| Basic Information | |
|---|---|
| Family ID | F050533 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MESLSELRERRAFECRLTPDRALGSLDEAEAFLRDRALLTRT |
| Number of Associated Samples | 132 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 69.17 % |
| % of genes near scaffold ends (potentially truncated) | 91.03 % |
| % of genes from short scaffolds (< 2000 bps) | 86.21 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (70.345 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.897 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.517 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.690 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.29% β-sheet: 0.00% Coil/Unstructured: 65.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF03706 | LPG_synthase_TM | 18.62 |
| PF05977 | MFS_3 | 13.10 |
| PF00994 | MoCF_biosynth | 7.59 |
| PF12697 | Abhydrolase_6 | 6.21 |
| PF10509 | GalKase_gal_bdg | 2.07 |
| PF10099 | RskA | 2.07 |
| PF07883 | Cupin_2 | 1.38 |
| PF01928 | CYTH | 1.38 |
| PF01087 | GalP_UDP_transf | 1.38 |
| PF01408 | GFO_IDH_MocA | 1.38 |
| PF13377 | Peripla_BP_3 | 1.38 |
| PF06724 | DUF1206 | 1.38 |
| PF13396 | PLDc_N | 1.38 |
| PF00903 | Glyoxalase | 1.38 |
| PF03551 | PadR | 1.38 |
| PF10604 | Polyketide_cyc2 | 0.69 |
| PF02126 | PTE | 0.69 |
| PF10502 | Peptidase_S26 | 0.69 |
| PF09851 | SHOCT | 0.69 |
| PF13487 | HD_5 | 0.69 |
| PF00797 | Acetyltransf_2 | 0.69 |
| PF00296 | Bac_luciferase | 0.69 |
| PF13671 | AAA_33 | 0.69 |
| PF00580 | UvrD-helicase | 0.69 |
| PF00144 | Beta-lactamase | 0.69 |
| PF01850 | PIN | 0.69 |
| PF00589 | Phage_integrase | 0.69 |
| PF04264 | YceI | 0.69 |
| PF16363 | GDP_Man_Dehyd | 0.69 |
| PF04542 | Sigma70_r2 | 0.69 |
| PF00383 | dCMP_cyt_deam_1 | 0.69 |
| PF00491 | Arginase | 0.69 |
| PF05235 | CHAD | 0.69 |
| PF01670 | Glyco_hydro_12 | 0.69 |
| PF02744 | GalP_UDP_tr_C | 0.69 |
| PF08281 | Sigma70_r4_2 | 0.69 |
| PF13527 | Acetyltransf_9 | 0.69 |
| PF11066 | DUF2867 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 18.62 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 13.10 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.38 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.38 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.38 |
| COG1735 | Predicted metal-dependent hydrolase, phosphotriesterase family | General function prediction only [R] | 0.69 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.69 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.69 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 0.69 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.69 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.69 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 0.69 |
| COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.69 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.69 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.69 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.69 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.69 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.69 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.69 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.69 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.34 % |
| Unclassified | root | N/A | 29.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_100927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300000956|JGI10216J12902_101285441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1331 | Open in IMG/M |
| 3300001305|C688J14111_10124748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 788 | Open in IMG/M |
| 3300001535|A3PFW1_10317351 | Not Available | 524 | Open in IMG/M |
| 3300001686|C688J18823_10234952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1224 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101414532 | Not Available | 589 | Open in IMG/M |
| 3300002568|C688J35102_118128092 | Not Available | 532 | Open in IMG/M |
| 3300002568|C688J35102_119401073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 688 | Open in IMG/M |
| 3300002915|JGI25387J43893_1040867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 634 | Open in IMG/M |
| 3300004633|Ga0066395_10920405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 530 | Open in IMG/M |
| 3300005174|Ga0066680_10238716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1153 | Open in IMG/M |
| 3300005332|Ga0066388_105799851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300005363|Ga0008090_15226018 | Not Available | 501 | Open in IMG/M |
| 3300005457|Ga0070662_101640684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 555 | Open in IMG/M |
| 3300005468|Ga0070707_101128327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
| 3300005536|Ga0070697_100337496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1300 | Open in IMG/M |
| 3300005542|Ga0070732_10020014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3759 | Open in IMG/M |
| 3300005560|Ga0066670_10067238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1914 | Open in IMG/M |
| 3300005764|Ga0066903_102878203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 933 | Open in IMG/M |
| 3300005764|Ga0066903_107352700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
| 3300005764|Ga0066903_107507192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300006175|Ga0070712_101251214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 646 | Open in IMG/M |
| 3300006847|Ga0075431_100277751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1696 | Open in IMG/M |
| 3300006852|Ga0075433_11453232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 593 | Open in IMG/M |
| 3300006904|Ga0075424_100187335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → unclassified Dongia → Dongia sp. | 2196 | Open in IMG/M |
| 3300006904|Ga0075424_101891227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300006914|Ga0075436_100294806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa ferruginea | 1161 | Open in IMG/M |
| 3300006954|Ga0079219_10713115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 766 | Open in IMG/M |
| 3300009094|Ga0111539_11660951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 741 | Open in IMG/M |
| 3300009143|Ga0099792_10445219 | Not Available | 801 | Open in IMG/M |
| 3300009148|Ga0105243_11482346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
| 3300009162|Ga0075423_11037840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 872 | Open in IMG/M |
| 3300010366|Ga0126379_11369564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Knoellia → Knoellia sinensis | 814 | Open in IMG/M |
| 3300010366|Ga0126379_13151021 | Not Available | 552 | Open in IMG/M |
| 3300010376|Ga0126381_100185563 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2767 | Open in IMG/M |
| 3300010376|Ga0126381_101661445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 923 | Open in IMG/M |
| 3300010379|Ga0136449_102364034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 768 | Open in IMG/M |
| 3300010876|Ga0126361_10855599 | Not Available | 531 | Open in IMG/M |
| 3300011270|Ga0137391_10744879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 811 | Open in IMG/M |
| 3300012199|Ga0137383_10633931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300012200|Ga0137382_10777503 | Not Available | 688 | Open in IMG/M |
| 3300012356|Ga0137371_10896569 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300012509|Ga0157334_1031502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 648 | Open in IMG/M |
| 3300012899|Ga0157299_10291294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 536 | Open in IMG/M |
| 3300012915|Ga0157302_10259057 | Not Available | 655 | Open in IMG/M |
| 3300012960|Ga0164301_10711307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300012971|Ga0126369_11674794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300012971|Ga0126369_12007233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300014968|Ga0157379_11122715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 754 | Open in IMG/M |
| 3300015372|Ga0132256_100768809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1079 | Open in IMG/M |
| 3300015374|Ga0132255_103387298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
| 3300016422|Ga0182039_10786799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300016445|Ga0182038_10985144 | Not Available | 746 | Open in IMG/M |
| 3300017695|Ga0180121_10222443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 705 | Open in IMG/M |
| 3300017823|Ga0187818_10052865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides ginsengisegetis | 1746 | Open in IMG/M |
| 3300017924|Ga0187820_1142554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
| 3300017939|Ga0187775_10010587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2339 | Open in IMG/M |
| 3300017942|Ga0187808_10007644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4148 | Open in IMG/M |
| 3300017974|Ga0187777_10781305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 681 | Open in IMG/M |
| 3300019890|Ga0193728_1180848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 902 | Open in IMG/M |
| 3300021363|Ga0193699_10052666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1578 | Open in IMG/M |
| 3300021374|Ga0213881_10137017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1069 | Open in IMG/M |
| 3300021403|Ga0210397_10684370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 788 | Open in IMG/M |
| 3300021407|Ga0210383_10799019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 808 | Open in IMG/M |
| 3300021433|Ga0210391_10832585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 721 | Open in IMG/M |
| 3300021445|Ga0182009_10502634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300021475|Ga0210392_10674713 | Not Available | 769 | Open in IMG/M |
| 3300021559|Ga0210409_10384306 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1258 | Open in IMG/M |
| 3300023071|Ga0247752_1027258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 834 | Open in IMG/M |
| 3300025556|Ga0210120_1058136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300025900|Ga0207710_10210508 | Not Available | 962 | Open in IMG/M |
| 3300025901|Ga0207688_10388886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 864 | Open in IMG/M |
| 3300025908|Ga0207643_11070921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300025931|Ga0207644_10399886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1123 | Open in IMG/M |
| 3300025934|Ga0207686_11405984 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 574 | Open in IMG/M |
| 3300026075|Ga0207708_11436767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
| 3300026078|Ga0207702_11101063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 788 | Open in IMG/M |
| 3300026528|Ga0209378_1246997 | Not Available | 567 | Open in IMG/M |
| 3300027567|Ga0209115_1062266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 850 | Open in IMG/M |
| 3300027824|Ga0209040_10120066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1459 | Open in IMG/M |
| 3300027867|Ga0209167_10416718 | Not Available | 733 | Open in IMG/M |
| 3300027908|Ga0209006_11251235 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300028666|Ga0265336_10064278 | Not Available | 1098 | Open in IMG/M |
| 3300028707|Ga0307291_1145530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
| 3300028722|Ga0307319_10222015 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
| 3300028789|Ga0302232_10085716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1624 | Open in IMG/M |
| 3300028811|Ga0307292_10148102 | Not Available | 947 | Open in IMG/M |
| 3300031236|Ga0302324_101483746 | Not Available | 882 | Open in IMG/M |
| 3300031247|Ga0265340_10079993 | Not Available | 1539 | Open in IMG/M |
| 3300031543|Ga0318516_10334912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 874 | Open in IMG/M |
| 3300031544|Ga0318534_10268978 | Not Available | 982 | Open in IMG/M |
| 3300031545|Ga0318541_10721289 | Not Available | 557 | Open in IMG/M |
| 3300031573|Ga0310915_10211649 | Not Available | 1358 | Open in IMG/M |
| 3300031668|Ga0318542_10295675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
| 3300031670|Ga0307374_10042038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4953 | Open in IMG/M |
| 3300031681|Ga0318572_10111605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 1554 | Open in IMG/M |
| 3300031708|Ga0310686_107553933 | Not Available | 560 | Open in IMG/M |
| 3300031713|Ga0318496_10060853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 1974 | Open in IMG/M |
| 3300031744|Ga0306918_11331218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300031751|Ga0318494_10232674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1054 | Open in IMG/M |
| 3300031764|Ga0318535_10196363 | Not Available | 902 | Open in IMG/M |
| 3300031768|Ga0318509_10132780 | Not Available | 1365 | Open in IMG/M |
| 3300031768|Ga0318509_10333671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300031769|Ga0318526_10480874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300031777|Ga0318543_10379534 | Not Available | 633 | Open in IMG/M |
| 3300031778|Ga0318498_10057353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales | 1735 | Open in IMG/M |
| 3300031793|Ga0318548_10122761 | Not Available | 1256 | Open in IMG/M |
| 3300031797|Ga0318550_10639398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300031805|Ga0318497_10256005 | Not Available | 971 | Open in IMG/M |
| 3300031819|Ga0318568_10201561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1227 | Open in IMG/M |
| 3300031819|Ga0318568_10936549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300031820|Ga0307473_10879709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 645 | Open in IMG/M |
| 3300031846|Ga0318512_10632477 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300031858|Ga0310892_10353108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 944 | Open in IMG/M |
| 3300031896|Ga0318551_10942962 | Not Available | 504 | Open in IMG/M |
| 3300031959|Ga0318530_10180585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 863 | Open in IMG/M |
| 3300032008|Ga0318562_10541181 | Not Available | 674 | Open in IMG/M |
| 3300032008|Ga0318562_10651937 | Not Available | 607 | Open in IMG/M |
| 3300032013|Ga0310906_10227535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1149 | Open in IMG/M |
| 3300032044|Ga0318558_10685429 | Not Available | 512 | Open in IMG/M |
| 3300032054|Ga0318570_10504442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 552 | Open in IMG/M |
| 3300032063|Ga0318504_10015738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2755 | Open in IMG/M |
| 3300032067|Ga0318524_10597405 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 581 | Open in IMG/M |
| 3300032089|Ga0318525_10275636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 864 | Open in IMG/M |
| 3300032089|Ga0318525_10323321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300032090|Ga0318518_10561095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 583 | Open in IMG/M |
| 3300032160|Ga0311301_10013180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25428 | Open in IMG/M |
| 3300032179|Ga0310889_10334697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
| 3300032896|Ga0335075_11240431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300033134|Ga0335073_10313750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1875 | Open in IMG/M |
| 3300033290|Ga0318519_10463307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300033412|Ga0310810_10729198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 914 | Open in IMG/M |
| 3300034817|Ga0373948_0103215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.90% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.83% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.07% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.38% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.38% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.38% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.69% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.69% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.69% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002915 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300025556 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_01547790 | 2199352025 | Soil | MEPVEPLAEQLRRRACECRLTPARALETLAEAEAFLRDRGLL |
| JGI10216J12902_1012854413 | 3300000956 | Soil | LGELQELQERRSFECRLTPDRALQTLDEAEAFLRDRGLLTRT |
| C688J14111_101247482 | 3300001305 | Soil | MTHMGLAELQRRRAVDCRLTPERALQSIDEAEAFLLDRGLLT |
| A3PFW1_103173512 | 3300001535 | Permafrost | MHSLRELEEQRRFACRLSPDRALQSLDDAHAFLRERGMLTRTEDSAL |
| C688J18823_102349522 | 3300001686 | Soil | MTHVGLAELQRRRAVDCRLTPERALQSIDEAEAFLLDRGL |
| JGIcombinedJ26739_1014145322 | 3300002245 | Forest Soil | MESLSELRERRAFECRLTADRALGSLDEAEAFLRERALLTRT |
| C688J35102_1181280921 | 3300002568 | Soil | VETLDELRVRRAFECRLTPHRALQSLDEAEAFLLDRGLLTRTADSA |
| C688J35102_1194010731 | 3300002568 | Soil | MTRMGLAELQQRRAFECRLTPDRALGSLDEAEAFLLDRGLLTR |
| JGI25387J43893_10408672 | 3300002915 | Grasslands Soil | MSRLQELQERRAYECRLTPDRALRSLDEAEAFLRDRGLLTRTADSA |
| Ga0066395_109204052 | 3300004633 | Tropical Forest Soil | VESLTDLQVQRVFECRLTADRALGTLDEAEAFLRGRGLLT |
| Ga0062591_1014516602 | 3300004643 | Soil | VESLDDLRERRAHECRLTPDRALQSLDEADAFLRDRGLLT |
| Ga0066680_102387161 | 3300005174 | Soil | MATLPELQERRAAECRLTPDRALTSPDDTEAFLRDRGLLTRTADSAL |
| Ga0070658_104044761 | 3300005327 | Corn Rhizosphere | MESLAALRERRAFACRLTPDRALESLDEAEGFLRERGMLTRT |
| Ga0066388_1057998511 | 3300005332 | Tropical Forest Soil | MESLAGLRERRAFECRLTPDRALRSIDEATAFLRERGMLTRT |
| Ga0008090_152260182 | 3300005363 | Tropical Rainforest Soil | VESLADLRARRAFECRLDPGLALRSLDEAEAFLRDRGLLTRTTDCAL |
| Ga0070662_1016406841 | 3300005457 | Corn Rhizosphere | MKPVTRVDELRERRALECRLTPDRALESLDEAEAFLLDRGLLTRTADS |
| Ga0070707_1011283272 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VESLAELREWRAFQCRLTPDRALRSLEEAEGYLRDRGMLTRTAD |
| Ga0070697_1003374963 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VESLTELRERRAFQCRLTPDRALRSLEEADAFLRDRGLLTR |
| Ga0070732_100200145 | 3300005542 | Surface Soil | VESLAAAREERAFLCRLTPDRALGSLDQADAFLRDRGMLTRTPDSALPSL |
| Ga0066670_100672384 | 3300005560 | Soil | VGTAQSDTALAELQEKRAFALRLTQDRALQTLDDAEAFLHERGMMTRT |
| Ga0066903_1028782031 | 3300005764 | Tropical Forest Soil | VESLAELRARRAFECRLIPVRALGSLDEAAAFLRDRGLLTR |
| Ga0066903_1073527001 | 3300005764 | Tropical Forest Soil | VDSLEGLRERRDFECRLTPDRALRTLDEAEAFLRDR |
| Ga0066903_1075071922 | 3300005764 | Tropical Forest Soil | MSSPLNELRERRAHECRLTPDRALTSLDEAEAFLLDRGLLTRTADS |
| Ga0070712_1012512143 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VESLADLRVRRAIECRLDPGRALRSLDEAEAFLRDRGLL |
| Ga0075431_1002777511 | 3300006847 | Populus Rhizosphere | MTGNPTLDDLRKLRAFECRLTPDRALGSLDEAEEFLLDRGLLTRTADC |
| Ga0075433_114532321 | 3300006852 | Populus Rhizosphere | MTGNPTLDQLRTLRAFECRLTPDRALGSLDEAEEFLLDRGLLTRTADC |
| Ga0075424_1001873353 | 3300006904 | Populus Rhizosphere | VESLTGLRERRAFQCRLAPGRALRSLEEADAFLRDRGLLTRTADC |
| Ga0075424_1018912271 | 3300006904 | Populus Rhizosphere | MTGNPTLDELRTLRAFECRLTPDRALGSLDEAEEFLLDRGLL |
| Ga0075436_1002948062 | 3300006914 | Populus Rhizosphere | VESLTELRERRAFQCRLAPGRALRSLEEADAFLRDRGLLTRTAD |
| Ga0079219_107131151 | 3300006954 | Agricultural Soil | MPSVTELGQLTARRAFECRLTPDRLLGSLEEAEAFLRDRG |
| Ga0111539_116609512 | 3300009094 | Populus Rhizosphere | MTGNPTLDQLRTLRAFECRLTPDRALGSLDEAEEFLLDRGLLTRT |
| Ga0099792_104452191 | 3300009143 | Vadose Zone Soil | VESLAGLQTRRAFECRLVPDRALRSLDEAAAFLRDRGLLTRTT |
| Ga0105243_114823461 | 3300009148 | Miscanthus Rhizosphere | MIQMSLPELQRRRAFECRLTPDRALGSLDEAEAFLLDR |
| Ga0075423_110378402 | 3300009162 | Populus Rhizosphere | VESLAELRVRRRYQCRLGPDRALRSLEEADAFLRDRGLLTRTADCAL |
| Ga0126380_115939101 | 3300010043 | Tropical Forest Soil | MLAALLEQRAFECRLTSDRALGTLVDAESFLRDRGLLTRTP |
| Ga0126373_113282162 | 3300010048 | Tropical Forest Soil | VEVVDPVADLLRRREFECRLTPDRALGSLQEAESFLRDRQLLTRT |
| Ga0126379_113695643 | 3300010366 | Tropical Forest Soil | VESLAELRVRRRFQCRLAPDRALRSLEEADAFLRDRGLLT |
| Ga0126379_131510212 | 3300010366 | Tropical Forest Soil | VESLADLRARRAFECRLYSGRALRSLGEAEAFLRDRGLLT |
| Ga0126379_133579282 | 3300010366 | Tropical Forest Soil | VESLAALRERRAYECRLIPGRALGSLDEAEGFLRDR |
| Ga0126381_1001855631 | 3300010376 | Tropical Forest Soil | VESLAELRVRRRFQCRLAPDRALRSLEEADAFLCDRGLLT |
| Ga0126381_1016614452 | 3300010376 | Tropical Forest Soil | VETLAELRERRAFECRLTADRALASLAEADAFLRDRGLLT |
| Ga0136449_1023640341 | 3300010379 | Peatlands Soil | VESLAAAREERAFWCRLTPDRALGSLDEAEMFLRDRGMLTRTADSALPS |
| Ga0126361_108555991 | 3300010876 | Boreal Forest Soil | VESLAELRARRAYECRLVPGRALRSLDEADGFLRGRGLLTRTTDCALP |
| Ga0137391_107448791 | 3300011270 | Vadose Zone Soil | VESLTALRERRGFECRLAPDRALRTIDDAEGFLHDRGLLTRT |
| Ga0137383_106339311 | 3300012199 | Vadose Zone Soil | MTHMGLAELQRRRAVDCRLTPERALQSIEEAEAFLLDRGLLTR |
| Ga0137382_107775031 | 3300012200 | Vadose Zone Soil | VSLEELRERRAFECRLTPDRALGSLEEAEAFLLDRGL |
| Ga0137371_108965693 | 3300012356 | Vadose Zone Soil | LQAKRVFACRLEPARALATLDEAEAFLRDRGLLTRT |
| Ga0157334_10315021 | 3300012509 | Soil | MPSVTELGQLTARRAFECRLTPDRALGSLEEAEAFLRDRGLLTRT |
| Ga0157299_102912941 | 3300012899 | Soil | MTRMSLAELQQRRAFECRLTPDRALGSLDEAETFLL |
| Ga0157302_102590571 | 3300012915 | Soil | MTHVRTAEDLQERRTFECRLTAERALESLDEAEEFLLDRGLLTRTADSA |
| Ga0164301_107113072 | 3300012960 | Soil | MTRMRLAELQQRRAVECRLTPDRALGSLDEAEAFLL |
| Ga0126369_116747941 | 3300012971 | Tropical Forest Soil | VESLAELRVRRAFECRLIPVRALGSLDEAAAFLRDR |
| Ga0126369_120072331 | 3300012971 | Tropical Forest Soil | VQPLAELRERRDFECRLVPVRALRSLDEADAFLRGRGLL |
| Ga0157379_111227152 | 3300014968 | Switchgrass Rhizosphere | MIQMSLPELQRRRAFECRLTPDRALGSLDEAEAFLLDRGLLTRTADSAL |
| Ga0132256_1007688092 | 3300015372 | Arabidopsis Rhizosphere | MDQLRRRRAFECRLTPDRALGSLDEAEAFLRDRGLLTRTADCALP |
| Ga0132255_1033872981 | 3300015374 | Arabidopsis Rhizosphere | VETLDELRERRAFECRLTPDRALPSLDEAEEFLLDRGLLT |
| Ga0182039_107867992 | 3300016422 | Soil | VESLAELRERRAFECRLSPDRALESLDEAEAFLGDRGFLTRTPDSALPS |
| Ga0182038_109851442 | 3300016445 | Soil | MESLAELRVRRAFECRLVPDRALRSLDEADRFLRCRGLLTRTTDC |
| Ga0180121_102224431 | 3300017695 | Polar Desert Sand | VASLTELQERHAFECRLTPERALGSLDEAEAFLLDR |
| Ga0187818_100528655 | 3300017823 | Freshwater Sediment | VESLAELRERRDLRCRLTPDRALRSLDEADAFLRDRGMLTRTADCAIP |
| Ga0187820_11425541 | 3300017924 | Freshwater Sediment | VESLTEARERRAFCCRLTPDRTLRSLAEAEVFLRDRGLLTRTADCAL |
| Ga0187775_100105874 | 3300017939 | Tropical Peatland | VSLEELRERRAFECRLAPNRALVSLDEAEAFLIDRGLL |
| Ga0187808_100076445 | 3300017942 | Freshwater Sediment | VESLTEARERRAFCCRLTPDRTLRSLAEAEVFLRDRGL |
| Ga0187777_107813051 | 3300017974 | Tropical Peatland | VESLTDLRAQRAFECRLAPDRALRTIDEAEAFLRDRGL |
| Ga0193728_11808481 | 3300019890 | Soil | MSAHGPSMEELRERRAFECRLTPDRALQTLDEAEVFLRDRGLLT |
| Ga0193699_100526663 | 3300021363 | Soil | MTRMRLAELQQRRALECRLTPDRALGSVDEAEAFLL |
| Ga0213881_101370171 | 3300021374 | Exposed Rock | VEALTALQEQRAMRCRLTTGRALRSLDEAEAFLLDR |
| Ga0210397_106843701 | 3300021403 | Soil | VETLADLRVRRAIECRLAPGRELRSLTEAREFLDE |
| Ga0210383_107990191 | 3300021407 | Soil | VDSLTGLREQRAFECRLTPDRALRTLAEAEEFLRGRGLLTRTTDCALPS |
| Ga0210391_108325852 | 3300021433 | Soil | MESLSELRERRAVECRLTPDRALCSLDEAEAFLRERALL |
| Ga0182009_105026341 | 3300021445 | Soil | MTRVRTAQDLQQRRTYECRLTADRALESLDEAEEFLLD |
| Ga0210392_106747132 | 3300021475 | Soil | MESLAALRERRSFECRLSPGRALASLDEAEAFLRGRGLL |
| Ga0210409_103843062 | 3300021559 | Soil | MESLAGLRERRVFECRLTPDRALGSLDEAEGFLRERGMLTR |
| Ga0126371_103180214 | 3300021560 | Tropical Forest Soil | VEPVADLLRRREFECRLSPDRALGSLQEAESFLRDRRLLTRTAD |
| Ga0247752_10272582 | 3300023071 | Soil | MTGNPTLDELRTLRAFECRLTPDRALGSPDEAEEFLLD |
| Ga0210120_10581361 | 3300025556 | Natural And Restored Wetlands | MTRMRLAELQRQRAVECRLTPDRALGSLDEAEAFLLDRGL |
| Ga0207710_102105082 | 3300025900 | Switchgrass Rhizosphere | MSLSDLQRRRDHECRLTPDRALGSLDEAESFLLDRGLLTR |
| Ga0207688_103888861 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MIQMSLPELQRRRAFECRLTPDRALGSLDEAEAFLLDRGLLD |
| Ga0207643_110709212 | 3300025908 | Miscanthus Rhizosphere | MPSVTELGQLTARRAFECRLTPDRALGSLEEAEAFLRDRGLL |
| Ga0207705_100709593 | 3300025909 | Corn Rhizosphere | MESLAALRERRAFACRLTPDRALESLDEAEGFLRERGML |
| Ga0207644_103998862 | 3300025931 | Switchgrass Rhizosphere | MATLDELRERRAFECRLTPDRALGSLDEAETFLLDRGLLT |
| Ga0207686_114059842 | 3300025934 | Miscanthus Rhizosphere | MSLPELQRRRAFECRLTPDRALGSLDEAEAFLLDRGLLTRTAD |
| Ga0207708_114367671 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLPELQRRRAFECRLTHDRALGSLDEAEAFLLDRG |
| Ga0207702_111010631 | 3300026078 | Corn Rhizosphere | MAPVSSAEELRERRAFECRLTPDRALESLDEAEEFLLDRGLLTRTA |
| Ga0209378_12469971 | 3300026528 | Soil | MHQLGRRRKRECRLEADRALRTLDEAEAFLRDRGLLTLMPDCAL |
| Ga0209648_106602041 | 3300026551 | Grasslands Soil | VESLAQLRERREFECRLTPDRALESLQEAEAFLRD |
| Ga0209115_10622661 | 3300027567 | Forest Soil | MESLSELRERRAFECRLTPDRALGSLDEAEAFLRERALLTRTPDCAV |
| Ga0209040_101200663 | 3300027824 | Bog Forest Soil | MESATQLRERRAFECRLTPDRALRSLDEAGAFLRDRGMLTR |
| Ga0209167_104167183 | 3300027867 | Surface Soil | MESVAGLRERRAFECRLTQDRALGSLDEAEAFLGERGMLTRTADS |
| Ga0209590_105333721 | 3300027882 | Vadose Zone Soil | MATLPELQERRAAECRLTPDRALTSPDDTEAFLRDRGLLTRT |
| Ga0209006_112512352 | 3300027908 | Forest Soil | VESLAELRERRAWECRLTPDRALVSIADADGFLQDRGLLTRTA |
| Ga0268266_108935951 | 3300028379 | Switchgrass Rhizosphere | MESLAALRERRAFACRLTPDRALESLDEAEGFLRERGMLTR |
| Ga0265336_100642781 | 3300028666 | Rhizosphere | MESLAGLRERRAFECRLTPDRALGSLDEAEGFLGLRGLLTRTADSAL |
| Ga0307291_11455302 | 3300028707 | Soil | MSLVELQQRRAHECRLTPDRALGSLDDAESFLLDRGL |
| Ga0307319_102220152 | 3300028722 | Soil | VETLGELRERRAYECRLTFDRALDSLDEAEAFLRDRGLLTRTPDSAL |
| Ga0302232_100857163 | 3300028789 | Palsa | MESLSELRERRAFECRLTPDRALGSLDEAEAFLRDRALLTRT |
| Ga0307292_101481021 | 3300028811 | Soil | VETLDELRERRAFECRLTPDRALQSLDEAEAFLLD |
| Ga0302324_1014837463 | 3300031236 | Palsa | MESLAELLERRAFRCRLVPERALRSVEEAEGFLRDRGLLTRTPDS |
| Ga0265340_100799932 | 3300031247 | Rhizosphere | MESLAGLRERRAFECRLTPDRALGSLDEAEGFLGLRGLLTRT |
| Ga0318516_103349121 | 3300031543 | Soil | VESLAELRARRAFECRLVPARALRSLDEAAAFLRDRGLLTRTTDCALPS |
| Ga0318534_102689781 | 3300031544 | Soil | VESLTDLQVQRVFDCRLTPDRALGTLDEAEAFLRGR |
| Ga0318541_107212891 | 3300031545 | Soil | VESLTDLQVQRVFDCRLTPDRALGTLDEAEAFLQGR |
| Ga0310915_102116491 | 3300031573 | Soil | MESLAELRVRRAFECRLVPDRALRSLDEADRFLRSRGLL |
| Ga0318542_102956752 | 3300031668 | Soil | MEPFAGLRERRAFECRLTPDRALRSLDEATAFLRERGMLTRTTDCALPSLY |
| Ga0307374_100420385 | 3300031670 | Soil | VAWLADLSAQRAFECRLTPDRALSSLDEADDFLLARGLLTRT |
| Ga0318572_101116051 | 3300031681 | Soil | VESLTDLQVQRVFDCRLTPDRALGTLDEAEAFLRGRGLLTR |
| Ga0310686_1075539331 | 3300031708 | Soil | MESLDGLSERRAFECRLRPDRALGSLDEAEVFLRERGM |
| Ga0318496_100608533 | 3300031713 | Soil | MESLAELRVRRAFECRLVPDRALRSLDEADRFLRCRGLLTRTTDCA |
| Ga0306918_113312181 | 3300031744 | Soil | MEPLAGLRERRAFECRLTPDRALRSLDEATAFARERGMLTR |
| Ga0318494_102326742 | 3300031751 | Soil | VESLADLRARRAFECRLDPGRALRSLDEAEGFLRDRGLLTRTTDC |
| Ga0318535_101963632 | 3300031764 | Soil | VESLADLRARRAFECRLDPGRALRSLDEAEAFLRDRGLLTRTTD |
| Ga0318509_101327801 | 3300031768 | Soil | VESLAELRARRAFECRLVPARALRSLDEAAGFLRDRGLLTRTTDCALPS |
| Ga0318509_102954302 | 3300031768 | Soil | MESLAELRERRAFECRLTPDRALASLDEAGEFLRDRGM |
| Ga0318509_103336711 | 3300031768 | Soil | MEPLAGLRERRAFECRLTPDRALRSLDEATAFARERGMLTRTTDC |
| Ga0318526_104808741 | 3300031769 | Soil | MESLAGLRERRAFECRLTPDRALRSLDEATAFARERGMLTRTTD |
| Ga0318543_103795341 | 3300031777 | Soil | VESLAELRARRAFECRLVPARALRSLDEAAAFLRDRGLLTRTAD |
| Ga0318498_100573531 | 3300031778 | Soil | VESLTDLQVQRVFDCRLTPDRALGTLDEAEAFLRGRGLLTRTAD |
| Ga0318548_101227612 | 3300031793 | Soil | VESLADLRARRAFECRLDPGRALRSLDEAEAFLRDRGLLT |
| Ga0318550_106393981 | 3300031797 | Soil | VESLTDLQVQRVFDCRLTPDRALGTLDEAEAFLRGRGLLTRTADC |
| Ga0318497_102560052 | 3300031805 | Soil | MESLAELRVRRAFECRLVPDRALRSLDEADRFLRCRGLLTR |
| Ga0318568_102015612 | 3300031819 | Soil | VESLAELRERRAFECRLSPDLALESLDEAQAFLDDRGFLTRTPD |
| Ga0318568_109365491 | 3300031819 | Soil | MESATELRERRAFECRLTPDRALGSLDEADAFLRDRGMLTRTPDSALPS |
| Ga0307473_108797092 | 3300031820 | Hardwood Forest Soil | VESLTELRERRAFQCRLTPDRALRSLEEADAFLRDRGLLTRTADCAL |
| Ga0318512_106324771 | 3300031846 | Soil | MESATELRERRAFECRLTPDRALRSLDEADAFLRDRGMLT |
| Ga0310892_103531081 | 3300031858 | Soil | MPLVTELGQLTARRAFECRLTPDRALGSLEEAEAFLRDRGLLTR |
| Ga0318551_109429622 | 3300031896 | Soil | MESLAELRVRRAFECRLVPDRALRSLDEADRFLRCRG |
| Ga0318530_101805852 | 3300031959 | Soil | MEPLAGLRERRAFECRLTPDRALRSLDEATAFARERGM |
| Ga0318562_105411811 | 3300032008 | Soil | VESLAELRARRAFECRLVPARALRSLDEAAAFLRDRGLLTRTTDCA |
| Ga0318562_106519371 | 3300032008 | Soil | VESLAELRARRAFECRLVPARALRSLDEAAGFLRDRGLLT |
| Ga0310906_102275352 | 3300032013 | Soil | MTGNPTLDELRTLRAFECRLTPDRALGSLDEAEEFLLDR |
| Ga0318558_106854292 | 3300032044 | Soil | MESLGELRERRAFECRLTQDRALESLDDADAFAAERGLLTRTADSA |
| Ga0318570_105044422 | 3300032054 | Soil | MESATELRERRAFECRLTPDRALRSLDEADAFLRDRG |
| Ga0318504_100157384 | 3300032063 | Soil | VESLADLRARRAFECRLDPGRALRSLDEAEGFLRD |
| Ga0318524_105974051 | 3300032067 | Soil | MESATELQERRAFECRLTPDRALRSLDEADAFLRDRGMLTR |
| Ga0318525_102756362 | 3300032089 | Soil | MESLARLRERRAFECRLTPDRALRSFDEATAFLRE |
| Ga0318525_103233211 | 3300032089 | Soil | MMEPVEPLAEQLRRRAFECRLTPDRALETLSEAEAFLRDRG |
| Ga0318518_105610952 | 3300032090 | Soil | MESLAGLRERRAFECRLTPDRALRSLDEATAFARERGMLTRTTDCAL |
| Ga0311301_1001318026 | 3300032160 | Peatlands Soil | VESLAAAREERAFWCRLTPDRALGSLDEAEMFLRDRGMLTRTADSALPSL |
| Ga0310889_103346971 | 3300032179 | Soil | MTGNPTLDELRTLRAFECRLTPDRALGSLDEAEEFLLDRGLLTR |
| Ga0335075_112404311 | 3300032896 | Soil | MMVPIETLAQLRERRAAECRLTPDRALGSLDEAAAFLRQRGLLTRTP |
| Ga0335073_103137501 | 3300033134 | Soil | MVVMESLAQLRERRAAECRLTPDLALGSLDEAAAFLRE |
| Ga0310914_118076092 | 3300033289 | Soil | VESLAELTERRAIECRLSPDRALESLDEAESFLGER |
| Ga0318519_104633072 | 3300033290 | Soil | MEPFAGLRERRAFECRLTPDRALRSLDEATAFLRERGMLTRTTDCALPS |
| Ga0310810_107291981 | 3300033412 | Soil | MTRVRTAEDLQERRTFECRLTAERALESLDEAEEFLLDRGLLTRTA |
| Ga0373948_0103215_1_138 | 3300034817 | Rhizosphere Soil | MAGRPTMTGNPTLDELRTLRAFECRLTPDRALGSLDEAEEFLLDRG |
| ⦗Top⦘ |