not Available903Open in IMG/M
3300031234|Ga0302325_13107171All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300031236|Ga0302324_100478816All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1826Open in IMG/M
3300031455|Ga0307505_10319699All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300031471|Ga0272439_1291015All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300031679|Ga0318561_10659157Not Available576Open in IMG/M
3300031708|Ga0310686_102879328Not Available1139Open in IMG/M
3300031708|Ga0310686_113705531All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300031768|Ga0318509_10251423Not Available987Open in IMG/M
3300031788|Ga0302319_11078926All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300031795|Ga0318557_10431539All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031798|Ga0318523_10309635All Organisms → cellular organisms → Bacteria788Open in IMG/M
3300032001|Ga0306922_11436469All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300032055|Ga0318575_10579505All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300032059|Ga0318533_10407636Not Available993Open in IMG/M
3300032783|Ga0335079_10688860All Organisms → cellular organisms → Bacteria → Acidobacteria1069Open in IMG/M
3300032783|Ga0335079_11524563All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300032892|Ga0335081_11138915Not Available895Open in IMG/M
3300032892|Ga0335081_11410473All Organisms → cellular organisms → Bacteria778Open in IMG/M
3300033158|Ga0335077_11198948All Organisms → cellular organisms → Bacteria743Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa13.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.34%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.90%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.83%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.83%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.14%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.45%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.45%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.07%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.07%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.38%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.38%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil1.38%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.38%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.38%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.38%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.38%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated1.38%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.69%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.69%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.69%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.69%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.69%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.69%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.69%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.69%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.69%
RockEnvironmental → Terrestrial → Rock-Dwelling (Endoliths) → Unclassified → Unclassified → Rock0.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.69%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009635Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009701Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015089Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300015206Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8B, Adjacent to main proglacial river, end of transect (Watson river))EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020018Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025500Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026291Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026515Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-AEnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027370Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028566Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E3_2EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028759Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029922III_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029955II_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030058Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030509Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2EnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_1EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031471Rock endolithic microbial communities from Victoria Land, Antarctica - Knobhead sudEnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1372452613300000363SoilDRQTALPLEPERPGPQHENVRGAQYFNPPTNLLQ*
Ga0063454_10142701413300004081SoilSLRSILKRSLDRQTTLDPEPGKSGPQHENVRGPNYYDPPTTLLQ*
Ga0062389_10141853313300004092Bog Forest SoilQAFSYQSLKSILKRSLDRQLVFDPEAVPPGPRHENLRGPLYYDPPTKLVQ*
Ga0063455_10125126813300004153SoilLKRSLDRQTTLDLETGKPGPRHENVRGADYYDPPTTLLQ*
Ga0062594_10253446213300005093SoilACSYQSLKSILQRSLDRQPVLEPETRKPGPQHKNLRGPHYYDPPTTLLQ*
Ga0066676_1049010023300005186SoilQRAMLLGACSYQSLKSILKRSLDQQTVLELECEKSGPHHGNVRGARYYDGPPNPRLQ*
Ga0070675_10083396513300005354Miscanthus RhizosphereSLRSILKRSLDRQTTLELEAGKPGPRHENVRGAGYYDPPPRLLQ*
Ga0066707_1034139913300005556SoilSLRSILKRSLDRQTTLALESGKPGPRHENVRGADYYDPPTTLLQ*
Ga0066704_1099906923300005557SoilSILKNSLDRQLSLEPDSNKSGPRHENVRGADYYDPPNTFLQ*
Ga0070761_1090268523300005591SoilELGACSHQSLKSILKSSLDRQAALPLEPERSGPRHENIRGARYFNPPTNLPQ*
Ga0070763_1024202413300005610SoilGACSYQSLKSILQRSLDRQTTLPLEPERTGPRHENVRGARYYDPPTTLLQ*
Ga0068864_10185028723300005618Switchgrass RhizosphereSILKRGLDRQTTLVLEPDRSGPKHENIRGAHYYDPPTTLLQ*
Ga0075014_10066039613300006174WatershedsKRSLDQQPVLELETEKPGPHHDNIRGAAYYDSPPGGLLQ*
Ga0079218_1219625513300007004Agricultural SoilGACSYQSLKSILKRSLDQQPVLELDIEKAGRHHGNVRGAQYYNTPPDTLLQ*
Ga0099828_1184087313300009089Vadose Zone SoilYQSLKSILKRSLDRQLLLDLEAVAPGPRHENLRGPLYYDPPTKLVQ*
Ga0075418_1142784513300009100Populus RhizosphereMKLPNAPALELETSKPGPQHENLRGPHYYDPPTTLLQ*
Ga0116117_114584013300009635PeatlandSYSSLRSILKRSLDRQTTLELEPGKPGPRHQNVRGAGYYDPPTTLLQ*
Ga0116126_125013013300009640PeatlandLQAFSYQSLKSILKRSLDRQLVLDSEAVPPGPRHENLRGPLYYDPPTKLVQ*
Ga0116106_125126223300009645PeatlandSYQSLKSILKRSLDRQTELELEVEKPGPQHDNIRGATYYDPPPTSLL*
Ga0116228_1046387413300009701Host-AssociatedSILKNSLDRQILLEPDNNQAGPRHENVRGADYYDPPNSISLP*
Ga0116227_1136678813300009709Host-AssociatedSYQSLKSILKRGLDRQTTLALEPDRSGPKHENVRGAHYYDPPTTLLQ*
Ga0116223_1039805613300009839Peatlands SoilRAHSYQSLKSILKRSLDRQTELELEVEKPGPQHDNIRGATYYDPPPPSFLQ*
Ga0126382_1100216223300010047Tropical Forest SoilETCSYHSLRSILKHSLDRQLWLDPDHDKSGPQHHNLRGARYYDPPTTLLQ*
Ga0134062_1010183933300010337Grasslands SoilMLLGACSYQSLKSILKRSLDQQTVLELECEKSGPHHGNVRGARYYDGPPNPRLQ*
Ga0126378_1019107753300010361Tropical Forest SoilRSILKRSLDRQLTLEPENSKPGPRHENVRGASYYDPPTTLLQ*
Ga0126379_1320928323300010366Tropical Forest SoilLKSILKRSLDRQPLLDPEATAPGPRHENLRGPLYYDPPTKLVQ*
Ga0134126_1152939913300010396Terrestrial SoilSYQSLRSILKNSLDPQLMIEPDSKKSGARHENVRGADYYDPPKTFLQ*
Ga0126383_1103337323300010398Tropical Forest SoilLKSILKRSLDRQLVLDTDTARSGPPHENLRGPHYYDPPTTLQ*
Ga0126383_1369783913300010398Tropical Forest SoilNSLDRQLLLEPEAAHPGPHHENLRGPHYYDPPTTLLQ*
Ga0137392_1123939813300011269Vadose Zone SoilRSLDRQLLLDSEAVAPGPRHENLRGPLYYDPPTKLVQ*
Ga0137392_1151742413300011269Vadose Zone SoilACSYSSLRSILKRSLDRQTTLALESGKPGPRHENVRGADYYDPPTTLLQ*
Ga0137389_1048905913300012096Vadose Zone SoilLKSILKNSLDRQLLLESEAAHPGPEHENLRGPHYYDPPTTLVQ*
Ga0137364_1098048523300012198Vadose Zone SoilDRQLSLEPDSDKSGPRHENVRGADYYDPPNTFLQ*
Ga0137378_1066914613300012210Vadose Zone SoilLKSILKRGLDRQATLALEPDRSGPKHENIRGAHYYDPPTTLLQ*
Ga0137378_1074741313300012210Vadose Zone SoilYQSLKSILKRSLDQQTVLELDNEKSGPHHDNVRGARYYDGPPNPRLQ*
Ga0137377_1029359113300012211Vadose Zone SoilKSILKNSLDRQLRLEPEAAHPGPEHENVRGPHYYDPPTTLVQEPVQKESAC*
Ga0137387_1076576823300012349Vadose Zone SoilYSSLRSILKRSLDGQTTLALESGKPGPRHENVRGADYYDPPTTLLQ*
Ga0137387_1114571513300012349Vadose Zone SoilKHSLDRQLWLDPDPDKSGPKHQNLRGARYYDPPTPLLQ*
Ga0137358_1065645813300012582Vadose Zone SoilLKSILKRSLDRQTALPLEPERSGPRHENIRGAQYFNPPTNLLQ*
Ga0137407_1167446723300012930Vadose Zone SoilDRQLLLNPEAVAPGPRHENLRGPFYYDPPTKLVQ*
Ga0137410_1153265913300012944Vadose Zone SoilSILKHSLDRQLLLEPEAAHPGPEHENLRGPHYYAPPTTLVQ*
Ga0164306_1127843913300012988SoilKRSLDRQTTLDLESGKSGPQHENVRGADYYDPPTTLLQ*
Ga0157369_1233885713300013105Corn RhizosphereKSILKRSLDRQTSLPMEPERTGPRHENVRGAHYYDPPTTLLQ*
Ga0157372_1235745623300013307Corn RhizosphereKNSLDRQLSLEPDSDKSGPRHENVRGADYYDPPNTFLQ*
Ga0157372_1321552823300013307Corn RhizosphereSLDRQTTLDLEPGKPGPRHENVRGADYYDPPTTLLQ*
Ga0181523_1011088533300014165BogRSLDRQTVLELEVEKPGPQHDNIRGATYYDPPPTSLLQ*
Ga0181537_1081904013300014201BogLLQAHSYQSLKSILKRSLDRQTQLELEVEKPGPQHENIRGATYYDPPPTSLLQ*
Ga0182024_1173599823300014501PermafrostLQACSYSSLRSILKRSLDRQTTLELEPGKPGPRHENLRGPNYYDPPTTLLQ*
Ga0182030_1026930643300014838BogILKRSLDRQPALEPETSKPGPQHENLRGPHYYDPPTTLLQ*
Ga0167643_100951533300015089Glacier Forefield SoilAHSYQSLKSILKRSLDRQTELELEVEKPGPQHDNVRGATYYDPLATSFLE*
Ga0167644_106179333300015206Glacier Forefield SoilSLKSILKRSLDRQTTLPLEPERTGPRHENVRGAHYYDPPTTLLQ*
Ga0182041_1068872913300016294SoilYTSLHSMLKHSLDRQLTLEPENSKPGPRHENVRGACYYDPPTTLLQ
Ga0182037_1164923813300016404SoilTCSYQSLKSILKRSLDRQLLLEAEAAQPGPQHENLRGPHYYDPPTTLVQ
Ga0187806_135075823300017928Freshwater SedimentSILKRSLDRQLLLDSEAVAPGPRHENLRGPLYYDPPTKLVQ
Ga0187825_1023842423300017930Freshwater SedimentLKSILKRSLDRQLVFNPETVASGPQHENLRGPLYYDPPTKLVQ
Ga0187877_107021013300017931PeatlandLLLHAHSYQSLKSILKRSLDRQTELELEVEKPGPQHDNIRGATYYDPPPTSLLQ
Ga0187879_1065294013300017946PeatlandSLKSILKRSLDRQTVLELEVERPGPKHDNIRGATYYDPPPSSLLQ
Ga0187817_1108342713300017955Freshwater SedimentLKRSLDRQLLLDSEAVAPGPRHENLRGPLYYDPPTKLVQ
Ga0187860_139079313300018014PeatlandSLKSILKRSLDRQTELELEVEKPGPQHDNIRGATYYDPPPSSLLQ
Ga0187880_130872713300018016PeatlandQACSYSSLRSILKRSLDRQTTLALESGKPGPRHENVRGADYYDPPTTLLQ
Ga0187857_1014220313300018026PeatlandSLKSILKRSLDRQTELELEVEKPGPQHDNIRGATYYDPPPTSLL
Ga0187863_1044117013300018034PeatlandRSLDRQTTLTLEPDRPGPEHENVRGAHYYDPPTTLLQ
Ga0187859_1007919533300018047PeatlandILKRSLDRQTTLTLEPDRPGPEHENVRGAHYYDPPTTLLQ
Ga0187784_1169945023300018062Tropical PeatlandHSLDRQLLLESEAAHPGPQHENLRGPHYYDPPLPLVQ
Ga0193730_111387613300020002SoilRSILKRSLDRQTTLELESGKPGPRHENVRGAGYYDPPTTLLQ
Ga0193755_113485513300020004SoilSILKRSLDRQTTLELESGKPGPRHENVRGAGYYDPPTTLLQ
Ga0193721_111011023300020018SoilLKRSLDRQTTLELESGKPGPRHENVRGAGYYDPPTTLLQ
Ga0210401_1123794723300020583SoilILKRSLDRQLLLDPEAVAPGPRHENLRGPLYYDPPTKLVQ
Ga0210400_1166707913300021170SoilLELGACSYQSLKSILQRSLDRQTTLPLEPERTGPRHENVRGARYYDPPTTPLQ
Ga0193719_1015140913300021344SoilRSLDRQPVLEPETRKPGPQHENLRGPHYYDPPTTLLQ
Ga0210393_1088322013300021401SoilRALLLRAHSYPSLKSILKRSLDRQTVLELEVEKPGPQHDNIRGATYYDPPPTSLLQ
Ga0210385_1098521423300021402SoilSLKSILKRSLDRQRLLDTETAQPGPQHENLRGPNYYDPPTTLVQ
Ga0210397_1135602613300021403SoilLARQLPLDVEAVAPGPRHENLRGPLYYDPPTKLVQ
Ga0210384_1033005813300021432SoilKRSLDRQTTLALESGKPGPRHENVRGADYYDPPTTLLQ
Ga0126371_1304108813300021560Tropical Forest SoilSYPSLKSILKRSLDRQTSLPMEPERTGPRHENLRGAHYYDPPTTLLH
Ga0179589_1030673513300024288Vadose Zone SoilVLILKRSLDRQTTLELESGNPGPRHENVRGPGYYDPPTTLLQ
Ga0208039_104903323300025454PeatlandSQRALLLHAHSYQSLKSILKRSLDRQTVLELEVERPGPKHDNIRGATYYDPPPSSLLQ
Ga0208850_107770013300025457Arctic Peat SoilSQRALLLHAHSYQSLKSILKRSLDRQTELELEVEKPGPKHDNIRGATYYDPPPSSLLQ
Ga0208686_111475323300025500PeatlandSYQSLKSILKRSLDRQTELELEVEKPGPQHDNIRGATYYDPPPTSLL
Ga0207692_1058313623300025898Corn, Switchgrass And Miscanthus RhizosphereYSSLHSILKRSLDRQTTLDLESGKSGPRHENVRGADYYAAPASAEVAG
Ga0207699_1122801223300025906Corn, Switchgrass And Miscanthus RhizosphereLQACSYTSLRSILKRSLDRQLTIDPEPAQPGPRHENLRGAAYYDPPTTLLQ
Ga0207649_1067250213300025920Corn RhizosphereLELGACSYQSLKSILKRSLDRQTSLPLEPERTGPRHENVRGAHYYDPPTTLLQ
Ga0207687_1149871223300025927Miscanthus RhizosphereLKRSLDRQTTLELEAGKPGPRHENVRGAGYYDPPPRLLQ
Ga0207690_1051411413300025932Corn RhizosphereILKRSLDRQTTLDLESGKSGPRHENVRGADYYDPPTTLLQ
Ga0207712_1048415913300025961Switchgrass RhizosphereLRSILKRSLDKQTTLELEPGKPGPRHENVRGAGYYDPPTTLLQ
Ga0207676_1054811823300026095Switchgrass RhizosphereQSLKSILQRSLDRQTTLPLEPERTGPRHENVRGARYYDPPTTLLQ
Ga0209890_1013487223300026291SoilKRSLDRQTELELDIEKPGPQHDNVRGAAYYDPPSTSLLQ
Ga0209687_130615423300026322SoilSILKNSLDRQLSLEPDSNKSGPRHENVRGADYYDPPNTFLQ
Ga0257158_100884643300026515SoilMLKRSLDRQLLLDDGTAQPGPQHENLRGPHYYDPPSRLVQ
Ga0209577_1078605213300026552SoilLKRSLDRQTTPDLETGKPGPRHENVRGADYYDPPTTLLQ
Ga0209010_103760413300027370Forest SoilLDRQLVLDSEAVPPGPRHENLRGPLYYDPPTKLVQ
Ga0209011_118264523300027678Forest SoilACSYSSLRSILKRSLDRQTTLALESGKPGPRHENVRGADYYDPPTTLLQ
Ga0209169_1030742523300027879SoilIALGDGSQRALLLGVYSYQSLKSILKNALDQQPTLELEAERSGPNHHNVRGAEYFDGPPNPLLQ
Ga0209169_1033222323300027879SoilLKSILKRGLDRETTLPPEPERSGPEHENVRGAHYYDLPATLLR
Ga0209590_1020392033300027882Vadose Zone SoilLKSILKRSLDRQLLLDLEAVAPGPRHENLRGPLYYDPPTKLVQ
Ga0209275_1066060213300027884SoilILKRSLDRQTTLELEAGKPGPRHENVRGAGYYDPPTTLLQ
Ga0209069_1022148023300027915WatershedsILKRSLDRQTTLELEPGKPGPRHENVRGPDYYDPPTTLLQ
Ga0302147_1003583133300028566BogLGACSYQSLKSILKRSLDRQAALPLEPERPGPRHENIRGAQYFNPPTNLLQ
Ga0302219_1026904323300028747PalsaLDRQLVLDSEAVGAPSGPGPRHENLRGPLYYDPPTKLVQ
Ga0302224_1032943023300028759PalsaFSYQSLKSILKRSLDRQLVLDSEAVGAPSGPGPRHENLRGPLYYDPPTKLVQ
Ga0307296_1080088713300028819SoilSSLRSILKRSLDRQTTLELESGKPGPRHENVRGAGYYDPPTTLLQ
Ga0308309_1044811713300028906SoilMKRSLDRQIKLELEVEKSGPQHDNIRGAAYYDPPSTSLLR
Ga0308309_1125548513300028906SoilKSILKRGLDRQTTLALESDRSGPKHENVRGAHYFDPPTTLLQ
Ga0311363_1131241813300029922FenALLLHAHSLNSLKSILKQSLDRQTVLELEVEKPGPRHENVRGATYYDPPHTPFLQ
Ga0311330_1072388513300029945BogSLDRQLVLDSEAVGAPSGPGPRHENLRGPLYYDPPTKLVQ
Ga0311342_1134435123300029955BogLKSGLDRETTLPLEPERSGPEHENVRGAHYYDLPPKLLP
Ga0311338_1131155123300030007PalsaRGLDRQTTLALEPDRSGPKHENVRGAHYYDPPTTLLQ
Ga0311338_1161258213300030007PalsaQSLKSILKRSLDRQLVLDSEAVPPGPRHENLRGPLYYDPPTKLVQ
Ga0302178_1012794313300030013PalsaKRSLDRQLLLDPEAVSPGPRHENLRGPLYYDPPTKLVQ
Ga0302176_1021033613300030057PalsaILKRSLDRQTTLPEPERTGARHENVRGSQYYDPPTTLLQ
Ga0302179_1009254533300030058PalsaQSLKSILKRSLDRQLVLDSGAIPPGPRHENLRGPLYYDPPTKLVQ
Ga0302179_1013895033300030058PalsaSYQSLKSILKRSLDRQTELELEVEKPGPQHDNIRGATYYDPPPSSLLQ
Ga0311349_1204808923300030294FenRSLDRQLLLDPESGSPGPHHENLRGPMYYDPPTKLVQ
Ga0311353_1084312123300030399PalsaKRSLDRQTTLELESGKPGPRHENVRGPGYYDPPTTLLQ
Ga0311370_1176327813300030503PalsaLKSSLKRSLDRQLLLDPEAVSPGPRHENLRGPLYYDPPTKLVQ
Ga0302183_1022533513300030509PalsaKRSLDRQTTLPEPERTGARHENVRGSQYYDPPTTLLQ
Ga0311356_1043811333300030617PalsaKSILKRSLDRQTVLDLEVEKPGPQHDNIRGARYYDSPPTSLLQ
Ga0311356_1128603323300030617PalsaSYQSLKSILKRSLDRQLVLDSEAVPPGPRHENLRGPLYYDPPTKLVQ
Ga0311354_1141171323300030618PalsaQRALLLRAHSYPSLKSILKRSLDRQTVLDLEVEKPGPQHDNIRGARYYDSPPTSLLQ
Ga0316363_1041883813300030659Peatlands SoilRSLDRQTELELEVEKPGPQHDNIRGATYYDPPPPSFLQ
Ga0311345_1024753233300030688BogCQRALLLHAHSLNSLKSILKQSLDRQTVLELEVEKPGPRHENVRGATYYDPPHTPFLQ
Ga0302312_1011993113300030746PalsaSLDRQLVLDPETVSPGPRHENLRGPLYYDPPTKLVQ
Ga0265746_102664813300030815SoilQSLKSILRRSLDRQTTLPLEPERTGPRHENVRGAHYYDPPTTLLQ
Ga0302307_1015270733300031233PalsaLGACSYQSLKSILKRSLDRQTTLPEPERTGARHENVRGSQYYDPPTTLLQ
Ga0302307_1016895313300031233PalsaILKRSLDRQTVLELEVEKPGPQHDNIRGATYYDPPPTSLLQ
Ga0302325_1141453423300031234PalsaDRQTVLELEVERPGPKHDNIRGATYYDPPPSSLLQ
Ga0302325_1310717113300031234PalsaKSILKRGLDRQTTLALEPDRSGPKHENVRGAHYYDPPTTLLQ
Ga0302324_10047881643300031236PalsaGLDRQTTLALEPDRSGPKHENVRGAHYYDPPTTLLQ
Ga0307505_1031969913300031455SoilKSILKRSLDRQTALPLEPERPGPQHKNVRGAQYFNPPTNLLQ
Ga0272439_129101523300031471RockLKRSLDRQTTLDLEPDKPGPRHHNVRGSGYYDPPTTLLQ
Ga0318561_1065915713300031679SoilHSMLKHSLDRQLTLEPENSKPGPRHENVRGACYYDPPTTLLQ
Ga0310686_10287932813300031708SoilSILKRSLDRQLPLDAEAVAPGPRHENLRGPLYYDPSTKLVQ
Ga0310686_11370553113300031708SoilKRSLDRQTSLSLEPERTGPRHENVRGAQYFTPPTDLLQ
Ga0318509_1025142313300031768SoilSYQSVKSILQRSLDRQLVLDPGSVAPGPRHENLRGPLYYDPPTKRLQ
Ga0302319_1107892623300031788BogAHSYQSLKSILKRSLDRQTVLELEVERPGPKHDNIRGATYYDPPPSSLLQ
Ga0318557_1043153913300031795SoilLKSILKRSLDQQPTPELETDKSGPRHDNLRGAHYYDEPPSSLLQ
Ga0318523_1030963523300031798SoilYQSLKSILKRSLDQQPTPELETDKSGPRHDNLRGAHYYDEPPSSLLQ
Ga0306922_1143646913300032001SoilQLQACSYQSLKSMLKRSLDRQQLLLDSEIDHPGPTHENLRGSHYYDPPTKLLQ
Ga0318575_1057950513300032055SoilSILKRSLDQQPTPELETDKSGPRHDNLRGAHYYDEPPSSLLQ
Ga0318533_1040763623300032059SoilVYNTVVLTSILKRSLDRQLLLEAEAAQPGPQHENLRGPHYYDPPTTLVQ
Ga0335079_1068886013300032783SoilRSLDRQLLLDPESVPAGPRHENLRGPHYYDPPTLVQ
Ga0335079_1152456313300032783SoilSYQSLKSILKHSLDRQLLLESEAAPPGPRHENLRGPHYYDPPNPLVQ
Ga0335081_1113891523300032892SoilCSYSSLRSILKHSLDRQLFLDPGPDKSGPKHQNLRGARYYDPPTPLLQ
Ga0335081_1141047313300032892SoilQAFSYQSLKSILKRSLDRQLVIDPEAVVPGPRHENLRGPLYYDPPSKLVQ
Ga0335077_1119894823300033158SoilSILKRSLDRQTSLLVEPERPGPQHENIRGAQYYQAPTTLLQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.