| Basic Information | |
|---|---|
| Family ID | F050456 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 46 residues |
| Representative Sequence | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGANKVFGWA |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 51.72 % |
| % of genes near scaffold ends (potentially truncated) | 97.24 % |
| % of genes from short scaffolds (< 2000 bps) | 88.97 % |
| Associated GOLD sequencing projects | 133 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.931 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.310 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.586 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.552 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.72% β-sheet: 12.68% Coil/Unstructured: 67.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 46.21 |
| PF08495 | FIST | 15.86 |
| PF04237 | YjbR | 11.72 |
| PF10442 | FIST_C | 8.28 |
| PF13489 | Methyltransf_23 | 1.38 |
| PF12706 | Lactamase_B_2 | 1.38 |
| PF01625 | PMSR | 1.38 |
| PF07973 | tRNA_SAD | 0.69 |
| PF13673 | Acetyltransf_10 | 0.69 |
| PF00296 | Bac_luciferase | 0.69 |
| PF13189 | Cytidylate_kin2 | 0.69 |
| PF03625 | DUF302 | 0.69 |
| PF01810 | LysE | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG3287 | FIST domain protein MJ1623, contains FIST_N and FIST_C domains | Signal transduction mechanisms [T] | 15.86 |
| COG4398 | Small ligand-binding sensory domain FIST | Signal transduction mechanisms [T] | 15.86 |
| COG2315 | Predicted DNA-binding protein with ‘double-wing’ structural motif, MmcQ/YjbR family | Transcription [K] | 11.72 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 1.38 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.69 |
| COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.93 % |
| Unclassified | root | N/A | 2.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2228664021|ICCgaii200_c1039331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 679 | Open in IMG/M |
| 3300000156|NODE_c0738519 | All Organisms → cellular organisms → Bacteria | 11538 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101115662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 533 | Open in IMG/M |
| 3300000880|AL20A1W_1248535 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300000891|JGI10214J12806_10548579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1566 | Open in IMG/M |
| 3300000891|JGI10214J12806_10710234 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300000953|JGI11615J12901_11673129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 544 | Open in IMG/M |
| 3300000956|JGI10216J12902_109903230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300001334|A2165W6_1021791 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
| 3300001686|C688J18823_10155879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1564 | Open in IMG/M |
| 3300004114|Ga0062593_100926567 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
| 3300004480|Ga0062592_100708295 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300004643|Ga0062591_101443475 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005171|Ga0066677_10449294 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005172|Ga0066683_10468634 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005329|Ga0070683_101901652 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005332|Ga0066388_100124993 | All Organisms → cellular organisms → Bacteria | 3105 | Open in IMG/M |
| 3300005335|Ga0070666_10520082 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005337|Ga0070682_100113907 | All Organisms → cellular organisms → Bacteria | 1807 | Open in IMG/M |
| 3300005437|Ga0070710_10681521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 724 | Open in IMG/M |
| 3300005441|Ga0070700_101063165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 669 | Open in IMG/M |
| 3300005445|Ga0070708_101167560 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005450|Ga0066682_10378795 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300005535|Ga0070684_100581294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1041 | Open in IMG/M |
| 3300005543|Ga0070672_100390462 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300005545|Ga0070695_100590326 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300005553|Ga0066695_10689751 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005553|Ga0066695_10852204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 523 | Open in IMG/M |
| 3300005556|Ga0066707_10420812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 868 | Open in IMG/M |
| 3300005558|Ga0066698_10527939 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005560|Ga0066670_10042522 | All Organisms → cellular organisms → Bacteria | 2305 | Open in IMG/M |
| 3300005566|Ga0066693_10010653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2585 | Open in IMG/M |
| 3300005569|Ga0066705_10660196 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005587|Ga0066654_10527312 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300005764|Ga0066903_100729534 | All Organisms → cellular organisms → Bacteria | 1754 | Open in IMG/M |
| 3300006028|Ga0070717_10134664 | All Organisms → cellular organisms → Bacteria | 2127 | Open in IMG/M |
| 3300006237|Ga0097621_100041760 | All Organisms → cellular organisms → Bacteria | 3693 | Open in IMG/M |
| 3300006755|Ga0079222_10888834 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300006804|Ga0079221_10981734 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300006806|Ga0079220_11043036 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300006881|Ga0068865_100105026 | All Organisms → cellular organisms → Bacteria | 2074 | Open in IMG/M |
| 3300007821|Ga0104323_113347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1271 | Open in IMG/M |
| 3300009012|Ga0066710_100380990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2096 | Open in IMG/M |
| 3300009093|Ga0105240_10653089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1152 | Open in IMG/M |
| 3300009100|Ga0075418_11679688 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300009137|Ga0066709_104140441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300009148|Ga0105243_10021607 | All Organisms → cellular organisms → Bacteria | 4885 | Open in IMG/M |
| 3300009148|Ga0105243_10187030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1806 | Open in IMG/M |
| 3300009148|Ga0105243_12720296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 535 | Open in IMG/M |
| 3300009162|Ga0075423_11374976 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
| 3300009545|Ga0105237_12541788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300010040|Ga0126308_10009152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4906 | Open in IMG/M |
| 3300010145|Ga0126321_1033508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 984 | Open in IMG/M |
| 3300010320|Ga0134109_10125127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 911 | Open in IMG/M |
| 3300010326|Ga0134065_10320726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
| 3300010337|Ga0134062_10611338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300010360|Ga0126372_11374667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 738 | Open in IMG/M |
| 3300010371|Ga0134125_10661384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1153 | Open in IMG/M |
| 3300010373|Ga0134128_12102308 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 622 | Open in IMG/M |
| 3300010375|Ga0105239_10226637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2097 | Open in IMG/M |
| 3300010396|Ga0134126_12610868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 549 | Open in IMG/M |
| 3300010398|Ga0126383_13172778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300010400|Ga0134122_10452745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1149 | Open in IMG/M |
| 3300011996|Ga0120156_1068866 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300011999|Ga0120148_1063680 | Not Available | 733 | Open in IMG/M |
| 3300012206|Ga0137380_11151411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300012207|Ga0137381_10854215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300012210|Ga0137378_10877787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 810 | Open in IMG/M |
| 3300012211|Ga0137377_10410201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1293 | Open in IMG/M |
| 3300012211|Ga0137377_11803377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
| 3300012356|Ga0137371_10158486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1775 | Open in IMG/M |
| 3300012356|Ga0137371_11186501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
| 3300012360|Ga0137375_10855757 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 726 | Open in IMG/M |
| 3300012507|Ga0157342_1068939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 534 | Open in IMG/M |
| 3300012508|Ga0157315_1055187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300012532|Ga0137373_10114665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2328 | Open in IMG/M |
| 3300012955|Ga0164298_10229879 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1105 | Open in IMG/M |
| 3300012958|Ga0164299_10336599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 943 | Open in IMG/M |
| 3300012961|Ga0164302_10664634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 766 | Open in IMG/M |
| 3300012977|Ga0134087_10247390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 816 | Open in IMG/M |
| 3300012984|Ga0164309_10858819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
| 3300012986|Ga0164304_10668169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 785 | Open in IMG/M |
| 3300013102|Ga0157371_11093514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 611 | Open in IMG/M |
| 3300013307|Ga0157372_10565853 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300013308|Ga0157375_13224390 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300014157|Ga0134078_10353835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
| 3300017654|Ga0134069_1112697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300017939|Ga0187775_10049827 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300018061|Ga0184619_10115963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1211 | Open in IMG/M |
| 3300018066|Ga0184617_1259025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 522 | Open in IMG/M |
| 3300018081|Ga0184625_10358177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300018465|Ga0190269_10388934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 857 | Open in IMG/M |
| 3300018482|Ga0066669_12143031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300019869|Ga0193705_1057310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300020022|Ga0193733_1042620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1283 | Open in IMG/M |
| 3300021080|Ga0210382_10030422 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300022694|Ga0222623_10122634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1012 | Open in IMG/M |
| 3300022756|Ga0222622_10726052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 723 | Open in IMG/M |
| 3300022893|Ga0247787_1044224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 647 | Open in IMG/M |
| 3300022915|Ga0247790_10000882 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5908 | Open in IMG/M |
| 3300023071|Ga0247752_1000962 | All Organisms → cellular organisms → Bacteria | 3614 | Open in IMG/M |
| 3300024224|Ga0247673_1011124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1159 | Open in IMG/M |
| 3300024286|Ga0247687_1012165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1168 | Open in IMG/M |
| 3300024310|Ga0247681_1023023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 902 | Open in IMG/M |
| 3300025901|Ga0207688_10833730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300025915|Ga0207693_10125841 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2015 | Open in IMG/M |
| 3300025921|Ga0207652_11065567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300025931|Ga0207644_11707369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
| 3300025935|Ga0207709_10928524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 708 | Open in IMG/M |
| 3300025944|Ga0207661_11446710 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
| 3300025949|Ga0207667_11645592 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300025960|Ga0207651_11191690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
| 3300026088|Ga0207641_12102322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 565 | Open in IMG/M |
| 3300026118|Ga0207675_100254483 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300026306|Ga0209468_1139766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300026308|Ga0209265_1136456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 623 | Open in IMG/M |
| 3300026550|Ga0209474_10394939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
| 3300027907|Ga0207428_10967560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
| 3300028281|Ga0247689_1025013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 801 | Open in IMG/M |
| 3300028704|Ga0307321_1081669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300028708|Ga0307295_10129349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 693 | Open in IMG/M |
| 3300028711|Ga0307293_10043113 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300028713|Ga0307303_10143641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 570 | Open in IMG/M |
| 3300028714|Ga0307309_10009213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1739 | Open in IMG/M |
| 3300028715|Ga0307313_10021012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1774 | Open in IMG/M |
| 3300028715|Ga0307313_10183047 | Not Available | 649 | Open in IMG/M |
| 3300028716|Ga0307311_10169513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300028719|Ga0307301_10065508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1129 | Open in IMG/M |
| 3300028784|Ga0307282_10183781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 997 | Open in IMG/M |
| 3300028784|Ga0307282_10590800 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 539 | Open in IMG/M |
| 3300028793|Ga0307299_10286435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 619 | Open in IMG/M |
| 3300028796|Ga0307287_10374019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300028807|Ga0307305_10172181 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300028819|Ga0307296_10080615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1734 | Open in IMG/M |
| 3300028872|Ga0307314_10197151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 604 | Open in IMG/M |
| 3300028872|Ga0307314_10316030 | Not Available | 501 | Open in IMG/M |
| 3300028876|Ga0307286_10334632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 562 | Open in IMG/M |
| 3300030511|Ga0268241_10093706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300031091|Ga0308201_10120122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300031901|Ga0307406_11056305 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 699 | Open in IMG/M |
| 3300031996|Ga0308176_10248141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1705 | Open in IMG/M |
| 3300032004|Ga0307414_10695154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 920 | Open in IMG/M |
| 3300032013|Ga0310906_10362996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 946 | Open in IMG/M |
| 3300032770|Ga0335085_10537198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1327 | Open in IMG/M |
| 3300034819|Ga0373958_0105670 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.31% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.10% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.21% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.14% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.14% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.76% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.76% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.07% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.07% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.07% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.38% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.38% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.38% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.69% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664021 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001334 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A21-65cm)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011996 | Permafrost microbial communities from Nunavut, Canada - A39_65cm_12M | Environmental | Open in IMG/M |
| 3300011999 | Permafrost microbial communities from Nunavut, Canada - A28_65cm_6M | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019869 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024310 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
| 3300031091 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICCgaii200_10393312 | 2228664021 | Soil | VRKATIERRITELALSFPESYEDRPWGDFPVFKVGQNKVFGWMVT |
| NODE_07385199 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | VRKATLERRITELALSFPEAYEDRPWGDFPVFKVGKNKVFGWLVADENGVRV |
| INPhiseqgaiiFebDRAFT_1011156621 | 3300000364 | Soil | VPFRPKTAIRRVRELALSFPQAYEDDPWGFPVFKVA |
| AL20A1W_12485353 | 3300000880 | Permafrost | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGANKVFGWAQVEGGAVHVTVS* |
| JGI10214J12806_105485794 | 3300000891 | Soil | MRVAAIERRITEEALSFPESYEDRPWGDFPVFKVGE |
| JGI10214J12806_107102341 | 3300000891 | Soil | VRKTTIERRITELALSFPEAYEDRPWGDFPVFKVG |
| JGI11615J12901_116731292 | 3300000953 | Soil | VRVAAIERRITEEALSFPESYEDRPWGDFPVFKVGENK |
| JGI10216J12902_1099032302 | 3300000956 | Soil | VRLKAIEEQIRSSALAFPGTYEDRPWGDFPVFKVGE |
| A2165W6_10217911 | 3300001334 | Permafrost | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGANKVFGWAQVEGGAVHVTVKLT |
| C688J18823_101558791 | 3300001686 | Soil | MRVATIERRITELALSFPEAYEDRPWGDFPVFKVGDNKVFA |
| Ga0062593_1009265671 | 3300004114 | Soil | MRVAAIERRITEEALSFPESYEDRPWGDFPVFKVGENKVF |
| Ga0062592_1007082951 | 3300004480 | Soil | VRLEQIEARIREVALGFPESYEDHPWGDFPVFKVGQNKVFGW |
| Ga0062591_1014434752 | 3300004643 | Soil | MRRDELARLRQIEAKIHEVALGFPEAYEDRPWGDFPVFKV |
| Ga0066677_104492941 | 3300005171 | Soil | VRLQAIEERVKETALGFPQAYEDRPWGDFPVFKVGQNKVFGWAVVRD |
| Ga0066683_104686343 | 3300005172 | Soil | VRLSTIERRIHDLALSFPETYEDRPWGDFPVFKVGENKVFGWA |
| Ga0070683_1019016522 | 3300005329 | Corn Rhizosphere | MRAATIERKVKELALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVTRDGAVDV |
| Ga0066388_1001249934 | 3300005332 | Tropical Forest Soil | VRVSAIKRRITEVALSFPQSYEDRPWGDFPVFKVGENKVF |
| Ga0070666_105200821 | 3300005335 | Switchgrass Rhizosphere | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAIT |
| Ga0070682_1001139071 | 3300005337 | Corn Rhizosphere | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVAREESVDVTVKL |
| Ga0070710_106815213 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VVGTAFEQRIRELALSFPETYEDHPWGDFPVFKVGDNKVFAW |
| Ga0070700_1010631651 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLGEALEERIRELALSFPETYEDHPWGDFPVFKVGSNKVFAWL |
| Ga0070708_1011675601 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MESTTPAERQNAAVRLKAIEERITELALGFPQTYEDRPWGDFPVYKVG |
| Ga0066682_103787953 | 3300005450 | Soil | MRLQAIEERIVELALGFPQAYEDRPWGDFPVFKVGENRVFGWAVVEDGAVHVTVKLTAEERD |
| Ga0070684_1005812941 | 3300005535 | Corn Rhizosphere | VRNGQNAAVRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQ |
| Ga0070672_1003904622 | 3300005543 | Miscanthus Rhizosphere | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKV |
| Ga0070695_1005903261 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | VRLATIERRIKDAALAFPEAYEDRPWGDFPVFKVGQNKVFGWA |
| Ga0066695_106897511 | 3300005553 | Soil | VRLEVIEERIKDLALGFPQAYEDRPWGDFPVFKVGENKVFGWAV |
| Ga0066695_108522042 | 3300005553 | Soil | VRLSTIERRIHDLALSFPETYEDRPWGDFPVFKVGENKVFGWAVVEDGAVH |
| Ga0066707_104208121 | 3300005556 | Soil | VRLELIEERIKELALGFPQAYEDRPWGDFPVFKVGENKVFG |
| Ga0066698_105279391 | 3300005558 | Soil | MRLNAIERRIRDLALSFPEAYEDRPWGDFPVFKVGENKVFGWAVAE |
| Ga0066670_100425221 | 3300005560 | Soil | VRGTAIEERIRELALSFPETYEDHPWGDFPVFKVGA |
| Ga0066693_100106531 | 3300005566 | Soil | VLGTAIEARIRELALSFPETYEDHPWGDFPVFKVG |
| Ga0066705_106601961 | 3300005569 | Soil | VRLATIEERIHDLALGFPEAYEDRPWGDFPVYKVGENKVFGW |
| Ga0066654_105273122 | 3300005587 | Soil | VRGTAIEERIRELALSFPETYEDHPWGDFPVFKVGSN |
| Ga0066903_1007295341 | 3300005764 | Tropical Forest Soil | MRGTAIEDRIRELALSFPETYEDHPWGDFPVFKVG |
| Ga0070717_101346643 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGENKVFGWVVA |
| Ga0097621_1000417606 | 3300006237 | Miscanthus Rhizosphere | VRTATIERRITELALSFPEAYEDRPWGNFPVFKVGQNKVFGWVVAREESV |
| Ga0079222_108888341 | 3300006755 | Agricultural Soil | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVF |
| Ga0079221_109817341 | 3300006804 | Agricultural Soil | MRAVRLGAIEQRITELALGFPQAYEDRPWGDFPVFKVGDNKVF |
| Ga0079220_110430361 | 3300006806 | Agricultural Soil | VRASTIERRIIELALSFPEAYEDRPWGDFPVFKVGQNKVFGW |
| Ga0068865_1001050261 | 3300006881 | Miscanthus Rhizosphere | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITRDGAV |
| Ga0104323_1133471 | 3300007821 | Soil | VSSRNRENGAVRTATIERRITELALSFPQSYEDRPWGDFPVFKVGENKVFG |
| Ga0066710_1003809904 | 3300009012 | Grasslands Soil | VRLEVIEERIKDLALGFPQAYEDRPWGDFPVFKVGENKVFGWAVVDDGAVHVT |
| Ga0105240_106530894 | 3300009093 | Corn Rhizosphere | LATIERRIKDAALAFPEAYEDRPWGDFPVFKVGQNKVFGWAVTREESVDVTMKLTAE |
| Ga0075418_116796881 | 3300009100 | Populus Rhizosphere | VRKTTIERRITELALSFPEAYEDRPWGDFPVFKVGQNKV |
| Ga0066709_1041404411 | 3300009137 | Grasslands Soil | VRLELIEERIKELALGFPQAYEDRPWGDFPVFKVGENKVFGWAVVDDGAVHVT |
| Ga0105243_100216078 | 3300009148 | Miscanthus Rhizosphere | VRTATIERRITELALSFPEAYEDRPWGNFPVFKVGQNKVFGWAIVRDG |
| Ga0105243_101870304 | 3300009148 | Miscanthus Rhizosphere | VRAATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAIVRDGAVDVT |
| Ga0105243_127202962 | 3300009148 | Miscanthus Rhizosphere | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITRDGAVDVTV |
| Ga0075423_113749761 | 3300009162 | Populus Rhizosphere | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGENKVFGWAQVAEGAVHVTV |
| Ga0105237_125417882 | 3300009545 | Corn Rhizosphere | MRAATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITRDGAV |
| Ga0126308_100091521 | 3300010040 | Serpentine Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVEDGA |
| Ga0126321_10335081 | 3300010145 | Soil | MGGVRTATIQRRITELALSFPEAYEDRPWGDFPVFKVGANKVF |
| Ga0134109_101251273 | 3300010320 | Grasslands Soil | VRLATIEERIRELALGFPESYEDRPWGDFPVYKVGENKVFGW |
| Ga0134065_103207262 | 3300010326 | Grasslands Soil | VRLSTIERRIRELALGFPEAYEDRPWGDFPVYKVGQNKVFGWAIVRDGSVDVTLKL |
| Ga0134062_106113381 | 3300010337 | Grasslands Soil | VRLEVIEERLNDLALGFPQAYEDRPWGDFPVFKVGENKVFGWA |
| Ga0126372_113746672 | 3300010360 | Tropical Forest Soil | VRVATIERRVTELALSFPESYEDRPWGDFPVFKVGENKVF |
| Ga0134125_106613841 | 3300010371 | Terrestrial Soil | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITR |
| Ga0134128_121023081 | 3300010373 | Terrestrial Soil | VVGTAIEQRMRELALSFPETYEDHPWGDFPVFKVG |
| Ga0105239_102266374 | 3300010375 | Corn Rhizosphere | MRAVRKTTIERRITELALSFPEAYEDRPWGDFPVFKVGENKVFGWMV |
| Ga0134126_126108682 | 3300010396 | Terrestrial Soil | VTLEDLAAEIHGLALSFPEAHEDRPWGDLPVYKVGENRVFAWAVRDDACVRVTLKLTP |
| Ga0126383_131727782 | 3300010398 | Tropical Forest Soil | VRGTAIEERIRVLALSFPETYEDHPWGDFPVFKVGANKV |
| Ga0134122_104527451 | 3300010400 | Terrestrial Soil | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITRDG |
| Ga0120156_10688663 | 3300011996 | Permafrost | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGANKVFGWAQVEGGAVHV |
| Ga0120148_10636801 | 3300011999 | Permafrost | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGANKVFGWA |
| Ga0137380_111514111 | 3300012206 | Vadose Zone Soil | VRLKAIEERITELALGFPEAYEDRPWGDFPVFKVGE |
| Ga0137381_108542153 | 3300012207 | Vadose Zone Soil | VLGESIEQRIRELALSFPETYEDHPWGDFPVFKVG |
| Ga0137378_108777871 | 3300012210 | Vadose Zone Soil | VLGESIEQRIRELALSFPETYEDHPWGDFPVFKVGENKV |
| Ga0137377_104102011 | 3300012211 | Vadose Zone Soil | VLGESIEQRIRELALSFPETYEDHPWGDFPVFKVGENK |
| Ga0137377_118033771 | 3300012211 | Vadose Zone Soil | VRLATIEKRIKELALGFPEAYEDRPWGDFPVFKVGENKVFG |
| Ga0137371_101584863 | 3300012356 | Vadose Zone Soil | VRLEAIEQRITELALSFPEAYEDRPWGDFPVFKVGD |
| Ga0137371_111865011 | 3300012356 | Vadose Zone Soil | VRLATIEERIRELALGFPEAYEDRPWGDFPVYKVGENKVFGWAIVRDESVDVTVKLT |
| Ga0137375_108557573 | 3300012360 | Vadose Zone Soil | VRTATIERRISELALSFPESYEDRPWGDFPVFKVGA |
| Ga0157342_10689392 | 3300012507 | Arabidopsis Rhizosphere | VRTTAIERRITELALSFPESYEDRPWGDFPVFKVGQNKVFGWVVAREESVDVTVKLTA |
| Ga0157315_10551872 | 3300012508 | Arabidopsis Rhizosphere | VLKATIERRITELALSFPESYEDRPWGDFPVFKVGQNKVFGWMVT |
| Ga0137373_101146655 | 3300012532 | Vadose Zone Soil | VRTATIERRISELALSFPESYEDRPWGDFPVFKVGANKVFGWAQV |
| Ga0164298_102298791 | 3300012955 | Soil | VVGTAIEQRIRELALSFPETYEDHPWGDFPVFKVGDNKVFAW |
| Ga0164299_103365992 | 3300012958 | Soil | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVTRDGAVDVTVKLTL |
| Ga0164302_106646341 | 3300012961 | Soil | VVGTAIEQRVRELALSFPETYEDHPWGDFPVFKVGDNKVFAWL |
| Ga0134087_102473901 | 3300012977 | Grasslands Soil | VRLATIEERIRDLALGFPEAYEDRPWGDFPVYKVGENRVF |
| Ga0164309_108588191 | 3300012984 | Soil | MRPATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVTR |
| Ga0164304_106681692 | 3300012986 | Soil | MRPATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVT |
| Ga0157371_110935142 | 3300013102 | Corn Rhizosphere | LATIERRIKDAALAFPEAYEDRPWGDFPVFKVGQNKVFGWAVTREDSVDVTMKLT |
| Ga0157372_105658531 | 3300013307 | Corn Rhizosphere | VRNGQNAAVRTATIERRITELALSFPEAYEDRPWGDFPVFK |
| Ga0157375_132243902 | 3300013308 | Miscanthus Rhizosphere | MLGEALEARIRELALSFPETYEDHPWGDFPVFKVGSNKVF |
| Ga0134078_103538351 | 3300014157 | Grasslands Soil | VRLSTIERRIHDLALSFPETYEDRPWGDFPVFKVGENKVFCWAVAQDGA |
| Ga0134069_11126971 | 3300017654 | Grasslands Soil | VRLSTIERRIYDLALSFPEAYEDRPWGDFPVFKVGQN |
| Ga0187775_100498273 | 3300017939 | Tropical Peatland | VRLATIEERIRELALGFPEAYEDRPWGDFPVYKVGENKVFGWAIVRDGSVDVTVKLTHEE |
| Ga0184619_101159631 | 3300018061 | Groundwater Sediment | MLGTAIETRIRELALSFPATYEDHRWGDFPVFKVGENK |
| Ga0184617_12590252 | 3300018066 | Groundwater Sediment | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVEDGAVHLTVKRTAEE |
| Ga0184625_103581771 | 3300018081 | Groundwater Sediment | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVE |
| Ga0190269_103889341 | 3300018465 | Soil | VRKATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAV |
| Ga0066669_121430312 | 3300018482 | Grasslands Soil | VRLSTIERRIYDLALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVAENGAVHVTV |
| Ga0193705_10573101 | 3300019869 | Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGA |
| Ga0193733_10426201 | 3300020022 | Soil | VRLATIEERIRELALGFPEAYEDRPWGDFPVYKVGESKVFGWAI |
| Ga0210382_100304225 | 3300021080 | Groundwater Sediment | MLGTVIETRIRELALSFPATYEDHPWGDFPVFKVGENKVFAWLTI |
| Ga0222623_101226344 | 3300022694 | Groundwater Sediment | VRKATIERRITALALSFPEAYEDRPWGDFPVFKVGQN |
| Ga0222622_107260521 | 3300022756 | Groundwater Sediment | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVEGGAVHVTVK |
| Ga0247787_10442242 | 3300022893 | Soil | VRKTTIERRITELALSFPEAYEDRPWGDFPVFKVGENKVFGWMVTRDDSVDL |
| Ga0247790_100008821 | 3300022915 | Soil | VRKTTIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWMVTRDDSVDLTLK |
| Ga0247752_10009626 | 3300023071 | Soil | VRKTTIERRITELALSFPEAYEDRPWGDFPVFKVGENKVFG |
| Ga0247673_10111241 | 3300024224 | Soil | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFG |
| Ga0247687_10121652 | 3300024286 | Soil | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGEN |
| Ga0247681_10230231 | 3300024310 | Soil | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVRREDRVDVTMKL |
| Ga0207688_108337301 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAITRDGAVDVTVKLT |
| Ga0207693_101258413 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VGQNGPVRMATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGW |
| Ga0207652_110655671 | 3300025921 | Corn Rhizosphere | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGWA |
| Ga0207644_117073691 | 3300025931 | Switchgrass Rhizosphere | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFAWAVTR |
| Ga0207709_109285241 | 3300025935 | Miscanthus Rhizosphere | VRAATIERKITELALSFPEAYEDRPWGDFPVFKVGQNKVFGW |
| Ga0207661_114467102 | 3300025944 | Corn Rhizosphere | MRAATIERKVKELALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVTRDGAVDVT |
| Ga0207667_116455921 | 3300025949 | Corn Rhizosphere | VRTATIERRITELALSFPEAYEDRPWGNFPVFKVGQNKVFGWAIVRDGAVDVTVK |
| Ga0207651_111916901 | 3300025960 | Switchgrass Rhizosphere | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWVVAREESVDVTVKL |
| Ga0207641_121023221 | 3300026088 | Switchgrass Rhizosphere | MRAATIERKVKELALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVTRDGAVDVTVKL |
| Ga0207675_1002544831 | 3300026118 | Switchgrass Rhizosphere | VRAATIERKVTELALSFPEAYEDRPWGDFPVFKVGQNKVFGW |
| Ga0209468_11397661 | 3300026306 | Soil | MQGTAIEARIRELALSLPKTYEDHPWGDFPVFKVGANKVFAWLT |
| Ga0209265_11364562 | 3300026308 | Soil | VRGTAIEERIRELALSFPETYEDHPWGDFPVFKVGANKVFAWL |
| Ga0209474_103949391 | 3300026550 | Soil | VRLETIEGRIKELALSFPEAYEDRPWGDFPVFKVGDNKVFGWA |
| Ga0207428_109675601 | 3300027907 | Populus Rhizosphere | VRVAAIERRITEEALSFPESYEDRPWGDFPVFKVGENKVFGWAVVEEGGVHVTVKL |
| Ga0247689_10250131 | 3300028281 | Soil | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWVV |
| Ga0307321_10816691 | 3300028704 | Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQIEDGAVHLTV |
| Ga0307295_101293492 | 3300028708 | Soil | VQAATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGW |
| Ga0307293_100431134 | 3300028711 | Soil | VRKATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVAEDDAVHV |
| Ga0307303_101436412 | 3300028713 | Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVEGGAVHVTVKL |
| Ga0307309_100092131 | 3300028714 | Soil | VRAATIERKVKELALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVVR |
| Ga0307313_100210124 | 3300028715 | Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFG |
| Ga0307313_101830472 | 3300028715 | Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVQEGAVH |
| Ga0307311_101695131 | 3300028716 | Soil | MRRNELARLRQIEAKIHEVALGFPEAYEDRPWGDFPVFKVGQNKVFGWAVTRED |
| Ga0307301_100655081 | 3300028719 | Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQIEDGAVHLTVKLT |
| Ga0307282_101837814 | 3300028784 | Soil | MLGTAIETRIRELALSFPATYEDHPWGDFPVFKVGE |
| Ga0307282_105908002 | 3300028784 | Soil | LACPTGRVRNGKNAAVRLEAIEQRITELALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVV |
| Ga0307299_102864352 | 3300028793 | Soil | MRLEAMEQRIRGLALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVLED |
| Ga0307287_103740191 | 3300028796 | Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVF |
| Ga0307305_101721811 | 3300028807 | Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQV |
| Ga0307296_100806154 | 3300028819 | Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVEDG |
| Ga0307314_101971511 | 3300028872 | Soil | MRLEAMEQRIRGLALSFPEAYEDRPWGDFPVFKVGDNKVFGWAVLE |
| Ga0307314_103160301 | 3300028872 | Soil | VRTATIERRITELALSFPESYEDRPWGDFPVFKVGAN |
| Ga0307286_103346322 | 3300028876 | Soil | VQAATIERRITELALSFPEAYEDRPWGDFPVFKVGQNKVFGWAVTRDGA |
| Ga0268241_100937061 | 3300030511 | Soil | VRLSTIERRIKELALSFPQAYEDRPWGDFPVFKVG |
| Ga0308201_101201221 | 3300031091 | Soil | VRKATIERRITELALSFPESYEDRPWGDFPVFKVGANKVFGWAQVQEGAVHVTMKLTAEE |
| Ga0307406_110563051 | 3300031901 | Rhizosphere | MRPVRKTTIERRIMELALSFPEAYEDRPWGDFPVFKVGQNKVFGWMVTRDDSVDVT |
| Ga0308176_102481411 | 3300031996 | Soil | MRVSAIERRIHELALSFPEAYEDRPWGDFPVYKVGAN |
| Ga0307414_106951541 | 3300032004 | Rhizosphere | MRPVRKTTIERRIMELALSFPEAYEDRPWGDFPVFKVGQNKVFGWMVTRDDSVD |
| Ga0310906_103629962 | 3300032013 | Soil | VGQNGPVRMATIERRITELALSFPEAYEDRPWGDFPVFKVGENKV |
| Ga0335085_105371982 | 3300032770 | Soil | VRLATIEERIRELALGFPEAYEDRPWGDFPVYKVGENKVFGWAIVREGSVDVTVKLTQE |
| Ga0373958_0105670_516_665 | 3300034819 | Rhizosphere Soil | VRTATIERRITELALSFPEAYEDRPWGDFPVFKVGENKVFGWVVAREESV |
| ⦗Top⦘ |