| Basic Information | |
|---|---|
| Family ID | F050530 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LAGRAAQLQGWKLLVATSIAAGLGLVMILLKDLVLIHLH |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.69 % |
| % of genes near scaffold ends (potentially truncated) | 94.48 % |
| % of genes from short scaffolds (< 2000 bps) | 95.17 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.724 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (35.172 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.241 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.655 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF07690 | MFS_1 | 5.52 |
| PF06736 | TMEM175 | 2.76 |
| PF07411 | DUF1508 | 2.07 |
| PF13302 | Acetyltransf_3 | 2.07 |
| PF13520 | AA_permease_2 | 2.07 |
| PF07366 | SnoaL | 2.07 |
| PF02738 | MoCoBD_1 | 1.38 |
| PF01906 | YbjQ_1 | 1.38 |
| PF00753 | Lactamase_B | 1.38 |
| PF03631 | Virul_fac_BrkB | 1.38 |
| PF13546 | DDE_5 | 1.38 |
| PF00903 | Glyoxalase | 1.38 |
| PF08281 | Sigma70_r4_2 | 1.38 |
| PF13460 | NAD_binding_10 | 0.69 |
| PF01814 | Hemerythrin | 0.69 |
| PF13808 | DDE_Tnp_1_assoc | 0.69 |
| PF11964 | SpoIIAA-like | 0.69 |
| PF02113 | Peptidase_S13 | 0.69 |
| PF01022 | HTH_5 | 0.69 |
| PF13508 | Acetyltransf_7 | 0.69 |
| PF13683 | rve_3 | 0.69 |
| PF12840 | HTH_20 | 0.69 |
| PF09851 | SHOCT | 0.69 |
| PF06386 | GvpL_GvpF | 0.69 |
| PF08240 | ADH_N | 0.69 |
| PF01568 | Molydop_binding | 0.69 |
| PF01544 | CorA | 0.69 |
| PF10009 | DUF2252 | 0.69 |
| PF00132 | Hexapep | 0.69 |
| PF04185 | Phosphoesterase | 0.69 |
| PF00392 | GntR | 0.69 |
| PF03976 | PPK2 | 0.69 |
| PF02604 | PhdYeFM_antitox | 0.69 |
| PF04851 | ResIII | 0.69 |
| PF13379 | NMT1_2 | 0.69 |
| PF00583 | Acetyltransf_1 | 0.69 |
| PF12680 | SnoaL_2 | 0.69 |
| PF11918 | Peptidase_S41_N | 0.69 |
| PF13482 | RNase_H_2 | 0.69 |
| PF04525 | LOR | 0.69 |
| PF01980 | TrmO | 0.69 |
| PF03793 | PASTA | 0.69 |
| PF13401 | AAA_22 | 0.69 |
| PF13581 | HATPase_c_2 | 0.69 |
| PF00589 | Phage_integrase | 0.69 |
| PF00528 | BPD_transp_1 | 0.69 |
| PF00144 | Beta-lactamase | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 2.76 |
| COG3422 | Uncharacterized conserved protein YegP, UPF0339 family | Function unknown [S] | 2.07 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 1.38 |
| COG1295 | Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase) | Function unknown [S] | 1.38 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.69 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.69 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG1720 | tRNA (Thr-GGU) A37 N6-methylase | Translation, ribosomal structure and biogenesis [J] | 0.69 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.69 |
| COG2326 | Polyphosphate kinase 2, PPK2 family | Energy production and conversion [C] | 0.69 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.69 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.69 |
| COG4894 | Putative phospholipid scramblase YxjI, Tubby2 superfamily | Lipid transport and metabolism [I] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.41 % |
| Unclassified | root | N/A | 27.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_109606640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 799 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101230961 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300004091|Ga0062387_101629211 | Not Available | 522 | Open in IMG/M |
| 3300004152|Ga0062386_100270905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1349 | Open in IMG/M |
| 3300004555|Ga0068922_1155316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300004633|Ga0066395_10800398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744 | 566 | Open in IMG/M |
| 3300005172|Ga0066683_10914046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300005445|Ga0070708_100818126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 875 | Open in IMG/M |
| 3300005533|Ga0070734_10829216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 525 | Open in IMG/M |
| 3300005764|Ga0066903_101015463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1518 | Open in IMG/M |
| 3300005764|Ga0066903_101929772 | All Organisms → cellular organisms → Bacteria | 1132 | Open in IMG/M |
| 3300005764|Ga0066903_103200498 | Not Available | 885 | Open in IMG/M |
| 3300005921|Ga0070766_10468287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 834 | Open in IMG/M |
| 3300005993|Ga0080027_10414461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 543 | Open in IMG/M |
| 3300006028|Ga0070717_10375442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1274 | Open in IMG/M |
| 3300006050|Ga0075028_100635636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300006162|Ga0075030_101192066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300006175|Ga0070712_101329322 | Not Available | 627 | Open in IMG/M |
| 3300006804|Ga0079221_11608214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
| 3300007076|Ga0075435_100201505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1686 | Open in IMG/M |
| 3300009162|Ga0075423_11508749 | Not Available | 721 | Open in IMG/M |
| 3300009672|Ga0116215_1340297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 651 | Open in IMG/M |
| 3300009839|Ga0116223_10775353 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. ATCC 39116 | 549 | Open in IMG/M |
| 3300010043|Ga0126380_11414433 | Not Available | 611 | Open in IMG/M |
| 3300010046|Ga0126384_10786677 | Not Available | 850 | Open in IMG/M |
| 3300010159|Ga0099796_10012485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 2401 | Open in IMG/M |
| 3300010343|Ga0074044_11080148 | Not Available | 526 | Open in IMG/M |
| 3300010358|Ga0126370_11314496 | Not Available | 678 | Open in IMG/M |
| 3300010361|Ga0126378_11854279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
| 3300010361|Ga0126378_12388058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300010362|Ga0126377_10276750 | All Organisms → cellular organisms → Bacteria | 1645 | Open in IMG/M |
| 3300010362|Ga0126377_11268965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 808 | Open in IMG/M |
| 3300010376|Ga0126381_102161492 | Not Available | 801 | Open in IMG/M |
| 3300010379|Ga0136449_102363156 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300010937|Ga0137776_1828250 | Not Available | 731 | Open in IMG/M |
| 3300011120|Ga0150983_16000201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1020 | Open in IMG/M |
| 3300012285|Ga0137370_10054781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 2150 | Open in IMG/M |
| 3300012285|Ga0137370_10390201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300012922|Ga0137394_10502170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1030 | Open in IMG/M |
| 3300012957|Ga0164303_10334627 | Not Available | 908 | Open in IMG/M |
| 3300013104|Ga0157370_12121772 | Not Available | 503 | Open in IMG/M |
| 3300013307|Ga0157372_12729282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300015372|Ga0132256_103165784 | Not Available | 553 | Open in IMG/M |
| 3300015373|Ga0132257_104605854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 502 | Open in IMG/M |
| 3300015374|Ga0132255_104734461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 576 | Open in IMG/M |
| 3300016341|Ga0182035_10616665 | Not Available | 939 | Open in IMG/M |
| 3300016341|Ga0182035_11307293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300016341|Ga0182035_12113169 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300016445|Ga0182038_10879956 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → unclassified Ktedonobacteraceae → Ktedonobacteraceae bacterium | 789 | Open in IMG/M |
| 3300017959|Ga0187779_10251491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1119 | Open in IMG/M |
| 3300017973|Ga0187780_10695957 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 733 | Open in IMG/M |
| 3300017974|Ga0187777_10879198 | Not Available | 643 | Open in IMG/M |
| 3300018007|Ga0187805_10055468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1780 | Open in IMG/M |
| 3300018044|Ga0187890_10881561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 504 | Open in IMG/M |
| 3300018058|Ga0187766_10361022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 953 | Open in IMG/M |
| 3300021181|Ga0210388_11352645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300021362|Ga0213882_10086136 | Not Available | 1265 | Open in IMG/M |
| 3300021403|Ga0210397_10247638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1292 | Open in IMG/M |
| 3300021404|Ga0210389_10843824 | Not Available | 715 | Open in IMG/M |
| 3300021405|Ga0210387_10034787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3991 | Open in IMG/M |
| 3300021420|Ga0210394_11134129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
| 3300021474|Ga0210390_10562539 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126 | 958 | Open in IMG/M |
| 3300021474|Ga0210390_10568498 | Not Available | 952 | Open in IMG/M |
| 3300021474|Ga0210390_11601536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 513 | Open in IMG/M |
| 3300021478|Ga0210402_11166538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
| 3300021559|Ga0210409_10793688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 819 | Open in IMG/M |
| 3300025898|Ga0207692_10285899 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → genistoids sensu lato → core genistoids → Genisteae → Lupinus → Lupinus albus | 999 | Open in IMG/M |
| 3300025911|Ga0207654_11165093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300025924|Ga0207694_10918551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 740 | Open in IMG/M |
| 3300027568|Ga0208042_1123939 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium ADurb.Bin126 | 651 | Open in IMG/M |
| 3300027604|Ga0208324_1169497 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella marina | 589 | Open in IMG/M |
| 3300027680|Ga0207826_1081689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 890 | Open in IMG/M |
| 3300027737|Ga0209038_10078092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 995 | Open in IMG/M |
| 3300027765|Ga0209073_10054996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082 | 1316 | Open in IMG/M |
| 3300027787|Ga0209074_10220193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| 3300027895|Ga0209624_10426361 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300027910|Ga0209583_10093630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1145 | Open in IMG/M |
| 3300028015|Ga0265353_1014461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 738 | Open in IMG/M |
| 3300028775|Ga0302231_10336820 | Not Available | 634 | Open in IMG/M |
| 3300030524|Ga0311357_10743455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 886 | Open in IMG/M |
| 3300030618|Ga0311354_11700147 | Not Available | 551 | Open in IMG/M |
| 3300030707|Ga0310038_10013526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 5308 | Open in IMG/M |
| 3300031170|Ga0307498_10154176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300031545|Ga0318541_10771810 | Not Available | 536 | Open in IMG/M |
| 3300031564|Ga0318573_10115105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1391 | Open in IMG/M |
| 3300031564|Ga0318573_10288198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 878 | Open in IMG/M |
| 3300031573|Ga0310915_10099055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1967 | Open in IMG/M |
| 3300031640|Ga0318555_10440991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 706 | Open in IMG/M |
| 3300031640|Ga0318555_10477056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 676 | Open in IMG/M |
| 3300031679|Ga0318561_10121089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1390 | Open in IMG/M |
| 3300031679|Ga0318561_10207749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1063 | Open in IMG/M |
| 3300031679|Ga0318561_10832005 | Not Available | 507 | Open in IMG/M |
| 3300031681|Ga0318572_10774859 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300031682|Ga0318560_10489825 | Not Available | 666 | Open in IMG/M |
| 3300031708|Ga0310686_101854217 | Not Available | 903 | Open in IMG/M |
| 3300031713|Ga0318496_10557432 | Not Available | 633 | Open in IMG/M |
| 3300031723|Ga0318493_10312401 | Not Available | 850 | Open in IMG/M |
| 3300031736|Ga0318501_10419635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 724 | Open in IMG/M |
| 3300031736|Ga0318501_10449992 | Not Available | 699 | Open in IMG/M |
| 3300031740|Ga0307468_101465524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 631 | Open in IMG/M |
| 3300031748|Ga0318492_10344775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 779 | Open in IMG/M |
| 3300031763|Ga0318537_10267274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 634 | Open in IMG/M |
| 3300031763|Ga0318537_10323542 | Not Available | 570 | Open in IMG/M |
| 3300031764|Ga0318535_10080031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1410 | Open in IMG/M |
| 3300031764|Ga0318535_10109207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1216 | Open in IMG/M |
| 3300031799|Ga0318565_10170406 | Not Available | 1057 | Open in IMG/M |
| 3300031805|Ga0318497_10091241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1625 | Open in IMG/M |
| 3300031805|Ga0318497_10561585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
| 3300031823|Ga0307478_10713412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
| 3300031833|Ga0310917_10469933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 856 | Open in IMG/M |
| 3300031835|Ga0318517_10161876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1003 | Open in IMG/M |
| 3300031845|Ga0318511_10239467 | Not Available | 813 | Open in IMG/M |
| 3300031879|Ga0306919_10515374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 922 | Open in IMG/M |
| 3300031879|Ga0306919_10843689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 703 | Open in IMG/M |
| 3300031880|Ga0318544_10148807 | Not Available | 897 | Open in IMG/M |
| 3300031896|Ga0318551_10807601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 545 | Open in IMG/M |
| 3300031897|Ga0318520_10469336 | Not Available | 775 | Open in IMG/M |
| 3300031910|Ga0306923_10879494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 983 | Open in IMG/M |
| 3300031910|Ga0306923_10885218 | Not Available | 979 | Open in IMG/M |
| 3300031910|Ga0306923_11957855 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031945|Ga0310913_10633043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 758 | Open in IMG/M |
| 3300031954|Ga0306926_10177655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2641 | Open in IMG/M |
| 3300031954|Ga0306926_10718479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1210 | Open in IMG/M |
| 3300032001|Ga0306922_11312878 | Not Available | 731 | Open in IMG/M |
| 3300032008|Ga0318562_10141476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1382 | Open in IMG/M |
| 3300032008|Ga0318562_10786443 | Not Available | 545 | Open in IMG/M |
| 3300032009|Ga0318563_10108204 | Not Available | 1474 | Open in IMG/M |
| 3300032010|Ga0318569_10159179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → unclassified Acidithrix → Acidithrix sp. C25 | 1041 | Open in IMG/M |
| 3300032042|Ga0318545_10121032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 923 | Open in IMG/M |
| 3300032052|Ga0318506_10254240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. ATCC 39116 | 778 | Open in IMG/M |
| 3300032067|Ga0318524_10509276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → unclassified Acidithrix → Acidithrix sp. C25 | 632 | Open in IMG/M |
| 3300032076|Ga0306924_10652897 | Not Available | 1186 | Open in IMG/M |
| 3300032076|Ga0306924_11607759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinoplanes → Actinoplanes octamycinicus | 685 | Open in IMG/M |
| 3300032091|Ga0318577_10338952 | Not Available | 719 | Open in IMG/M |
| 3300032160|Ga0311301_10289325 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2640 | Open in IMG/M |
| 3300032160|Ga0311301_11660445 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300032770|Ga0335085_11439653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
| 3300032828|Ga0335080_10417558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1437 | Open in IMG/M |
| 3300032828|Ga0335080_10479737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1323 | Open in IMG/M |
| 3300032828|Ga0335080_10486660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1312 | Open in IMG/M |
| 3300032828|Ga0335080_11936067 | Not Available | 572 | Open in IMG/M |
| 3300032895|Ga0335074_11290871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300033290|Ga0318519_10664831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → unclassified Rhodococcus → Rhodococcus sp. RD6.2 | 635 | Open in IMG/M |
| 3300033290|Ga0318519_10746157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 35.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.66% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 6.21% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.76% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.76% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.07% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.07% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.07% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.07% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.38% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.69% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.69% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004555 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 7 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005993 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027568 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027680 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1096066403 | 3300000955 | Soil | IHGWLAGRAAQLQGWKLLVATSIAAGLGLVMILLKDLV |
| JGIcombinedJ26739_1012309612 | 3300002245 | Forest Soil | TFHGWNAARAAQLQGWRLAAATSVAAVLGLAMVALKNLVITHLH* |
| Ga0062387_1016292111 | 3300004091 | Bog Forest Soil | QLHRWQLFFTTSIAAALGLVMIAPKDFVLTHLHWRPALAG* |
| Ga0062386_1002709052 | 3300004152 | Bog Forest Soil | IVLLTVHGWLAGRAAQLHSWQLVVATSIAAALGLVMVALKDLVLIHLH* |
| Ga0068922_11553161 | 3300004555 | Peatlands Soil | AAAIVLLTVHGWLAGRAAQLHSWQLVVATSIAAALGLVMVALKDLVLIHLH* |
| Ga0066395_108003981 | 3300004633 | Tropical Forest Soil | RAALAAQLRGWQLMAACSVAAALGLIMILLKDLVLIHLH* |
| Ga0066683_109140462 | 3300005172 | Soil | GWSAGRAAHLAGRTLLTATLVAAALGLVMVLLKDLVLIHLH* |
| Ga0070708_1008181261 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | WSASRAAQLRGRQLLVATSVAAALGLVMIALKDLVLLHFH* |
| Ga0070734_108292162 | 3300005533 | Surface Soil | RAAQLQGHRLLLATSVAAALGIVMILLKDLVLIHLH* |
| Ga0066903_1010154631 | 3300005764 | Tropical Forest Soil | VVVLLIVHAWAAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH* |
| Ga0066903_1019297723 | 3300005764 | Tropical Forest Soil | GGLRGRQLLIATSIAVGLGLAMIGLKDLVLIHLH* |
| Ga0066903_1032004982 | 3300005764 | Tropical Forest Soil | VVVLLIVHAWAAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLGLIHLH* |
| Ga0070766_104682871 | 3300005921 | Soil | LVLIMHAWIAGRAAKLHGWRLAVAVSVAAALGLTMVALKDLVLIHLH* |
| Ga0080027_104144612 | 3300005993 | Prmafrost Soil | AIVLLTFHGWSASRAAQLHGRQLIFATSVALALGLVMIALKDLVLNHLH* |
| Ga0070717_103754422 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | SAGRAAHLAGRALLIATSVAAVLGVAMVLLKDLVLIHMH* |
| Ga0075028_1006356362 | 3300006050 | Watersheds | ATILVLIMHAWTAGRAAKLHGWRLAAAVSVAAALGLTMVALKDLVLIHLH* |
| Ga0075030_1011920662 | 3300006162 | Watersheds | HAWIAGRAARLHGWQLFFTVSVAAALGLTMVALKDLVLIHLH* |
| Ga0070712_1013293221 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LAGRAAQLQGWKLLVATSIAAGLGLVMILLKDLVLIHLH* |
| Ga0079221_116082141 | 3300006804 | Agricultural Soil | ILLLTFHGWSAGRASRLHGWPLAGVTAVAAALGLVMVMLKDLVLIHLH* |
| Ga0075435_1002015051 | 3300007076 | Populus Rhizosphere | AAQFRGWKLAGVTSVATGLGLVMILLKDLVLVHLH* |
| Ga0075423_115087491 | 3300009162 | Populus Rhizosphere | AQLQGWKLVMVTSIAAGLGLVMILLKDLVLVHLH* |
| Ga0116215_13402971 | 3300009672 | Peatlands Soil | LTVHGWLAGRAAQLHNWPLVVATSIAAALGLVMVALKDFVLIHLH* |
| Ga0116223_107753531 | 3300009839 | Peatlands Soil | TVHGWLAGRAAQLRSWQLLLATSIAAALGLVMIALKDLVLIHLH* |
| Ga0126380_114144331 | 3300010043 | Tropical Forest Soil | RASHLRGWQLAGVTSIAAALGLVMVVLKDLVLIHLH* |
| Ga0126384_107866773 | 3300010046 | Tropical Forest Soil | AQLQGRKLLVATSVAAGLGLVMILLKDLALLHLH* |
| Ga0099796_100124854 | 3300010159 | Vadose Zone Soil | MVHAWAAGRSARLHGRQLLFTISIAAGLGLAMIVLKDVVLTHVH* |
| Ga0074044_110801482 | 3300010343 | Bog Forest Soil | AARAAQLRSWQLFFATSTAAALGLVMIALKDFVLIHLH* |
| Ga0126370_113144962 | 3300010358 | Tropical Forest Soil | GRAAHLAGRALLAATSVAAVLGIVMIVLKDIVLIHLH* |
| Ga0126378_118542793 | 3300010361 | Tropical Forest Soil | AGRAAQLRGRKLLYATSVAAALGLVMILLKDLVLIHLH* |
| Ga0126378_123880582 | 3300010361 | Tropical Forest Soil | GLAATILLLIAHAWIAGRAAKLRGWQLVFAVSLAAALGLTMVVLKDLVLIHLH* |
| Ga0126377_102767503 | 3300010362 | Tropical Forest Soil | LAGRAAQLRGRKLLYATSVAAALGLVMILLKDLVLIHLH* |
| Ga0126377_112689652 | 3300010362 | Tropical Forest Soil | LAGRAAQLRGRKLVLVTLIAAGLGLVMILLKDLVLIHLH* |
| Ga0126381_1021614922 | 3300010376 | Tropical Forest Soil | FHGWSAGRASHLRGWQLAGVTSIAAALGLVMVVLKDLVLIHLH* |
| Ga0136449_1023631561 | 3300010379 | Peatlands Soil | AIVLLTVHGWLAGRAAQLRSWQLFFATSIAAALGLVMVALKDLVLIHLH* |
| Ga0137776_18282502 | 3300010937 | Sediment | AGRSAQLHGRQLLLASSIALGLGMAMILLKDLVLTHLH* |
| Ga0150983_160002011 | 3300011120 | Forest Soil | GRAAKLHSWQLYVTTSIAAALGLVMIALKNLVLIHLH* |
| Ga0137370_100547812 | 3300012285 | Vadose Zone Soil | FHGWSAGRASQLRGWQLAAVTSVAAALGLVMVVLKDLVLIHLH* |
| Ga0137370_103902011 | 3300012285 | Vadose Zone Soil | RAAQLRGWKLAGVTSVATGLGLVMILLKDLVLVHLH* |
| Ga0137394_105021702 | 3300012922 | Vadose Zone Soil | VGWSAGRASRLRGWRLAVTTSIAAALGLVMVALKELVILHLH* |
| Ga0164303_103346271 | 3300012957 | Soil | CLAGRAAQLRRWQLFFATSIAAALGLVMIALKDLVLIHLH* |
| Ga0157370_121217722 | 3300013104 | Corn Rhizosphere | SDHPRLAGRAAQLQGWKLLVATSIAAGLGLVMILFKDLVLIHLH* |
| Ga0157372_127292821 | 3300013307 | Corn Rhizosphere | GRAAQFRGWKLAGVTSVATGLGLVMILLKDLVLVHLH* |
| Ga0132256_1031657841 | 3300015372 | Arabidopsis Rhizosphere | LAGRAAQFRGWKLDGVTSVATELGLVMILLKDLVLVHLH* |
| Ga0132257_1046058542 | 3300015373 | Arabidopsis Rhizosphere | GWSAGRASRLRGWQLAGVTSVAAALGLVMVFLKDLVLIHLH* |
| Ga0132255_1047344611 | 3300015374 | Arabidopsis Rhizosphere | RASRLRGWQLAGVTSVAAALGLVMVLLKDLVLIHLH* |
| Ga0182035_106166652 | 3300016341 | Soil | AGRSAQLRGRKLLVATSVAAGLGLVMILLKDLVLIHLH |
| Ga0182035_113072932 | 3300016341 | Soil | AWAAGRSARLRGRQLLVTTSIAAGLGLAMILLKDVILTHVH |
| Ga0182035_121131692 | 3300016341 | Soil | GWSAARSAQLRRWQLAFATSVAVALGLVMVALKDLVLQHLH |
| Ga0182038_108799561 | 3300016445 | Soil | ALAAQLRGWQLFGACSVAAALGLIMILLKDLVLIHLH |
| Ga0187779_102514912 | 3300017959 | Tropical Peatland | RSAQLRGRQLLIATSIAAGLGLAMVALKDLVLIHLH |
| Ga0187780_106959572 | 3300017973 | Tropical Peatland | MVHAWAAGRSAQLRGRQFLVATSIAAGLGLAMVALKDLVLIHLH |
| Ga0187777_108791981 | 3300017974 | Tropical Peatland | RAAQLQRGKLLVATSIAAGLGLIMILLKDLVLIHLH |
| Ga0187805_100554683 | 3300018007 | Freshwater Sediment | TAHGWTAGRAAQLTGWQLTACTSIAAVLGLVMVALKNLVIVHLH |
| Ga0187890_108815611 | 3300018044 | Peatland | VHGWLAGRAAQLRSWQLFFATSIAAALGLVMVALKDLVLIHLH |
| Ga0187766_103610221 | 3300018058 | Tropical Peatland | AGRSAQLRGRQLLIATSIAAGLGLAMVALKDLVLIHLH |
| Ga0210395_104725721 | 3300020582 | Soil | GLAAAIVLLTVHGWLAGRAAKLHSWQLFFATSIAAALGLVMIALKDLVLIHLH |
| Ga0210388_113526451 | 3300021181 | Soil | LTVHGWLAGRAAQLRGWQLFFATSIAAALGLVMIGLKDFVLIHLH |
| Ga0213882_100861362 | 3300021362 | Exposed Rock | AWVAGRAAQLRGRRLLFSTSIGAALGLAMILLKDIVLARLH |
| Ga0210397_102476382 | 3300021403 | Soil | WSAGRAAQLRRWQLFFATSVAAALGLLMIALKDLVLIHLH |
| Ga0210389_108438241 | 3300021404 | Soil | AWAAGRSARLHGRQLLFTISIAAGLGLAMIVLKDVVLTHVH |
| Ga0210387_100347877 | 3300021405 | Soil | AIVLLTVHGWLAGRAAQLRSWPLFFATSIAAALGLAMIALKDLVLIHLH |
| Ga0210394_111341291 | 3300021420 | Soil | AIVLLTVHGCLAGRAAQLRRWQLFFATSIAAALGLVMIALKDLVLIHLH |
| Ga0210390_105625392 | 3300021474 | Soil | LAGRAAQLRSWQLLFATSFAAALGLVMILLKDLVLTHLH |
| Ga0210390_105684983 | 3300021474 | Soil | LAAAIVLLTVHGWLAGRAAKLHSWQLFFATSIAAALGLLMIALKDLVLIHLH |
| Ga0210390_116015362 | 3300021474 | Soil | VLLLTFHGWLAGRAAQLRGWQLFFATSFAAALGLVMVLLKDLVLTHLH |
| Ga0210402_111665382 | 3300021478 | Soil | ARAAQLRRWQLFFATSVAAALGLVMIALKDLVLIHLH |
| Ga0210409_107936881 | 3300021559 | Soil | GWSAGREAQLRRWQLFFATSVAAALGLLMIALKDLVLIHLH |
| Ga0207692_102858992 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RAAHLAGRALLIATSVAAVLGVAMVLLKDLVLIHMH |
| Ga0207654_111650932 | 3300025911 | Corn Rhizosphere | LAGRAAQFRGWKLAGVTSVATGLGLVMILLKDLVLVHLH |
| Ga0207694_109185512 | 3300025924 | Corn Rhizosphere | AAQFRGWKLAGVTSVATGLGLVMILLKDLVLVHLH |
| Ga0208042_11239391 | 3300027568 | Peatlands Soil | VVAIVLLTVHGWLAGRAAQLRGWQLFFATSIAAGLGLVMVALKDFVLIHLH |
| Ga0208324_11694971 | 3300027604 | Peatlands Soil | GRAAQLRSWPLVVATSIAAALGLVMVALKDFVLIHLH |
| Ga0207826_10816891 | 3300027680 | Tropical Forest Soil | VHGWSAARSAQLQGRRLLWASSVALALGLVMVLLKDLVLIHLH |
| Ga0209038_100780921 | 3300027737 | Bog Forest Soil | AAQLHRWQLFFTTSIAAALGLEMIARTDFVLIHLH |
| Ga0209073_100549962 | 3300027765 | Agricultural Soil | RSARLHGRQLLFTISIAAGLGLAMIVLKDVVLTHVH |
| Ga0209074_102201932 | 3300027787 | Agricultural Soil | WLAGRAAQFQGWKLAGITLVATGLGLVMILLKDLVLVHLH |
| Ga0209624_104263612 | 3300027895 | Forest Soil | GRAAQLRSWQLFLATSFAAALGLVMILLKDLVLAHLH |
| Ga0209583_100936302 | 3300027910 | Watersheds | GLAATILLLIMHAWIAGRAARLHGWQLFFTVSVAAALGLTMVALKDLVLIHLH |
| Ga0265353_10144611 | 3300028015 | Soil | LLTFHGWLAARAAQLRSWQLFFATSIAAALGLVMIALKDFVLIHLH |
| Ga0302231_103368201 | 3300028775 | Palsa | MAGRSSRPVAQLRSWQLFFATSIAAALGLLMIGLKDLVLIHLH |
| Ga0311357_107434551 | 3300030524 | Palsa | RSSRPVAQLRSWQLFFATSIAAALGLLMIGLKDLVLIHLH |
| Ga0311354_117001471 | 3300030618 | Palsa | GRAAQLRSWQLFFATSIAAALGLVMIGLKDLVLIHLH |
| Ga0310038_100135267 | 3300030707 | Peatlands Soil | TVHGWLAGRAAQLRSWQLFFATSIAAALGLVMVALKDFVLIHLH |
| Ga0307498_101541762 | 3300031170 | Soil | GRASRLRGWPLAGVTATAAALGLVMVVLKDLVLIHLH |
| Ga0318541_107718102 | 3300031545 | Soil | VGLVTVVILLIVHAWAAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH |
| Ga0318573_101151051 | 3300031564 | Soil | VHSWAAGRSAQLRGRRLLFATSIAAGLGLAMILLNDLVLIHLH |
| Ga0318573_102881983 | 3300031564 | Soil | AAQLQGWKLVMVSSIAVGLGLVMILLKDLVLVHLH |
| Ga0310915_100990551 | 3300031573 | Soil | LAGRAAQLQGWKLLVATSIAAGLGLVMILLKDLVLIHLH |
| Ga0318555_104409912 | 3300031640 | Soil | VLLVIHGWSAARSAQLRRWQLAFATSVAVALGLVMVALKDLVLQHLH |
| Ga0318555_104770562 | 3300031640 | Soil | VGLVTVVILLIVHAWAAGRSAQLRGRQLLFATSIAAGLGLAMFLLKDLVLIHLH |
| Ga0318561_101210891 | 3300031679 | Soil | WLAGRAAQLQSWRLLVATSIAAGLGLVMILLKDLVLTHLH |
| Ga0318561_102077492 | 3300031679 | Soil | SLPAVARSAQRHGVQLIFTTSSAAALGLVMVALKDLVLLHLP |
| Ga0318561_108320051 | 3300031679 | Soil | AGRSAQLHGWRLLFAVSIAAGLGMIMILLKDVVLTHLH |
| Ga0318572_107748591 | 3300031681 | Soil | LAGRAAQLQGWKLVIVTSIAAALGLVMILLKDLVLIHLH |
| Ga0318560_104898252 | 3300031682 | Soil | RAAQLQGRKLLFATSVAAGLGLVMILLKDLVLIHLH |
| Ga0310686_1018542171 | 3300031708 | Soil | SGAIGPAARLAAWVATSFAAALGLVMILLKDLVLIHLH |
| Ga0318496_105574321 | 3300031713 | Soil | VHAWAAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH |
| Ga0318493_103124012 | 3300031723 | Soil | WTAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH |
| Ga0318501_104196351 | 3300031736 | Soil | AAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH |
| Ga0318501_104499921 | 3300031736 | Soil | AAQLRCWRLLAACSVAAAPGLIMILLEDLVLIHLH |
| Ga0307468_1014655241 | 3300031740 | Hardwood Forest Soil | RAARLRGWKLAGVTSVAAGLGLVMILLKDLVLIHLH |
| Ga0318492_103447751 | 3300031748 | Soil | VHAWAAGRSAQLHGRQLLVTTSIAAGLGLAMVALKDLVLIHLH |
| Ga0318537_102672742 | 3300031763 | Soil | GWLAGRAAQLQGWKLVMVSSIAVGLGLVMILLKDLVLVHLH |
| Ga0318537_103235422 | 3300031763 | Soil | RAARLQSWKLLVATSIAAGLGLVMILLKDLVLTHLH |
| Ga0318535_100800313 | 3300031764 | Soil | VGLITVVVLLMVHAWAAGRSAQLHGRQLLGTTSIAGGLGLAMVALKDLVLIHLH |
| Ga0318535_101092073 | 3300031764 | Soil | SWAAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH |
| Ga0318565_101704061 | 3300031799 | Soil | AAGRSAQLRGRQLLFATSIAAGLGLAMFLLKDLVLIHLH |
| Ga0318497_100912413 | 3300031805 | Soil | IVLLVVNGWSAARSAQLRSWQLAFATSVAVALGLVMVLLKDLVLQHLH |
| Ga0318497_105615851 | 3300031805 | Soil | TAHGWLAARAAKLRGWRLLFTVSAAVALGLVMVLLKDLVLIHLH |
| Ga0307478_107134122 | 3300031823 | Hardwood Forest Soil | GRAAQLRGWQLTACTSIAAVLGLVMVALKNLVIVHLH |
| Ga0310917_104699332 | 3300031833 | Soil | LAGRAAQLQSWKLVVATSIAAGLGLVMILLKDLVLIHLH |
| Ga0318517_101618762 | 3300031835 | Soil | VTVVVLLIVHAWTAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH |
| Ga0318511_102394672 | 3300031845 | Soil | LVTVVILLIVHAWAAGRSAQLRGRQLLFATSIAAGLGLAMFLLKDLVLIHLH |
| Ga0306919_105153742 | 3300031879 | Soil | AGRSARLRGRQLLVTTSIAAGLGLAMILLKDVILTHVH |
| Ga0306919_108436891 | 3300031879 | Soil | VTVVILLVIHAWAAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH |
| Ga0318544_101488071 | 3300031880 | Soil | GWLAGRAAQLQRGKLLVATAIAAGLGLVMILLKDLVLIHLH |
| Ga0318551_108076011 | 3300031896 | Soil | AWIAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH |
| Ga0318520_104693361 | 3300031897 | Soil | VVLLIVHAWAAGRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH |
| Ga0306923_108794941 | 3300031910 | Soil | VHAWAAGRSARLRGRQLLVTTSIAAGLGLAMILLKDVILTHVH |
| Ga0306923_108852182 | 3300031910 | Soil | GRSAQLRGRRLLFATSIAAGLGLAMILLKDLVLIHLH |
| Ga0306923_119578552 | 3300031910 | Soil | RAAQLRGRQLVFVTSAAAGLGLVMILLKDLVLLHLH |
| Ga0310913_106330432 | 3300031945 | Soil | GRSAQLRGRRLLFATSIAAGLGLAMILLNDLVLIHLH |
| Ga0306926_101776551 | 3300031954 | Soil | VVILLIVHAWAAGRSAQLRGRQLLFATSIAAGLGLAMFLLKDLVLIHLH |
| Ga0306926_107184791 | 3300031954 | Soil | AARAAKLHGWQLLLAVSVAGALGLIMILLKDLVLVHLH |
| Ga0306922_113128781 | 3300032001 | Soil | LAGRAAQLQGWKLLWATAVAAALGLVMILLKDLVLIHLH |
| Ga0318562_101414761 | 3300032008 | Soil | ARAAQLRGRKLLVATSIAAGLGLVMILLKELLLVHLH |
| Ga0318562_107864431 | 3300032008 | Soil | AGRAAQLQGRRLLVATSIAAGLGLVMILLKDLVLLHLH |
| Ga0318563_101082041 | 3300032009 | Soil | LAGRAAQLQGRKLVIVTSIAASLGLVMILLKDLVLIHLH |
| Ga0318569_101591791 | 3300032010 | Soil | VPAVRAAKLHGWQLLLAVSVAGALGLIMILLKDLVLVHLH |
| Ga0318545_101210321 | 3300032042 | Soil | IVLLVIHGWSAARSAQLRRWQLAFATSVAVALGLVMVALKDLVLQHLH |
| Ga0318506_102542401 | 3300032052 | Soil | VTAVLVLMVHAWAAGRSARLRGRQLLVTTSIAAGLGLAMILLKDVVLTHVH |
| Ga0318524_105092762 | 3300032067 | Soil | IAGRAAKLHGWQLVFAVSVAATLGLTMVVLKNLVLIHLH |
| Ga0306924_106528973 | 3300032076 | Soil | SAQLHGRQLLVTTSIAAGLGLAMVALKDLVLIHLH |
| Ga0306924_116077592 | 3300032076 | Soil | MGGRAIGQLHGRQLLFATSITADLGLAMILLKDLILIHLR |
| Ga0318577_103389521 | 3300032091 | Soil | AGRAAQLQSWKLLVATSVAAGLGLVMILLKDLVLTHLH |
| Ga0311301_102893255 | 3300032160 | Peatlands Soil | RAAQLHSWQLLLATSIAAALGLVMIALKDLVLIHLH |
| Ga0311301_116604451 | 3300032160 | Peatlands Soil | AIVLLTVHGWLAGRAAQLRSWQLFFATSIAAALGLVMVALKDLVLIHLH |
| Ga0335085_114396532 | 3300032770 | Soil | VVLLMFHAWTAGRTAQLRGRQLLFATSIAAGLGLAMIVLKDVVLTHVH |
| Ga0335080_104175581 | 3300032828 | Soil | RAAQLQSWKLLVATSIAAGLGLVMILLKDLVLTHLH |
| Ga0335080_104797371 | 3300032828 | Soil | WSAGRASRLRGWQLAAVTSIAAALGLVMVVLKDLVLIHLH |
| Ga0335080_104866601 | 3300032828 | Soil | VAAIVLLTFHAWLAGRAAQLRTWQLFFATSIAAALGLVMIALKDLVLIYLH |
| Ga0335080_119360671 | 3300032828 | Soil | GRAARLQSWKLLVATSIAAGLGLVMILLKDLVLTHLH |
| Ga0335074_112908712 | 3300032895 | Soil | LAGRAAQLQGWKLLVATSIAAGLGLVMILLKDLVLTHLH |
| Ga0318519_106648312 | 3300033290 | Soil | MAGRAAQLQGRKLLLATSVAAVLGLVMILLKDLVLIHLH |
| Ga0318519_107461572 | 3300033290 | Soil | WAAGRSAQLHGRQLLGTTSIAGGLGLAMVALKDLVLIHLH |
| ⦗Top⦘ |