Basic Information | |
---|---|
Family ID | F050452 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 145 |
Average Sequence Length | 49 residues |
Representative Sequence | LVVDHHGMLDRALLHHPEVLEAASEFGDPYQVLAPVSHEAHGSGTAW |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 145 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.69 % |
% of genes near scaffold ends (potentially truncated) | 95.86 % |
% of genes from short scaffolds (< 2000 bps) | 91.03 % |
Associated GOLD sequencing projects | 126 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.414 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (8.276 % of family members) |
Environment Ontology (ENVO) | Unclassified (41.379 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.759 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.33% β-sheet: 2.67% Coil/Unstructured: 64.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 145 Family Scaffolds |
---|---|---|
PF09084 | NMT1 | 16.55 |
PF04909 | Amidohydro_2 | 14.48 |
PF13343 | SBP_bac_6 | 3.45 |
PF00582 | Usp | 2.07 |
PF12833 | HTH_18 | 1.38 |
PF07642 | BBP2 | 1.38 |
PF01590 | GAF | 1.38 |
PF05706 | CDKN3 | 1.38 |
PF00903 | Glyoxalase | 1.38 |
PF02775 | TPP_enzyme_C | 1.38 |
PF03401 | TctC | 1.38 |
PF00924 | MS_channel | 0.69 |
PF00782 | DSPc | 0.69 |
PF07690 | MFS_1 | 0.69 |
PF01977 | UbiD | 0.69 |
PF01613 | Flavin_Reduct | 0.69 |
PF13936 | HTH_38 | 0.69 |
PF00158 | Sigma54_activat | 0.69 |
PF00296 | Bac_luciferase | 0.69 |
PF13416 | SBP_bac_8 | 0.69 |
PF01850 | PIN | 0.69 |
PF02586 | SRAP | 0.69 |
PF00557 | Peptidase_M24 | 0.69 |
PF13302 | Acetyltransf_3 | 0.69 |
PF00011 | HSP20 | 0.69 |
PF00535 | Glycos_transf_2 | 0.69 |
PF13579 | Glyco_trans_4_4 | 0.69 |
PF04055 | Radical_SAM | 0.69 |
PF04209 | HgmA_C | 0.69 |
PF00072 | Response_reg | 0.69 |
COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
---|---|---|---|
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 16.55 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 16.55 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 1.38 |
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.69 |
COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.69 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.69 |
COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.69 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.69 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
COG3508 | Homogentisate 1,2-dioxygenase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 93.10 % |
Unclassified | root | N/A | 6.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886013|SwBSRL2_contig_4232579 | Not Available | 889 | Open in IMG/M |
2199352025|deepsgr__Contig_41026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1188 | Open in IMG/M |
3300000033|ICChiseqgaiiDRAFT_c2426234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 5275 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_102001171 | All Organisms → cellular organisms → Bacteria | 2630 | Open in IMG/M |
3300000550|F24TB_10144630 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2640 | Open in IMG/M |
3300000955|JGI1027J12803_108834713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 578 | Open in IMG/M |
3300001139|JGI10220J13317_10206301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
3300001213|JGIcombinedJ13530_102824609 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
3300001431|F14TB_103586566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 844 | Open in IMG/M |
3300001781|Deep_1074542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 625 | Open in IMG/M |
3300002159|JGI24796J26693_1047290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 936 | Open in IMG/M |
3300004009|Ga0055437_10056156 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300004114|Ga0062593_103277303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
3300004156|Ga0062589_101173168 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 732 | Open in IMG/M |
3300004268|Ga0066398_10000996 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
3300004463|Ga0063356_102796007 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
3300004480|Ga0062592_101234239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 701 | Open in IMG/M |
3300004643|Ga0062591_100614100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 964 | Open in IMG/M |
3300004779|Ga0062380_10122446 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300004779|Ga0062380_10172576 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
3300004782|Ga0062382_10286706 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 748 | Open in IMG/M |
3300005183|Ga0068993_10202545 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 690 | Open in IMG/M |
3300005294|Ga0065705_11196134 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
3300005295|Ga0065707_10369749 | Not Available | 892 | Open in IMG/M |
3300005327|Ga0070658_10670288 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 900 | Open in IMG/M |
3300005339|Ga0070660_100027442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 4249 | Open in IMG/M |
3300005343|Ga0070687_101023952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 600 | Open in IMG/M |
3300005353|Ga0070669_101458006 | Not Available | 594 | Open in IMG/M |
3300005355|Ga0070671_100361796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1239 | Open in IMG/M |
3300005355|Ga0070671_101150002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 682 | Open in IMG/M |
3300005356|Ga0070674_101527396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 601 | Open in IMG/M |
3300005446|Ga0066686_10973433 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005467|Ga0070706_101532039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 609 | Open in IMG/M |
3300005518|Ga0070699_101978146 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
3300005529|Ga0070741_10001902 | All Organisms → cellular organisms → Bacteria | 59338 | Open in IMG/M |
3300005544|Ga0070686_100247848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1300 | Open in IMG/M |
3300005564|Ga0070664_102142279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 531 | Open in IMG/M |
3300005616|Ga0068852_102510908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
3300005718|Ga0068866_10204630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1181 | Open in IMG/M |
3300005719|Ga0068861_100704191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 939 | Open in IMG/M |
3300005829|Ga0074479_10136906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1372 | Open in IMG/M |
3300005836|Ga0074470_10990744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1085 | Open in IMG/M |
3300005843|Ga0068860_101831523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 629 | Open in IMG/M |
3300006049|Ga0075417_10635556 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006237|Ga0097621_100302502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1413 | Open in IMG/M |
3300006731|Ga0079249_1514513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 832 | Open in IMG/M |
3300006755|Ga0079222_12336242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 534 | Open in IMG/M |
3300006806|Ga0079220_10101062 | Not Available | 1495 | Open in IMG/M |
3300006847|Ga0075431_101854488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 559 | Open in IMG/M |
3300006852|Ga0075433_10111978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2421 | Open in IMG/M |
3300006852|Ga0075433_11704893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 543 | Open in IMG/M |
3300006881|Ga0068865_101887423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 541 | Open in IMG/M |
3300006904|Ga0075424_100757766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1036 | Open in IMG/M |
3300007076|Ga0075435_100191654 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1730 | Open in IMG/M |
3300009100|Ga0075418_11854119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 656 | Open in IMG/M |
3300009147|Ga0114129_11323656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 892 | Open in IMG/M |
3300009162|Ga0075423_11782881 | Not Available | 664 | Open in IMG/M |
3300009162|Ga0075423_13192610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
3300009553|Ga0105249_10379340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1439 | Open in IMG/M |
3300009792|Ga0126374_10371950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 988 | Open in IMG/M |
3300010043|Ga0126380_10611776 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300010047|Ga0126382_10158787 | Not Available | 1559 | Open in IMG/M |
3300010359|Ga0126376_12218958 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
3300010359|Ga0126376_12414781 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 573 | Open in IMG/M |
3300010360|Ga0126372_10330303 | All Organisms → cellular organisms → Bacteria | 1357 | Open in IMG/M |
3300010360|Ga0126372_10370153 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300010361|Ga0126378_12921000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
3300010362|Ga0126377_10034062 | All Organisms → cellular organisms → Bacteria | 4333 | Open in IMG/M |
3300010362|Ga0126377_11692602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 707 | Open in IMG/M |
3300010366|Ga0126379_10069629 | All Organisms → cellular organisms → Bacteria | 2994 | Open in IMG/M |
3300010375|Ga0105239_10703403 | Not Available | 1155 | Open in IMG/M |
3300011409|Ga0137323_1024498 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300011421|Ga0137462_1146060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 579 | Open in IMG/M |
3300011436|Ga0137458_1274402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 514 | Open in IMG/M |
3300011441|Ga0137452_1323613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 513 | Open in IMG/M |
3300011445|Ga0137427_10069602 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300012179|Ga0137334_1060374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 818 | Open in IMG/M |
3300012202|Ga0137363_11241228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 632 | Open in IMG/M |
3300012353|Ga0137367_10816174 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300012354|Ga0137366_10657210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 749 | Open in IMG/M |
3300012509|Ga0157334_1032227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 644 | Open in IMG/M |
3300012514|Ga0157330_1003366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1237 | Open in IMG/M |
3300012907|Ga0157283_10208323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 621 | Open in IMG/M |
3300012913|Ga0157298_10182516 | Not Available | 658 | Open in IMG/M |
3300012929|Ga0137404_10641803 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
3300012944|Ga0137410_11415550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 604 | Open in IMG/M |
3300013096|Ga0157307_1020118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1097 | Open in IMG/M |
3300013100|Ga0157373_10378097 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300013307|Ga0157372_11938424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
3300014264|Ga0075308_1110939 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 598 | Open in IMG/M |
3300014861|Ga0180061_1068435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 593 | Open in IMG/M |
3300014865|Ga0180078_1082042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 560 | Open in IMG/M |
3300015201|Ga0173478_10791467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 519 | Open in IMG/M |
3300015255|Ga0180077_1145027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 502 | Open in IMG/M |
3300015372|Ga0132256_103275543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 545 | Open in IMG/M |
3300015374|Ga0132255_100430785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1926 | Open in IMG/M |
3300015374|Ga0132255_101899453 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 905 | Open in IMG/M |
3300015374|Ga0132255_102698914 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 759 | Open in IMG/M |
3300018056|Ga0184623_10077478 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
3300018074|Ga0184640_10379466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 639 | Open in IMG/M |
3300018075|Ga0184632_10054452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1731 | Open in IMG/M |
3300018075|Ga0184632_10468374 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 520 | Open in IMG/M |
3300018082|Ga0184639_10502107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 611 | Open in IMG/M |
3300018084|Ga0184629_10218847 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
3300018422|Ga0190265_11581441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 768 | Open in IMG/M |
3300018429|Ga0190272_10137585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1655 | Open in IMG/M |
3300019882|Ga0193713_1059398 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 1091 | Open in IMG/M |
3300020084|Ga0194110_10474011 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 824 | Open in IMG/M |
3300021078|Ga0210381_10183841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 723 | Open in IMG/M |
3300021082|Ga0210380_10001125 | All Organisms → cellular organisms → Bacteria | 11095 | Open in IMG/M |
3300025569|Ga0210073_1031986 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
3300025920|Ga0207649_10124851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1740 | Open in IMG/M |
3300025920|Ga0207649_11240392 | Not Available | 589 | Open in IMG/M |
3300025923|Ga0207681_10170934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1647 | Open in IMG/M |
3300025926|Ga0207659_10427432 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
3300025937|Ga0207669_11526250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 570 | Open in IMG/M |
3300025938|Ga0207704_10873003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 755 | Open in IMG/M |
3300025981|Ga0207640_10720593 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
3300025986|Ga0207658_10425053 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
3300026041|Ga0207639_11566169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 618 | Open in IMG/M |
3300026067|Ga0207678_10662853 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
3300027532|Ga0209544_1149683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 646 | Open in IMG/M |
3300027725|Ga0209178_1229825 | Not Available | 665 | Open in IMG/M |
3300027843|Ga0209798_10205066 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
3300027873|Ga0209814_10031930 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
3300027880|Ga0209481_10592202 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 575 | Open in IMG/M |
3300028379|Ga0268266_10470583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1197 | Open in IMG/M |
3300028381|Ga0268264_10240471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1677 | Open in IMG/M |
3300028802|Ga0307503_10916156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 508 | Open in IMG/M |
3300030729|Ga0308131_1010341 | All Organisms → cellular organisms → Bacteria | 1852 | Open in IMG/M |
(restricted) 3300031197|Ga0255310_10246149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 507 | Open in IMG/M |
3300031720|Ga0307469_11102215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 746 | Open in IMG/M |
3300031820|Ga0307473_10152166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1317 | Open in IMG/M |
3300031890|Ga0306925_10184695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2247 | Open in IMG/M |
3300031954|Ga0306926_11734986 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 711 | Open in IMG/M |
3300032076|Ga0306924_10305900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1824 | Open in IMG/M |
3300032180|Ga0307471_102793502 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300032211|Ga0310896_10949939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 500 | Open in IMG/M |
3300032421|Ga0310812_10103068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1175 | Open in IMG/M |
3300032895|Ga0335074_10147298 | All Organisms → cellular organisms → Bacteria | 2987 | Open in IMG/M |
3300033412|Ga0310810_10388823 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1446 | Open in IMG/M |
3300033557|Ga0316617_100709094 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300034115|Ga0364945_0206008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 601 | Open in IMG/M |
3300034151|Ga0364935_0234595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 596 | Open in IMG/M |
3300034176|Ga0364931_0105191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 895 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.28% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.28% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.59% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 6.21% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.14% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.14% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.14% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.45% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.76% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.07% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.07% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.07% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.07% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.07% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.07% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.07% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.07% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.07% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.07% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.07% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.38% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.38% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.38% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.38% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.38% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.38% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.38% |
Host-Associated | Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Host-Associated | 1.38% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.38% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.69% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.69% |
Hydrothermal Vent Plume | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.69% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.69% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.69% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.69% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.69% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300001781 | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Deep Sites | Environmental | Open in IMG/M |
3300002159 | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge pinacoderm, lysed by freeze-thaw cycling | Host-Associated | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004779 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh | Environmental | Open in IMG/M |
3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006731 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S7 AAIW_A metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300011409 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2 | Environmental | Open in IMG/M |
3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300011445 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2 | Environmental | Open in IMG/M |
3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
3300012907 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1 | Environmental | Open in IMG/M |
3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014264 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_ThreeSqA_D2_rd | Environmental | Open in IMG/M |
3300014861 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT27_16_10D | Environmental | Open in IMG/M |
3300014865 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT499_16_10D | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015255 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10D | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300027532 | Host-associated microbial community of the marine sponge Aplysina aerophoba from Gulf of Piran - sponge mesohyl, lysed by proteinase K digestion (SPAdes) | Host-Associated | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300030729 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1108_32.2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034115 | Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17 | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwBSRL2_0945.00001890 | 2162886013 | Switchgrass Rhizosphere | HMDGSVFNARLYIDDRLIVDTHGMLDRALLHHPEVLEVASQFGDPYQVLAPVSHEAHGSGSAW |
deepsgr_00351360 | 2199352025 | Soil | MGVSTSTNRLVVDTHGMLDRALLHHPEVLEAAAEFGDPYRVLAPVSHEAHGSGSAW |
ICChiseqgaiiDRAFT_24262341 | 3300000033 | Soil | YIDDRLIVDKHGMLDRSLLHHPEVLEAASEFGDPYKVLAPVSHEAHGSGSAW* |
INPhiseqgaiiFebDRAFT_1020011711 | 3300000364 | Soil | LYIDDRLVVDTHGVLDRALLHHPDVLEAAAEFGDPYKVLAPVSHEAHGSGSAW* |
F24TB_101446301 | 3300000550 | Soil | LHHPEVLDVASQFGDPYKVLAPVSHEAHGSGSAW* |
JGI1027J12803_1088347132 | 3300000955 | Soil | LDRALLHHPDVLEAAAEFGDPYKVLAPVSHEAHGSG |
JGI10220J13317_102063012 | 3300001139 | Soil | LYIDDRLIVDKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW* |
JGIcombinedJ13530_1028246091 | 3300001213 | Wetland | IDDRLVVDKHGMLDRSLLHHPEVLEVAAEFGDPYQVLAPVSHEAHGSNTVW* |
F14TB_1035865663 | 3300001431 | Soil | NARLYIDDQLVVDKYGMLDRSLLHHPEVLEAASQYGDPYQVLAPVSHEAHGSNTLW* |
Deep_10745421 | 3300001781 | Hydrothermal Vent Plume | DKYGMLDRSLLYHPDVMEVAEEFGDPVAILAPVSHAAHGSNTQW* |
JGI24796J26693_10472901 | 3300002159 | Host-Associated | RHVDGSVMNARLYIDERLIVHEQGMLDRSLLHHPEVLEAASAYGDPYQVLAPVSHNAHGSGTLW* |
Ga0055437_100561561 | 3300004009 | Natural And Restored Wetlands | LDRSLLHHPDVLEAAAEFGDPYQVLAPVSHAAHGSNTAW* |
Ga0062593_1032773031 | 3300004114 | Soil | GSVFNARLYIDNRLVVDKHGMLDRSLLHHPEVLEAASEFGDPYQVLSPVSHEAHGSGTAW |
Ga0062589_1011731682 | 3300004156 | Soil | YIDDRLVVDKYGMLDRSLLHHPEVIDAAAEYGDPYQVLAPISHAAHGSGTAW* |
Ga0066398_100009961 | 3300004268 | Tropical Forest Soil | MDGSVFNARLYIDDRLVVDTHGMLDRSLLHHPEVLEVASQFGDPYKVLAPVSHEAHGSGSAW* |
Ga0063356_1027960072 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VDKHGMLDRALLHHPDVIEAAAEFGDPHKVLAPVSHEAHGSGSAW* |
Ga0062592_1012342391 | 3300004480 | Soil | DGSVFNGQLYIDDRLVVDKYGMLDRSLLHHPEVIDAAAEYGDPYQVLAPISHAAHGSGTAW* |
Ga0062591_1006141001 | 3300004643 | Soil | RHMDGSVFNGQLYIDDRLVVDKHGMLDRSLLHHPEVLEVAAEFGDPYQVLAPVSHEAHGSNTSW* |
Ga0062380_101224461 | 3300004779 | Wetland Sediment | MDGSVFNGQLYIDDRLVVDKHGMLDRSLLHHPEVLEVAAEFGDPYRVLAPVSHEAHGSNTAW* |
Ga0062380_101725762 | 3300004779 | Wetland Sediment | MLDRSLLHHPEVLEVAAEFGDPYRVLAPVSHDAHGSNTVW* |
Ga0062382_102867061 | 3300004782 | Wetland Sediment | YIDDRLVVDKHGMLDRSLLHHPEVLEVAAEFGDPYRVLAPVSHDAHGSNTVW* |
Ga0068993_102025452 | 3300005183 | Natural And Restored Wetlands | DKHGMLDRSLLHHPEVLEVAAEFGDPYQVLAPVSHEAHGSNTYW* |
Ga0065705_111961341 | 3300005294 | Switchgrass Rhizosphere | RHMDGSVFNARLCIDDQLVVDKHGMLDRALLHHPEVLEVAAQFGDPYKVLAPVSHEAHGSGTAW* |
Ga0065707_103697491 | 3300005295 | Switchgrass Rhizosphere | GSVFNGQLYIDDRLVVDKHGMLDRSLLHHPEVLEVAAEFGDPYQVLAPVSHEAHGSNTSW |
Ga0070658_106702881 | 3300005327 | Corn Rhizosphere | LDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW* |
Ga0070660_1000274421 | 3300005339 | Corn Rhizosphere | VVDHHGMLDRALLHHPEVLEASSEFGDPYQVLAPVSHEAHGSGTAW* |
Ga0070687_1010239521 | 3300005343 | Switchgrass Rhizosphere | GMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW* |
Ga0070669_1014580061 | 3300005353 | Switchgrass Rhizosphere | GMLDRALLHHPEVLEVASQFGNPYQVLAPVSHEAHGSGSAW* |
Ga0070671_1003617962 | 3300005355 | Switchgrass Rhizosphere | LVVDHHGMLDRALLHHPEVLEAASEFGDPYQVLAPVSHEAHGSGTAW* |
Ga0070671_1011500021 | 3300005355 | Switchgrass Rhizosphere | VVDRFGMLDRALLHHPEVLEVAAQYGDPYQVLAPVSHEAHGSNTLW* |
Ga0070674_1015273961 | 3300005356 | Miscanthus Rhizosphere | SVFNGRLYIDDRLVVDTHGMLDRSLLHHPDVLEAAAEFGDPYRVLAPVSHEAHGSGSAW* |
Ga0066686_109734332 | 3300005446 | Soil | EKHGMLDRTLLHHPEVLEAASEFGAPYKVLAPVSHEAHGSGSTW* |
Ga0070706_1015320392 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | YIDDRLVVDTHGMLDRSLLHHPDVLEAASEFGDPYKVLAPVSHEAHGSGSAW* |
Ga0070699_1019781462 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VVDTHGMLDRSLLHHPDVLEAASEFGDPYKVLAPVSHEAHGSGSAW* |
Ga0070741_100019021 | 3300005529 | Surface Soil | SLLHHPEVLEVASQYGDPYEVLAPVSHAAHGSNTLW* |
Ga0070686_1002478482 | 3300005544 | Switchgrass Rhizosphere | VDHHGMLDRALLHHPEVLEAASEFGDPYQVLAPVSHEAHGSGTAW* |
Ga0070664_1021422792 | 3300005564 | Corn Rhizosphere | FNARLYIDDRLIVDTHGMLDRALLHHPEVLEVASQFGNPYQVLAPVSHEAHGSGSAW* |
Ga0068852_1025109082 | 3300005616 | Corn Rhizosphere | SVMNARLYIDDRLIVDKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW* |
Ga0068866_102046302 | 3300005718 | Miscanthus Rhizosphere | LVVDRFGMLDRALLHHPEVLEVAAQYGDPYQVLAPVSHEAHGSNTLW* |
Ga0068861_1007041911 | 3300005719 | Switchgrass Rhizosphere | VVDTHGMLDRSLLHHPDVLEAAAEFGDPYRVLAPVSHEAHGSGSAW* |
Ga0074479_101369061 | 3300005829 | Sediment (Intertidal) | GMLDRSLLHHPEVLDVASQFGDPYHVLAPVSHEAHGSNTLW* |
Ga0074470_109907442 | 3300005836 | Sediment (Intertidal) | VDKYGMLSEALLYHPEVLEVAARYGDPAHVLSPVSHEAHGSNTLW* |
Ga0068860_1018315232 | 3300005843 | Switchgrass Rhizosphere | IVDKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW* |
Ga0075417_106355562 | 3300006049 | Populus Rhizosphere | GMLDRALLHHPEVLEAASEFGDPYKVLAPVSHEAHGSGSTW* |
Ga0097621_1003025021 | 3300006237 | Miscanthus Rhizosphere | DDRLIVDKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW* |
Ga0079249_15145131 | 3300006731 | Marine | KYGMLDRSLLYHPDVVEVAAEFGDPYEVLAPISHQAHGSGTGW* |
Ga0079222_123362422 | 3300006755 | Agricultural Soil | AQPLAEVPRRHHGMLDRSLLHHPEVLEAASEFGDPYQVLAPVSHEAHGSGTAW* |
Ga0079220_101010622 | 3300006806 | Agricultural Soil | LIVDTQGMLDRALLHHPEVLEVASQFGDPYQVLAPVSHEAHGSGSAW* |
Ga0075431_1018544881 | 3300006847 | Populus Rhizosphere | FRHIDGSVFNGKLYIDDRLIVDKYGMLDRSLLHHPEVLDAAAEHGDPYQVLAPISHAAHGSGTAW* |
Ga0075433_101119781 | 3300006852 | Populus Rhizosphere | LYIDDRLVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW* |
Ga0075433_117048932 | 3300006852 | Populus Rhizosphere | YIDDRLVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW* |
Ga0068865_1018874232 | 3300006881 | Miscanthus Rhizosphere | ARLYIDDPLVVDHHGMLDRALLHHPEVLEASSEFGDPYQVLAPVSHEAHGSGTAW* |
Ga0075424_1007577662 | 3300006904 | Populus Rhizosphere | ARLYIDDRLVVDTHGMLDRALLHHPDVLEAASEFGDPYKVLAPVSHEAHGSGSTW* |
Ga0075435_1001916543 | 3300007076 | Populus Rhizosphere | SLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW* |
Ga0075418_118541191 | 3300009100 | Populus Rhizosphere | ALLHHPEVLEAAAEFGDPYTVLAPVSHEAHGSGTIW* |
Ga0114129_113236562 | 3300009147 | Populus Rhizosphere | DGSIMNGRLYIDGRIVVHEGGMLDRSLLHNPDVLEVASKYGDPYAVLAPVSHAAHGSGTLW* |
Ga0075423_117828811 | 3300009162 | Populus Rhizosphere | DDRLIVDTHGMLDRALLHHPEVLEVASQFGNPYQVLAPVSHEAHGSGSAW* |
Ga0075423_131926102 | 3300009162 | Populus Rhizosphere | ALLHHPDVLEAAAEFGDPYKVLAPVSHEAHGSGSAW* |
Ga0105249_103793401 | 3300009553 | Switchgrass Rhizosphere | RLIVDKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW* |
Ga0126374_103719501 | 3300009792 | Tropical Forest Soil | LLHHPEVLEVASQFGDPYKVLAPVSHEAHGSGSAW* |
Ga0126380_106117761 | 3300010043 | Tropical Forest Soil | RLYIDDRLVVDTHGMLDRSLLHHPEVLEVASQFGDPYKVLAPVSHEAHGSGSAW* |
Ga0126382_101587871 | 3300010047 | Tropical Forest Soil | RLYIDDRLVVDTHGMLDRSLLHHPEVLEVASRFGDPYKVLAPVSHEAHGSGSAW* |
Ga0126376_122189581 | 3300010359 | Tropical Forest Soil | LYIDDRLVVDTHGMLDRSLLHHPEVLEVASQFGDPYKVLAPVSHEAHGSGSAW* |
Ga0126376_124147811 | 3300010359 | Tropical Forest Soil | VVDTHGMLDRSLLHHPEVLEVASQFGDPYKVLAPVSHEAHGSGSAW* |
Ga0126372_103303031 | 3300010360 | Tropical Forest Soil | RHMDGSVFDARLYIDDRLVVDTHGMLDRSLLHHPDVLETASEFGDPYKVLAPVSHEAHGSGSAW* |
Ga0126372_103701532 | 3300010360 | Tropical Forest Soil | GMLDRSLLHHPDVLNAAAEFGDPYHVLAPVSHEAHGSGSIW* |
Ga0126378_129210001 | 3300010361 | Tropical Forest Soil | HFFDARLYIDDRLIVDKHGMLDRTLLYHPEVLEVASQFGDPYKVLAPVSHEAHGSGTAW* |
Ga0126377_100340624 | 3300010362 | Tropical Forest Soil | VVDTHGMLDRALLHHPEVLEVASQFGDPYRVLAPVSHEAHGSNTAW* |
Ga0126377_116926021 | 3300010362 | Tropical Forest Soil | NARLYIDDRLVVDTHGMLDRSLLHHPEVLEVASQFGDPYRVLAPVSHEAHGSGSAW* |
Ga0126379_100696294 | 3300010366 | Tropical Forest Soil | IDDRLVVDTHGMLDRSLLHHPEVLEVASQFGDPYKVLGPVSHEAHGSGSAW* |
Ga0105239_107034032 | 3300010375 | Corn Rhizosphere | HGMLDRALLHHPEVLEVASQFGNPYQVLAPVSHEAHGSGSAW* |
Ga0137323_10244982 | 3300011409 | Soil | LHHPDVLEAAAEFGDPYRVLAPVSHEAHGSNTAW* |
Ga0137462_11460601 | 3300011421 | Soil | VDKYGMLDRSLLHHPEVLDAAAEYGDPYQVLAPISHAAHGSGTAW* |
Ga0137458_12744022 | 3300011436 | Soil | GSVFNGRLYIDDRLVVDKYGMLDRALLHHPEVLDAAAAYGDPYQVLAPISHAAHGSGTAW |
Ga0137452_13236131 | 3300011441 | Soil | MLDRSLLHHPDVLEVAAEFGDPYQVLAPVSHEAHGSNTSW* |
Ga0137427_100696022 | 3300011445 | Soil | DRLVVDKHGMLDRSLLHHPDVLETAAEFGDPYQVLAPVSHAAHGSNTAW* |
Ga0137334_10603741 | 3300012179 | Soil | LLHHPDVLEAAAEFGDPYQVLAPVSHAAHGSNTAW* |
Ga0137363_112412281 | 3300012202 | Vadose Zone Soil | RLYIDDRLVVDTHGMLDRSLLHHPDVLEAASEFGDPYKVLAPVSHEAHGSGSAW* |
Ga0137367_108161741 | 3300012353 | Vadose Zone Soil | KHGMLDRALLHHPEVLEAASEFGDPYKVLAPVSHEAHGSGTAW* |
Ga0137366_106572101 | 3300012354 | Vadose Zone Soil | LYIDDRLIVDKHGMLDRALLHHPEVLDAASEFGDPYKVLAPVSHEAHGSGSTW* |
Ga0157334_10322272 | 3300012509 | Soil | VFNARLYIDDRLIVDTHGMLDRALLHHPDVLEAAAEFGDPYKVLAPVSHEAHGSGSAW* |
Ga0157330_10033661 | 3300012514 | Soil | RALLHHPEVLEAAAEFGDPYRVLAPVSHEAHGSGSAW* |
Ga0157283_102083232 | 3300012907 | Soil | VDGSVMNARLYIDDRLVVDKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW* |
Ga0157298_101825162 | 3300012913 | Soil | DRLIVDTHGMLDRALLRHPEVLEVASQFGDPYQVLAPVSHEAHGSGSAW* |
Ga0137404_106418031 | 3300012929 | Vadose Zone Soil | VFNARLYIDNRLIVDKHGMLDRALLHHPEVLEAASEFGDPYKVLAPVSHEAHGSGSTW* |
Ga0137410_114155501 | 3300012944 | Vadose Zone Soil | LVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW* |
Ga0157307_10201181 | 3300013096 | Soil | LLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW* |
Ga0157373_103780972 | 3300013100 | Corn Rhizosphere | SFLNDPEVRKLAGEFGDPDEVLAPVSHAAHGSGTLW* |
Ga0157372_119384242 | 3300013307 | Corn Rhizosphere | YIDDRLVVDTHGMLDRSLLHHPDVLEAAAEFGDPYRVLAPVSHEAHGSGSAW* |
Ga0075308_11109391 | 3300014264 | Natural And Restored Wetlands | GMLDRSLLHHPEVLEVAAEFGDPYQVLAPVSHEAHGSNTAW* |
Ga0180061_10684352 | 3300014861 | Soil | YIDDRLVVDKHGMLDRSLLHHPEVLEVAAEFGDPYQVLAPVSHEAHGSNTSW* |
Ga0180078_10820421 | 3300014865 | Soil | IDDRLVVDKHGMLDRSLLHHPEVLEVAAEFGDPYRVLAPVSHEAHGSNTAW* |
Ga0173478_107914671 | 3300015201 | Soil | RLVVDKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTSW* |
Ga0180077_11450272 | 3300015255 | Soil | DRSLLHHPEVLEVAAEFGDPYRVLAPVSHEAHGSNTAW* |
Ga0132256_1032755431 | 3300015372 | Arabidopsis Rhizosphere | VDTHGMLDRALLHHPDVLEAAAEFGDPYKVLAPVSHEAHGSGSAW* |
Ga0132255_1004307854 | 3300015374 | Arabidopsis Rhizosphere | FLHHPEVLKVASQFGDPYQVLAPVSHEAHGSGTAW* |
Ga0132255_1018994531 | 3300015374 | Arabidopsis Rhizosphere | ARLYIDDRLVVDTHGMLDRALLNHPDVLEAAAEFGDPYKVLAPVSHEAHGSGSAW* |
Ga0132255_1026989142 | 3300015374 | Arabidopsis Rhizosphere | YIDDRLIVDKHGMLDRALLHHPEVLEAASAFGDPYQVLAPVSHEAHGSGTAW* |
Ga0184623_100774781 | 3300018056 | Groundwater Sediment | DGRLVVDTHGMLDRSLLHHPDVLAAASEYGDPHQVLAPISHAAHGSGTLW |
Ga0184640_103794663 | 3300018074 | Groundwater Sediment | YIDDRLVVDTHGMLDRSLLQHPEVLEAASEFGDPYKVLAPVSHEAHGSGSAW |
Ga0184632_100544521 | 3300018075 | Groundwater Sediment | YIDDRLVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW |
Ga0184632_104683742 | 3300018075 | Groundwater Sediment | DDRLVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW |
Ga0184639_105021071 | 3300018082 | Groundwater Sediment | DDRLVVDKHGMLDRSLLHHPDVLEAAAEFGDPYRVLAPVSHAAHGSNTAW |
Ga0184629_102188472 | 3300018084 | Groundwater Sediment | SVFNGRLFIDGRLVVDIHGMLDRSLLHHPDVLAAASEYGDPYQVLAPISHAAHGSGTLW |
Ga0190265_115814412 | 3300018422 | Soil | RSLLHHPDVLEVAAQFGDPYQVLAPVSHEAHGSNTLW |
Ga0190272_101375853 | 3300018429 | Soil | RALLHHPEVLEAASEFGDPYTVLAPVSHEAHGSGTIW |
Ga0193713_10593982 | 3300019882 | Soil | LDRALLHDPEVLEAAAEFGDPYRVLAPVSHEAHGSGSAW |
Ga0194110_104740111 | 3300020084 | Freshwater Lake | DDRLVVDKFGMLDRALLHHPQVLEVAAEFGDPYQVLAPVSHEAHGSNTAW |
Ga0210381_101838412 | 3300021078 | Groundwater Sediment | HMDGSVFNARLYIDDRLVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW |
Ga0210380_100011251 | 3300021082 | Groundwater Sediment | RSLLHHPEVLEVAAEFGDPYRVLAPVSHEAHGSNTAW |
Ga0210073_10319863 | 3300025569 | Natural And Restored Wetlands | LDRSLLHHPDVLEAAAEFGDPYQVLAPVSHAAHGSNTAW |
Ga0207649_101248513 | 3300025920 | Corn Rhizosphere | MDGSVMNARLYIDDRLIVDKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW |
Ga0207649_112403922 | 3300025920 | Corn Rhizosphere | LYIDDRLIVDTHGMLDRALLHHPEVLEVASQFGNPYQVLAPVSHEAHGSGSAW |
Ga0207681_101709342 | 3300025923 | Switchgrass Rhizosphere | DKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW |
Ga0207659_104274321 | 3300025926 | Miscanthus Rhizosphere | GSVFNARLYIDDPLVVDHHGMLDRALLHHPEVLEASSEFGDPYQVLAPVSHEAHGSGTAW |
Ga0207669_115262502 | 3300025937 | Miscanthus Rhizosphere | RLIVDTHGMLDRALLHHPDVLEAAAEFGDPYKVLAPVSHEAHGSGSAW |
Ga0207704_108730031 | 3300025938 | Miscanthus Rhizosphere | NARLYIDDPLVVDHHGMLDRALLHHPEVLEASSEFGDPYQVLAPVSHEAHGSGTAW |
Ga0207640_107205931 | 3300025981 | Corn Rhizosphere | LVVDHHGMLNRALLHHPEVLEAASEFGDPYQVLAPVSHEAHGSGTAW |
Ga0207658_104250534 | 3300025986 | Switchgrass Rhizosphere | DRLVVDHHGMLDRALLHHPEVLEASSEFGDPYQVLAPVSHEAHGSGTAW |
Ga0207639_115661692 | 3300026041 | Corn Rhizosphere | LDRALLHHPEVLEASSEFGDPYQVLAPVSHEAHGSGTAW |
Ga0207678_106628533 | 3300026067 | Corn Rhizosphere | RALLHHPEVLEASSEFGDPYQVLAPVSHEAHGSGTAW |
Ga0209544_11496831 | 3300027532 | Host-Associated | DRLIVHEQGMLDRSLLHHPEVLEAASAYGDPYQVLAPVSHDAHGSGTLW |
Ga0209178_12298252 | 3300027725 | Agricultural Soil | NARLYIDDRLIVDTHGMLDRALLHHPEVLEVASQFGDPYQVLAPVSHEAHGSGSAW |
Ga0209798_102050661 | 3300027843 | Wetland Sediment | LHIDDRLVVDKHGMLDRSLLHHPEVLEVAAEFGDPYRVLAPVSHEAHGSNTAW |
Ga0209814_100319305 | 3300027873 | Populus Rhizosphere | GMLDRALLHHPEVLEAASEFGDPYKVLAPVSHEAHGSGSTW |
Ga0209481_105922022 | 3300027880 | Populus Rhizosphere | RLYIDDRLVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW |
Ga0268266_104705832 | 3300028379 | Switchgrass Rhizosphere | SLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW |
Ga0268264_102404713 | 3300028381 | Switchgrass Rhizosphere | LIVDKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW |
Ga0307503_109161561 | 3300028802 | Soil | YIDDRLVVDKHGMLDRSLLHHPEVLEVAAEFGDPYQVLAPVSHEAHGSNTAW |
Ga0308131_10103413 | 3300030729 | Marine | YIDGRLLVDKYGMLDRTLLYHPDVVQVAKEFGDPVEILAPVSHAAHGSNTQW |
(restricted) Ga0255310_102461491 | 3300031197 | Sandy Soil | DKHGMLDRSLLHHSEVLEAAAEFGDPYQVLAPVSHAAHGSNTAW |
Ga0307469_111022152 | 3300031720 | Hardwood Forest Soil | LYIDDRLVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW |
Ga0307473_101521662 | 3300031820 | Hardwood Forest Soil | GSVFNARLYIDDRLVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW |
Ga0306925_101846951 | 3300031890 | Soil | GMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW |
Ga0306926_117349861 | 3300031954 | Soil | RHMDGSVFNARLYIDDRLVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW |
Ga0306924_103059001 | 3300032076 | Soil | DARLYIDDRLIVDKHGMLDRTLLYHPEVLEVASQFGDPYKVLAPVSHEAHGSGTAW |
Ga0307471_1027935021 | 3300032180 | Hardwood Forest Soil | RLYIDDRLVVDTHGMLDRSLLHHPDVLEAASEFGDPYRVLAPVSHEAHGSGSAW |
Ga0310896_109499392 | 3300032211 | Soil | DTHGMLDRALLHHPEVLEAAAEFGDPYKVLAPVSHEAHGSGSAW |
Ga0310812_101030682 | 3300032421 | Soil | SVMNARLYIDDRLIVDKYGMLDRSLLHHPEVLDVASQFGDPYQVLAPVSHEAHGSNTLW |
Ga0335074_101472984 | 3300032895 | Soil | DGRLIVDKFGMLEPSFLADPDVVRVASEFGDPDELLAPISHAAHGSGTLW |
Ga0310810_103888232 | 3300033412 | Soil | MDGSVFNARLYIDDPLVVDHHGMLDRALLHHPEVLEASSEFGDPYQVLAPVSHEAHGSGTAW |
Ga0316617_1007090942 | 3300033557 | Soil | GMLDRTLLYHPDVLEVAAEFGDPYQVLAPVSHEAHGSNTSW |
Ga0364945_0206008_471_599 | 3300034115 | Sediment | HGMLDRSLLHHPEVLDVASGFGDPYKVLAPVSHEAHGSGSAW |
Ga0364935_0234595_457_579 | 3300034151 | Sediment | MLDRSLLHHPEVLEVAAEFGDPYRVLAPVSHEAHGSNTAW |
Ga0364931_0105191_7_195 | 3300034176 | Sediment | MDGSVFNARLYIDDRLVVDTHGMLDRSLLHHPEVLDVASGFGDPYKVLAPLSHEAHGSGSAW |
⦗Top⦘ |