Basic Information | |
---|---|
Family ID | F050515 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 145 |
Average Sequence Length | 42 residues |
Representative Sequence | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRA |
Number of Associated Samples | 118 |
Number of Associated Scaffolds | 145 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.62 % |
% of genes near scaffold ends (potentially truncated) | 93.79 % |
% of genes from short scaffolds (< 2000 bps) | 92.41 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.862 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (31.724 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.379 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.103 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.29% β-sheet: 0.00% Coil/Unstructured: 79.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 145 Family Scaffolds |
---|---|---|
PF13365 | Trypsin_2 | 14.48 |
PF13561 | adh_short_C2 | 6.90 |
PF00725 | 3HCDH | 3.45 |
PF02798 | GST_N | 2.76 |
PF00561 | Abhydrolase_1 | 1.38 |
PF02515 | CoA_transf_3 | 1.38 |
PF05231 | MASE1 | 1.38 |
PF00043 | GST_C | 1.38 |
PF02737 | 3HCDH_N | 1.38 |
PF00550 | PP-binding | 1.38 |
PF03466 | LysR_substrate | 0.69 |
PF02913 | FAD-oxidase_C | 0.69 |
PF03725 | RNase_PH_C | 0.69 |
PF12974 | Phosphonate-bd | 0.69 |
PF00771 | FHIPEP | 0.69 |
PF02738 | MoCoBD_1 | 0.69 |
PF01553 | Acyltransferase | 0.69 |
PF14497 | GST_C_3 | 0.69 |
PF00183 | HSP90 | 0.69 |
PF07592 | DDE_Tnp_ISAZ013 | 0.69 |
PF00211 | Guanylate_cyc | 0.69 |
PF08450 | SGL | 0.69 |
PF01264 | Chorismate_synt | 0.69 |
PF01522 | Polysacc_deac_1 | 0.69 |
PF00199 | Catalase | 0.69 |
PF00501 | AMP-binding | 0.69 |
COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
---|---|---|---|
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 4.83 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.38 |
COG3447 | Integral membrane sensor domain MASE1 | Signal transduction mechanisms [T] | 1.38 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 1.38 |
COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 1.38 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 1.38 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.38 |
COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 1.38 |
COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 1.38 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 1.38 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.38 |
COG0689 | Ribonuclease PH | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 0.69 |
COG0082 | Chorismate synthase | Amino acid transport and metabolism [E] | 0.69 |
COG1185 | Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) | Translation, ribosomal structure and biogenesis [J] | 0.69 |
COG0326 | Molecular chaperone, HSP90 family | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 0.69 |
COG2123 | Exosome complex RNA-binding protein Rrp42, RNase PH superfamily | Intracellular trafficking, secretion, and vesicular transport [U] | 0.69 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.69 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.69 |
COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 95.86 % |
Unclassified | root | N/A | 4.14 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300003219|JGI26341J46601_10067492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1088 | Open in IMG/M |
3300004091|Ga0062387_100349029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 976 | Open in IMG/M |
3300004633|Ga0066395_10094386 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1429 | Open in IMG/M |
3300005167|Ga0066672_10577258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 729 | Open in IMG/M |
3300005435|Ga0070714_101066282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
3300005450|Ga0066682_10760199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. th.b2 | 589 | Open in IMG/M |
3300005454|Ga0066687_10188120 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1119 | Open in IMG/M |
3300005561|Ga0066699_10853750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 638 | Open in IMG/M |
3300005575|Ga0066702_10139217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1427 | Open in IMG/M |
3300005586|Ga0066691_10684409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 607 | Open in IMG/M |
3300005764|Ga0066903_101382311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1321 | Open in IMG/M |
3300005842|Ga0068858_101735487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 617 | Open in IMG/M |
3300006176|Ga0070765_100040351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3732 | Open in IMG/M |
3300006796|Ga0066665_10619450 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 867 | Open in IMG/M |
3300006854|Ga0075425_101707913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 708 | Open in IMG/M |
3300009137|Ga0066709_103169389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 600 | Open in IMG/M |
3300009156|Ga0111538_12512234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 646 | Open in IMG/M |
3300009444|Ga0114945_10157079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1306 | Open in IMG/M |
3300009525|Ga0116220_10267447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
3300009672|Ga0116215_1199541 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
3300009840|Ga0126313_11438814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
3300010044|Ga0126310_11145779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
3300010048|Ga0126373_10096538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2725 | Open in IMG/M |
3300010048|Ga0126373_11231818 | All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Candidatus Magnetoovum → Candidatus Magnetoovum chiemensis | 814 | Open in IMG/M |
3300010048|Ga0126373_12597519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 565 | Open in IMG/M |
3300010162|Ga0131853_10791852 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 765 | Open in IMG/M |
3300010325|Ga0134064_10330343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
3300010335|Ga0134063_10530811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 592 | Open in IMG/M |
3300010337|Ga0134062_10795903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 505 | Open in IMG/M |
3300010358|Ga0126370_10083180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2159 | Open in IMG/M |
3300010360|Ga0126372_10680284 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1001 | Open in IMG/M |
3300010361|Ga0126378_10141763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2436 | Open in IMG/M |
3300010361|Ga0126378_11266179 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 833 | Open in IMG/M |
3300010399|Ga0134127_10284497 | Not Available | 1584 | Open in IMG/M |
3300010401|Ga0134121_11788511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 641 | Open in IMG/M |
3300010880|Ga0126350_10023528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 552 | Open in IMG/M |
3300011269|Ga0137392_11223095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
3300011442|Ga0137437_1192331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 708 | Open in IMG/M |
3300012189|Ga0137388_10336223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1390 | Open in IMG/M |
3300012202|Ga0137363_10480577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1042 | Open in IMG/M |
3300012202|Ga0137363_10737888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 834 | Open in IMG/M |
3300012207|Ga0137381_10161525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1932 | Open in IMG/M |
3300012359|Ga0137385_11237514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
3300012948|Ga0126375_11779304 | Not Available | 537 | Open in IMG/M |
3300012971|Ga0126369_10024243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4910 | Open in IMG/M |
3300013770|Ga0120123_1162590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
3300014325|Ga0163163_10788637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1013 | Open in IMG/M |
3300015242|Ga0137412_10077427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2705 | Open in IMG/M |
3300015373|Ga0132257_103697916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 557 | Open in IMG/M |
3300016294|Ga0182041_10607243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 962 | Open in IMG/M |
3300016294|Ga0182041_11602418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 601 | Open in IMG/M |
3300016319|Ga0182033_10482565 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300016319|Ga0182033_10841364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 810 | Open in IMG/M |
3300016341|Ga0182035_10227329 | All Organisms → cellular organisms → Bacteria | 1493 | Open in IMG/M |
3300016341|Ga0182035_12092412 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300016357|Ga0182032_10881710 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300016387|Ga0182040_11578375 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 558 | Open in IMG/M |
3300016404|Ga0182037_10550866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 973 | Open in IMG/M |
3300016422|Ga0182039_10695295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 896 | Open in IMG/M |
3300016422|Ga0182039_11088104 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300018090|Ga0187770_11668557 | Not Available | 520 | Open in IMG/M |
3300018431|Ga0066655_10458365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 842 | Open in IMG/M |
3300018433|Ga0066667_10328583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1204 | Open in IMG/M |
3300018433|Ga0066667_10839791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
3300020580|Ga0210403_10569637 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300020582|Ga0210395_11185707 | Not Available | 562 | Open in IMG/M |
3300021168|Ga0210406_10317195 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1264 | Open in IMG/M |
3300021171|Ga0210405_10201693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1577 | Open in IMG/M |
3300021180|Ga0210396_11040539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 692 | Open in IMG/M |
3300021358|Ga0213873_10008966 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2061 | Open in IMG/M |
3300021405|Ga0210387_10772041 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 850 | Open in IMG/M |
3300021444|Ga0213878_10059494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1505 | Open in IMG/M |
3300021560|Ga0126371_11291223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 864 | Open in IMG/M |
3300021560|Ga0126371_11871594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 720 | Open in IMG/M |
3300021560|Ga0126371_12268938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 655 | Open in IMG/M |
3300021560|Ga0126371_13516589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 529 | Open in IMG/M |
3300025906|Ga0207699_11278178 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
3300025915|Ga0207693_10396365 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1079 | Open in IMG/M |
3300025915|Ga0207693_11191165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
3300025944|Ga0207661_11767145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 564 | Open in IMG/M |
3300026315|Ga0209686_1206447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 534 | Open in IMG/M |
3300027383|Ga0209213_1018164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1309 | Open in IMG/M |
3300027703|Ga0207862_1175742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Bordetella → Bordetella genomosp. 10 | 638 | Open in IMG/M |
3300027706|Ga0209581_1157512 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 735 | Open in IMG/M |
3300027729|Ga0209248_10084382 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 962 | Open in IMG/M |
3300027738|Ga0208989_10069240 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1211 | Open in IMG/M |
3300027874|Ga0209465_10009832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 4238 | Open in IMG/M |
3300027894|Ga0209068_10694611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 596 | Open in IMG/M |
3300029636|Ga0222749_10105197 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
3300031446|Ga0170820_13079002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
3300031545|Ga0318541_10095556 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1590 | Open in IMG/M |
3300031561|Ga0318528_10210144 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 1042 | Open in IMG/M |
3300031561|Ga0318528_10686054 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 548 | Open in IMG/M |
3300031564|Ga0318573_10223063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1002 | Open in IMG/M |
3300031573|Ga0310915_10149724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea | 1613 | Open in IMG/M |
3300031679|Ga0318561_10679633 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300031718|Ga0307474_10126994 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1917 | Open in IMG/M |
3300031719|Ga0306917_10286738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1269 | Open in IMG/M |
3300031724|Ga0318500_10142683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1122 | Open in IMG/M |
3300031753|Ga0307477_10933262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 572 | Open in IMG/M |
3300031763|Ga0318537_10008431 | All Organisms → cellular organisms → Bacteria | 3431 | Open in IMG/M |
3300031771|Ga0318546_10224513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1288 | Open in IMG/M |
3300031782|Ga0318552_10372857 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 727 | Open in IMG/M |
3300031793|Ga0318548_10395204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 678 | Open in IMG/M |
3300031795|Ga0318557_10226783 | Not Available | 854 | Open in IMG/M |
3300031795|Ga0318557_10497773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 560 | Open in IMG/M |
3300031798|Ga0318523_10598325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 543 | Open in IMG/M |
3300031819|Ga0318568_10172885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1327 | Open in IMG/M |
3300031819|Ga0318568_10266803 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
3300031831|Ga0318564_10200754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 888 | Open in IMG/M |
3300031833|Ga0310917_10778438 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300031859|Ga0318527_10069979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1405 | Open in IMG/M |
3300031860|Ga0318495_10401039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
3300031879|Ga0306919_10510814 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
3300031879|Ga0306919_11335164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 542 | Open in IMG/M |
3300031890|Ga0306925_10891770 | All Organisms → cellular organisms → Bacteria | 915 | Open in IMG/M |
3300031896|Ga0318551_10161116 | Not Available | 1228 | Open in IMG/M |
3300031896|Ga0318551_10909332 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 514 | Open in IMG/M |
3300031912|Ga0306921_10601522 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
3300031912|Ga0306921_10890036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1011 | Open in IMG/M |
3300031912|Ga0306921_11469401 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300031941|Ga0310912_10462648 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300031945|Ga0310913_11210822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 525 | Open in IMG/M |
3300031946|Ga0310910_10383700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea | 1112 | Open in IMG/M |
3300031947|Ga0310909_10131812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2039 | Open in IMG/M |
3300031947|Ga0310909_10396287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea | 1159 | Open in IMG/M |
3300031947|Ga0310909_11587211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 519 | Open in IMG/M |
3300031981|Ga0318531_10215348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 866 | Open in IMG/M |
3300032001|Ga0306922_10440192 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1394 | Open in IMG/M |
3300032002|Ga0307416_102649716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
3300032043|Ga0318556_10564002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 594 | Open in IMG/M |
3300032044|Ga0318558_10100834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1351 | Open in IMG/M |
3300032044|Ga0318558_10348891 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300032044|Ga0318558_10364651 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
3300032059|Ga0318533_10623138 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Elioraeaceae → Elioraea → Elioraea rosea | 792 | Open in IMG/M |
3300032059|Ga0318533_11099199 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 582 | Open in IMG/M |
3300032060|Ga0318505_10515163 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300032060|Ga0318505_10529903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
3300032065|Ga0318513_10063165 | All Organisms → cellular organisms → Bacteria → Nitrospinae/Tectomicrobia group → Candidatus Tectomicrobia → Candidatus Entotheonella | 1681 | Open in IMG/M |
3300032090|Ga0318518_10188366 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300032174|Ga0307470_11025620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 658 | Open in IMG/M |
3300032261|Ga0306920_100587450 | All Organisms → cellular organisms → Bacteria | 1648 | Open in IMG/M |
3300032261|Ga0306920_100597823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1632 | Open in IMG/M |
3300032515|Ga0348332_14034650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
3300032896|Ga0335075_10014347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 11906 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 31.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.97% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.83% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.76% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.76% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.07% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.07% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.07% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.07% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.38% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.38% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.38% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.38% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.38% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.38% |
Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.69% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.69% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.69% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.69% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.69% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.69% |
Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.69% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.69% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Host-Associated | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021444 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02 | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI26341J46601_100674923 | 3300003219 | Bog Forest Soil | MARYREISPAEMTSAQKEVHDEIVAGRRGRFGGPFQVLIRSPEVCR |
Ga0062387_1003490292 | 3300004091 | Bog Forest Soil | MARYLDITPAEMTPAQRRVHDLIVSGRRGRFGGPFQLLIRAPEICEHAA |
Ga0066395_100943862 | 3300004633 | Tropical Forest Soil | MARYREISPAEMNSEQHRVRDLIVAGRRGRFGGPFQLLIRAPEICEHAAKL |
Ga0066672_105772581 | 3300005167 | Soil | MARYGKITLAEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEICEHAAKL |
Ga0070714_1010662822 | 3300005435 | Agricultural Soil | MSRYREITTAEMNPEQKRVHDQIVGGKRGRFGGPFQLLIRAPEICEHA |
Ga0066682_107601991 | 3300005450 | Soil | MNRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCRHLQRLG |
Ga0066687_101881202 | 3300005454 | Soil | MSRYRDITVAEMNPAQKRVHDQIIAGRRGRFGGPFQLLIRA |
Ga0066699_108537501 | 3300005561 | Soil | MSRYRDITVGEMDPAQKRVHDQIIAGKRGRFGGPF |
Ga0066702_101392173 | 3300005575 | Soil | MARYRDITPAEMTPAQRRVHDLIVSGRRGRFGGPFQL |
Ga0066691_106844091 | 3300005586 | Soil | MGRYREITAAEVNPAQQRVHDQIIAGRRGRFGGPFQLLIRAPEIC |
Ga0066903_1013823111 | 3300005764 | Tropical Forest Soil | LARYKDITVTEMTPAQRRVHDLIVAGRRGRFGGPFPAAD |
Ga0068858_1017354871 | 3300005842 | Switchgrass Rhizosphere | MSRYREISVAEMDPAQKRAHDQIVAGKRGRFGGPFQLLIRAPEIC |
Ga0070765_1000403514 | 3300006176 | Soil | MARYRELTTAEMNPAQKQVVDEIVSGKRGRFGGPFQLLIRAPEVCKH |
Ga0066665_106194501 | 3300006796 | Soil | MSRYREIAPNEMSPAQKRVHDQIIAGKRGRFGGPFHIL |
Ga0075425_1017079132 | 3300006854 | Populus Rhizosphere | LARYREITSAEMTPAQRHVHDLIVAGRRGRFGGPFQ |
Ga0066709_1031693891 | 3300009137 | Grasslands Soil | MNRYREITAAEMNPAQQRVHDQIIAGRRGRFGGPFQLL |
Ga0111538_125122342 | 3300009156 | Populus Rhizosphere | MSRYREITAAEMDPAQKRVHDQIVSGKRGRFGGPFQLLIRAPGVCEHA |
Ga0114945_101570793 | 3300009444 | Thermal Springs | MSRYREIAPAEMNPAQKRVHDEIVAGKRGRFGGPFQLL |
Ga0116220_102674472 | 3300009525 | Peatlands Soil | MARYRELTTAEMNPVQKSVVDEIVSGKRGRFGGPFQLLVRAPEVC |
Ga0116215_11995411 | 3300009672 | Peatlands Soil | MARYRELTTAEMNPVQKSVVDEIVSGKRGRFGGPFQLLVRAPE |
Ga0126313_114388142 | 3300009840 | Serpentine Soil | MSRYREITAAEMDPAQKRVHDQIVAGKRGRFGGPFQLLIRAP |
Ga0126310_111457792 | 3300010044 | Serpentine Soil | MSRYSEIAVGEMTPEQKRVHDQIVSGKRGRFGGPFELLIRAPGVCEHAAP |
Ga0126373_100965383 | 3300010048 | Tropical Forest Soil | MARYREITPAEMNSEQHRVHDLIVAGRRGRFADRSSC* |
Ga0126373_112318181 | 3300010048 | Tropical Forest Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEVC |
Ga0126373_125975191 | 3300010048 | Tropical Forest Soil | LARYRDITLGEMTPAQRRVHDLIVAGRRGRFGGPFQL |
Ga0131853_107918522 | 3300010162 | Termite Gut | MTRYREISSAEMTSAQKDVHDEIVAGRRGRFGGPFQILIRAPEVCRHLQRL |
Ga0134064_103303432 | 3300010325 | Grasslands Soil | MSRYREIPPAEMSPAQQRVRDQIIAGKRGRFGGPFELLI |
Ga0134063_105308112 | 3300010335 | Grasslands Soil | MSRYREISPTEMSPAQKRVHDQIVAGKRGRFGGPFELLIRAPEIC |
Ga0134062_107959031 | 3300010337 | Grasslands Soil | MSRYREISPTEMSPAQKRVHDQIIAGKRGRFGGPF |
Ga0126370_100831801 | 3300010358 | Tropical Forest Soil | LARYKDITATEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEI |
Ga0126372_106802842 | 3300010360 | Tropical Forest Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCRHL* |
Ga0126378_101417631 | 3300010361 | Tropical Forest Soil | MTRYKEISSAEMTSAQKEVRDEIVAGRRGRFGGPFHILIRAP |
Ga0126378_112661792 | 3300010361 | Tropical Forest Soil | MARYRELSPPEMTPAQKQVHDEIIAGRRGRFGGPFQLLIRAPEVCRHLS |
Ga0134127_102844971 | 3300010399 | Terrestrial Soil | MSRYREIAASEMDPAQKRVHDQIVSGKRGRFGGPFQ |
Ga0134121_117885111 | 3300010401 | Terrestrial Soil | MSRYREIAPNEMSPAQRRVHDQIIAGKRGRFGGPF |
Ga0126350_100235282 | 3300010880 | Boreal Forest Soil | MSRYREISPAEMNPAQKRVHDQIVAGKRGRFGGPFELLIRAPE |
Ga0137392_112230951 | 3300011269 | Vadose Zone Soil | MSRYREIPSAEMSPAQKRVRDQIIAGKRGRFGGPFELLI |
Ga0137437_11923312 | 3300011442 | Soil | MSRYREIAAAEMSPAQKRVYDQIIAGARGRFGGPFQLLI |
Ga0137388_103362231 | 3300012189 | Vadose Zone Soil | MARYREIIPVEMTPAQKRVHDLIVAGRRGRFGAPSNS* |
Ga0137363_104805771 | 3300012202 | Vadose Zone Soil | MTRYRDITPAEMTPAQRRVHDLIIAGRRGRFSGPFQLLI |
Ga0137363_107378883 | 3300012202 | Vadose Zone Soil | MARYGKITLAEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEICE |
Ga0137381_101615252 | 3300012207 | Vadose Zone Soil | MSRYREIPPAEMSPAQQRVRDQIIAGKRGRFGGPFELLIRAPE |
Ga0137385_112375142 | 3300012359 | Vadose Zone Soil | MSRYREIPPAEMSPAQQRVRDQVIAGKRGRFGGPFELLIRAPE |
Ga0126375_117793041 | 3300012948 | Tropical Forest Soil | MARYREISPAEMNSEQHRVRDLIVAGRRGRFGGPF |
Ga0126369_100242431 | 3300012971 | Tropical Forest Soil | MARYREITREEMTPAQRRVRELIIAGRRGRFGGPFQ |
Ga0120123_11625902 | 3300013770 | Permafrost | MSRYREISAGEMSPAQKRVHDQIIAGARGRFGGPVQLLIR |
Ga0163163_107886371 | 3300014325 | Switchgrass Rhizosphere | MSRYREITAAEMDPAQKRVHDQIVSGKRGRFGGPFQL |
Ga0137412_100774271 | 3300015242 | Vadose Zone Soil | MSRYRDITAAEMNPAQKRVHDLIIAGRRGRFGGPFQLLIRAPE |
Ga0132257_1036979161 | 3300015373 | Arabidopsis Rhizosphere | MSRYREISVGEMTPEQKRVHDQIVSGKRGRFGGPFQLL |
Ga0182041_106072431 | 3300016294 | Soil | VARYREIMLSEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEICEHAAK |
Ga0182041_116024182 | 3300016294 | Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPE |
Ga0182033_104825652 | 3300016319 | Soil | MTRYREISPVEITPAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCR |
Ga0182033_108413642 | 3300016319 | Soil | LARYRNITPAEMTPAQRRVHDLIIAGRRGRFGGPFQ |
Ga0182035_102273292 | 3300016341 | Soil | MTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFEILIRAP |
Ga0182035_120924122 | 3300016341 | Soil | MTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPF |
Ga0182032_108817104 | 3300016357 | Soil | MIRYREMNTVDMTPAQKEVHDEIVAGRRGRFGGPFQILIRAPEVC |
Ga0182040_115783752 | 3300016387 | Soil | VARYREIMLSEMTPAQRRVHDLIVAGPRGRFGGPF |
Ga0182037_105508661 | 3300016404 | Soil | VARYREIMLSEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEICEHA |
Ga0182039_106952953 | 3300016422 | Soil | LARYRDIMPGEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAP |
Ga0182039_110881042 | 3300016422 | Soil | MTRYREISPVEITPAQKEVHDEIVAGRRGRFGGPFQILI |
Ga0187770_116685571 | 3300018090 | Tropical Peatland | MPRYRELGTAEMNPAQKSVVDEIVSGKRGRFGGPFQL |
Ga0066655_104583652 | 3300018431 | Grasslands Soil | MSRHREIAPNEMSPAPKRVHDQIIAGKRVRFGGSFHILIRSPEICEYASKLG |
Ga0066667_103285832 | 3300018433 | Grasslands Soil | MSRYRDIAVAEMNPAQKRVHDQIVAGKRGRFGGPFQ |
Ga0066667_108397911 | 3300018433 | Grasslands Soil | MSRYRDITVAEMNPAQKRVHDEIIAGKRGRCGGPFQLLIRAPEHY |
Ga0210403_105696373 | 3300020580 | Soil | MTRYREISPAEMTSAQKEVHDEIVAGRRGRFGGPFQIL |
Ga0210395_111857072 | 3300020582 | Soil | MARYRELAAADMNPAQKAVVDAIVSGKRGRFGEPFQL |
Ga0210406_103171951 | 3300021168 | Soil | MARYREITPAEMTPAQRRVHDLIVAGRRGTLGGPFQLL |
Ga0210405_102016932 | 3300021171 | Soil | MARYRELTTAEMNPAQKAVVDEIVSGKRGRFGGPFQLLIRAPEVCR |
Ga0210396_110405391 | 3300021180 | Soil | VPRYRDITPGEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEI |
Ga0213873_100089662 | 3300021358 | Rhizosphere | MSRYRDIAVAEMDPAQRRVHDQIVAGKRGRFGGPFQILIR |
Ga0210387_107720411 | 3300021405 | Soil | MTRYREIGSTEMTSAQKEVHDEIVAGRRGRFGGPFQILIRATE |
Ga0213878_100594941 | 3300021444 | Bulk Soil | MSRYREISVAEMTAEQKEVQDEIVGGRRGRFGGPFQILIRSPEVCRHL |
Ga0126371_112912231 | 3300021560 | Tropical Forest Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQI |
Ga0126371_118715941 | 3300021560 | Tropical Forest Soil | MTRYREISPAEMTSTQKEVHDEIVAGKRGRFGGPFE |
Ga0126371_122689381 | 3300021560 | Tropical Forest Soil | MDRYREISPAEMNSQQHRVHDLIVAGRRGRFGGPFQLLIRTL |
Ga0126371_135165891 | 3300021560 | Tropical Forest Soil | MSRYREISVGEMNPAQREVHDEIVAGRRGRFGGPFQLLI |
Ga0207699_112781782 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MARYREISSAEMTSAQKKVHDEIVAGRRGRFGGPFQILIRAPE |
Ga0207693_103963653 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MARYRNITPAEMTPAQRRVHDLIIAGRRGRFGGPFQLLIRAPEI |
Ga0207693_111911652 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MARYREITLAEMTPAQRRVHDLIVAGRRGRFGGPFQ |
Ga0207661_117671451 | 3300025944 | Corn Rhizosphere | MSRYREITFAEMDPAQKRVHDQIVSGKRGRFGGPFQLLIRAPGVCEHAA |
Ga0209686_12064472 | 3300026315 | Soil | MSRYRDIAVAEMNPAQKRVHDQIVAGKRGRFGVPFQLLIRA |
Ga0209213_10181642 | 3300027383 | Forest Soil | MSRYRDITAAEMNPAQKRVHDLIIAGRRGRFGGPFQLLIRAPEI |
Ga0207862_11757421 | 3300027703 | Tropical Forest Soil | MARYREITLDEMTPPQRRVHDLIVAGRRGRFGGPFQLLIRAPEICEPAAQ |
Ga0209581_11575121 | 3300027706 | Surface Soil | MSRYREITPSEMTPAQKRVHDQIVAGKRGRFGGPFQLLIRAPEICGL |
Ga0209248_100843822 | 3300027729 | Bog Forest Soil | MSRYREISPAEMTPAQKQVHDEIVAGKRGRFGGPFQ |
Ga0208989_100692401 | 3300027738 | Forest Soil | MSRYRDITAAEMNPAQKRVHDLIIAGRRGRFGGPFQLL |
Ga0209465_100098323 | 3300027874 | Tropical Forest Soil | MARYREITPAEMNSEQHRVHDLIVAGRRGRFADRSSC |
Ga0209068_106946112 | 3300027894 | Watersheds | MPRYRQLSPAEYNPAQKAAVDEIVSGKRGRFGGPFELLLRS |
Ga0222749_101051971 | 3300029636 | Soil | MSRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCRHL |
Ga0170820_130790022 | 3300031446 | Forest Soil | LARYRDIAPSEMTPAQSRVHDLIVAGRRGRFGGPFQLLIRAPEICEHAA |
Ga0318541_100955562 | 3300031545 | Soil | MARYREITLVEMSPVQRRVHDLILAGRRGRFGGPFQLLIRAPEI |
Ga0318528_102101442 | 3300031561 | Soil | MTRYREISAAEMTSAQKEVHDEIVAGRRGRFGGPFQI |
Ga0318528_106860542 | 3300031561 | Soil | MTRYREINSAEMTSAQKDVHDEIVAGRRGRFGGPFQILIRAPEVCRHLQ |
Ga0318573_102230632 | 3300031564 | Soil | MTRYREINSAEMTSAQKDVHDEIVAGRRGRFGGPFQILIRAPEVC |
Ga0310915_101497241 | 3300031573 | Soil | MTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQI |
Ga0318561_106796332 | 3300031679 | Soil | MTRYREISPVEITPAQKEVHDEIVAGRRGRFGGPFQI |
Ga0307474_101269941 | 3300031718 | Hardwood Forest Soil | MTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFQILIRAPEV |
Ga0306917_102867383 | 3300031719 | Soil | VARYREIMLSEMTPAQRRVHDLIVAGQRGRFGGPFQLLIRAPEICEHAAK |
Ga0318500_101426832 | 3300031724 | Soil | VARYREITLSEMTPAQRRVHDLIVAGPRGRFGGPFQLLI |
Ga0307477_109332621 | 3300031753 | Hardwood Forest Soil | MARYREITTAEMTPAQRRVHDLIVAGRRGRFGGPF |
Ga0318537_100084315 | 3300031763 | Soil | MTRYREISPVEITPAQKEVHDEIVAGRRGRFGGPFQILIRAPE |
Ga0318546_102245133 | 3300031771 | Soil | MTRYREINSAEMTSAQKDVHDEIVAGRRGRFGGPFQILI |
Ga0318552_103728571 | 3300031782 | Soil | MARYREIALGEMTPAQRRVHDQIVTGRRGRFGGPFQLLIRAPEICEPTAKQRTLP |
Ga0318548_103952041 | 3300031793 | Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEGMPPSAAA |
Ga0318557_102267832 | 3300031795 | Soil | MARYRDITPGEMTPAQRRVHDLIVAGRRGRFGGPFQLLIRAPEICE |
Ga0318557_104977731 | 3300031795 | Soil | MTRYREINTVDMTPAQKEVHDEIVAGRRGRFGGPFQILIRA |
Ga0318523_105983251 | 3300031798 | Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQ |
Ga0318568_101728852 | 3300031819 | Soil | MARYREISRAEMNSEQHRVHDLIVAGRRGRFGGPFQLLIRASEICEHAGKL |
Ga0318568_102668031 | 3300031819 | Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRA |
Ga0318564_102007542 | 3300031831 | Soil | MTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPF |
Ga0310917_107784382 | 3300031833 | Soil | MTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFQILI |
Ga0318527_100699791 | 3300031859 | Soil | LARYRDITPGEMTPDQRRVHDLIVAGRRGRFGGPFQLLIRAPEICEHAAK |
Ga0318495_104010391 | 3300031860 | Soil | MTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQILI |
Ga0306919_105108142 | 3300031879 | Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILI |
Ga0306919_113351641 | 3300031879 | Soil | MARYRDIAPGEMTAAQRRVHDLIVAGRRGRFGGPFQLLIRAPEIC |
Ga0306925_108917701 | 3300031890 | Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEGMPPSAAAGRI |
Ga0318551_101611162 | 3300031896 | Soil | MARYRDITPGEMTPAQRRVHDLIVAGRRGRFGGRRRSGRG |
Ga0318551_109093322 | 3300031896 | Soil | LARYRNITPAEMTPAQRRVHDLIIAGRRGRFGGPF |
Ga0306921_106015222 | 3300031912 | Soil | MTRYREISSADMTSAQKDVHDEIVAGRRGRFGGPFQILIRAPEACRHLQRL |
Ga0306921_108900362 | 3300031912 | Soil | MARYREIALGEMTPAQRRVHDQIVTGRRGRFGGPFQLLIRAPEI |
Ga0306921_114694012 | 3300031912 | Soil | MTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFQILIR |
Ga0310912_104626483 | 3300031941 | Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEGMPPSAAAGR |
Ga0310913_112108221 | 3300031945 | Soil | MARYREITLVEMSPVQRRVHDLILAGRRGRFGGPFQ |
Ga0310910_103837002 | 3300031946 | Soil | VAQAAAPGEPEMTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQIPIRAPEECRH |
Ga0310909_101318121 | 3300031947 | Soil | MTRYREINSAEMTSAQKDVHDEIVAGRRGRFGGPFQIL |
Ga0310909_103962872 | 3300031947 | Soil | MTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQIPIRAPEECRHL |
Ga0310909_115872111 | 3300031947 | Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEGMPPS |
Ga0318531_102153482 | 3300031981 | Soil | MTRYREITAAEMTSAQKEVHDEIVAGRRGRFGGPFQILVRAPEVCRHLQ |
Ga0306922_104401922 | 3300032001 | Soil | LARYRDITPGEMTPDQRRVHDLIVAGRRGLFGGPFQLLIRAPEICEHAAK |
Ga0307416_1026497162 | 3300032002 | Rhizosphere | MSRYREISVVEMGPAQKRVHDQIVAGKRGRFGGPFQ |
Ga0318556_105640021 | 3300032043 | Soil | MARYRDIAPGEMTAAQRRVHDLIVAGRRGRFGGPFQLLI |
Ga0318558_101008342 | 3300032044 | Soil | MARYREISRAEMNSEQHRVHDLIARAGAAGSADRSSY |
Ga0318558_103488912 | 3300032044 | Soil | MTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCRNL |
Ga0318558_103646512 | 3300032044 | Soil | MARYREISPAEMTSAQKEVHDEIVAGRRGRFGGPFQVLIRSPEVCRHL |
Ga0318533_106231381 | 3300032059 | Soil | MTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQIP |
Ga0318533_110991992 | 3300032059 | Soil | MTRYREISSADMTSAQKEVHDEIVAGRRGRFGGPFQILIR |
Ga0318505_105151631 | 3300032060 | Soil | MTRYREISPVEMTPAQKEVHDEIVAGRRGRFGGPFQ |
Ga0318505_105299031 | 3300032060 | Soil | MARYREISPAEMTSAQKEVHDEIVAGRRGRFGGPFQVLIRSPEVC |
Ga0318513_100631651 | 3300032065 | Soil | MARYREISPAEMTSAQKEVHDEIVAGRRGRFGGPFQVLI |
Ga0318518_101883662 | 3300032090 | Soil | MTRYREISSAETTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEGMP |
Ga0307470_110256202 | 3300032174 | Hardwood Forest Soil | MTRYREISSAEMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPEVCRHLQRLGNICVGGAP |
Ga0306920_1005874501 | 3300032261 | Soil | MTRYREISSADMTSAQKEVHDEIVAGRRGRCGGPF |
Ga0306920_1005978231 | 3300032261 | Soil | MTRYREISSAGMTSAQKEVHDEIVAGRRGRFGGPFQILIRAPE |
Ga0348332_140346501 | 3300032515 | Plant Litter | MSRYREISPAEMTSAQKQVHDEIVAGKRGRFGGPF |
Ga0335075_100143471 | 3300032896 | Soil | MARYRELSPADMSAAQKAVVDEIVSGKRGRFGGPF |
⦗Top⦘ |