Basic Information | |
---|---|
Family ID | F050422 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 145 |
Average Sequence Length | 40 residues |
Representative Sequence | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTTTISAG |
Number of Associated Samples | 134 |
Number of Associated Scaffolds | 145 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 99.31 % |
% of genes near scaffold ends (potentially truncated) | 99.31 % |
% of genes from short scaffolds (< 2000 bps) | 93.10 % |
Associated GOLD sequencing projects | 127 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.24 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (42.759 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (17.241 % of family members) |
Environment Ontology (ENVO) | Unclassified (77.931 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (84.138 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 23.19% Coil/Unstructured: 72.46% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 145 Family Scaffolds |
---|---|---|
PF06841 | Phage_T4_gp19 | 63.45 |
PF04984 | Phage_sheath_1 | 32.41 |
PF03237 | Terminase_6N | 0.69 |
COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
---|---|---|---|
COG3497 | Phage tail sheath protein FI | Mobilome: prophages, transposons [X] | 32.41 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 57.24 % |
Unclassified | root | N/A | 42.76 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000115|DelMOSum2011_c10053648 | Not Available | 1570 | Open in IMG/M |
3300000117|DelMOWin2010_c10097943 | All Organisms → Viruses | 1084 | Open in IMG/M |
3300000149|LPaug09P1610mDRAFT_c1029719 | Not Available | 658 | Open in IMG/M |
3300000159|LPaug08P2610mDRAFT_c1007208 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
3300000190|LPjun09P161000mDRAFT_c1018418 | All Organisms → Viruses → Predicted Viral | 1242 | Open in IMG/M |
3300000247|LPaug09P26500mDRAFT_1017333 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
3300000260|LP_A_09_P20_500DRAFT_1027217 | All Organisms → Viruses | 782 | Open in IMG/M |
3300000949|BBAY94_10206458 | Not Available | 529 | Open in IMG/M |
3300001472|JGI24004J15324_10039994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1456 | Open in IMG/M |
3300001589|JGI24005J15628_10150023 | Not Available | 709 | Open in IMG/M |
3300001943|GOS2226_1022396 | All Organisms → Viruses → Predicted Viral | 1844 | Open in IMG/M |
3300003498|JGI26239J51126_1037660 | Not Available | 968 | Open in IMG/M |
3300006336|Ga0068502_1156153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1133 | Open in IMG/M |
3300006735|Ga0098038_1199317 | Not Available | 648 | Open in IMG/M |
3300006900|Ga0066376_10460972 | Not Available | 721 | Open in IMG/M |
3300006900|Ga0066376_10689263 | Not Available | 563 | Open in IMG/M |
3300006929|Ga0098036_1033508 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
3300007160|Ga0099959_1094016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1313 | Open in IMG/M |
3300007513|Ga0105019_1041639 | Not Available | 2841 | Open in IMG/M |
3300007543|Ga0102853_1010802 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1438 | Open in IMG/M |
3300007555|Ga0102817_1110422 | Not Available | 606 | Open in IMG/M |
3300007756|Ga0105664_1030342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1338 | Open in IMG/M |
3300008999|Ga0102816_1288210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 521 | Open in IMG/M |
3300009079|Ga0102814_10418829 | Not Available | 729 | Open in IMG/M |
3300009409|Ga0114993_10426353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 994 | Open in IMG/M |
3300009409|Ga0114993_10973518 | Not Available | 605 | Open in IMG/M |
3300009422|Ga0114998_10367512 | Not Available | 673 | Open in IMG/M |
3300009432|Ga0115005_10508867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 960 | Open in IMG/M |
3300009435|Ga0115546_1167418 | Not Available | 769 | Open in IMG/M |
3300009436|Ga0115008_10544662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 832 | Open in IMG/M |
3300009438|Ga0115559_1095478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1169 | Open in IMG/M |
3300009481|Ga0114932_10379726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 840 | Open in IMG/M |
3300009481|Ga0114932_10601602 | Not Available | 643 | Open in IMG/M |
3300009495|Ga0115571_1393041 | Not Available | 541 | Open in IMG/M |
3300009507|Ga0115572_10240416 | All Organisms → Viruses → Predicted Viral | 1038 | Open in IMG/M |
3300009679|Ga0115105_10492167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 880 | Open in IMG/M |
3300009786|Ga0114999_10586198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 848 | Open in IMG/M |
3300010153|Ga0098059_1199368 | Not Available | 780 | Open in IMG/M |
3300011253|Ga0151671_1000527 | Not Available | 659 | Open in IMG/M |
3300011253|Ga0151671_1000529 | Not Available | 648 | Open in IMG/M |
3300012418|Ga0138261_1446316 | Not Available | 731 | Open in IMG/M |
3300012419|Ga0138260_10000389 | Not Available | 747 | Open in IMG/M |
3300012953|Ga0163179_10732676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 842 | Open in IMG/M |
3300012953|Ga0163179_11051361 | Not Available | 713 | Open in IMG/M |
3300012954|Ga0163111_12330701 | Not Available | 543 | Open in IMG/M |
3300012969|Ga0129332_1325422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1007 | Open in IMG/M |
3300017710|Ga0181403_1038016 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1012 | Open in IMG/M |
3300017719|Ga0181390_1098514 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 785 | Open in IMG/M |
3300017724|Ga0181388_1040167 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1140 | Open in IMG/M |
3300017726|Ga0181381_1043760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 989 | Open in IMG/M |
3300017728|Ga0181419_1056871 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
3300017729|Ga0181396_1017579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1423 | Open in IMG/M |
3300017731|Ga0181416_1055377 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 936 | Open in IMG/M |
3300017734|Ga0187222_1054415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 930 | Open in IMG/M |
3300017738|Ga0181428_1136014 | Not Available | 575 | Open in IMG/M |
3300017740|Ga0181418_1108754 | Not Available | 671 | Open in IMG/M |
3300017741|Ga0181421_1151958 | Not Available | 599 | Open in IMG/M |
3300017744|Ga0181397_1006437 | All Organisms → Viruses → Predicted Viral | 3775 | Open in IMG/M |
3300017745|Ga0181427_1015655 | All Organisms → Viruses → Predicted Viral | 1899 | Open in IMG/M |
3300017755|Ga0181411_1210096 | Not Available | 544 | Open in IMG/M |
3300017759|Ga0181414_1177090 | Not Available | 555 | Open in IMG/M |
3300017764|Ga0181385_1117132 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 814 | Open in IMG/M |
3300017765|Ga0181413_1008015 | All Organisms → Viruses → Predicted Viral | 3287 | Open in IMG/M |
3300017768|Ga0187220_1264783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 513 | Open in IMG/M |
3300017775|Ga0181432_1100441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 861 | Open in IMG/M |
3300017775|Ga0181432_1133030 | Not Available | 757 | Open in IMG/M |
3300017779|Ga0181395_1256480 | Not Available | 534 | Open in IMG/M |
3300017781|Ga0181423_1291289 | Not Available | 603 | Open in IMG/M |
3300017782|Ga0181380_1196764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 677 | Open in IMG/M |
3300018420|Ga0181563_10659464 | Not Available | 579 | Open in IMG/M |
3300020282|Ga0211667_1073286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 845 | Open in IMG/M |
3300020311|Ga0211628_1012770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1517 | Open in IMG/M |
3300020363|Ga0211493_1109284 | Not Available | 716 | Open in IMG/M |
3300020363|Ga0211493_1156457 | Not Available | 596 | Open in IMG/M |
3300020365|Ga0211506_1208301 | Not Available | 545 | Open in IMG/M |
3300020367|Ga0211703_10040979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1093 | Open in IMG/M |
3300020385|Ga0211677_10135145 | All Organisms → Viruses → Predicted Viral | 1056 | Open in IMG/M |
3300020430|Ga0211622_10071733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1511 | Open in IMG/M |
3300020437|Ga0211539_10049207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1660 | Open in IMG/M |
3300020442|Ga0211559_10481286 | Not Available | 569 | Open in IMG/M |
3300020447|Ga0211691_10135767 | Not Available | 925 | Open in IMG/M |
3300020456|Ga0211551_10079870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1531 | Open in IMG/M |
3300020456|Ga0211551_10590222 | Not Available | 527 | Open in IMG/M |
3300020465|Ga0211640_10511220 | Not Available | 654 | Open in IMG/M |
3300020472|Ga0211579_10845116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 504 | Open in IMG/M |
3300020475|Ga0211541_10421430 | Not Available | 652 | Open in IMG/M |
3300021068|Ga0206684_1210899 | Not Available | 625 | Open in IMG/M |
3300021345|Ga0206688_10127305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 956 | Open in IMG/M |
3300021348|Ga0206695_1097458 | Not Available | 516 | Open in IMG/M |
3300021355|Ga0206690_10724309 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
3300021389|Ga0213868_10047779 | All Organisms → Viruses → Predicted Viral | 3000 | Open in IMG/M |
3300021442|Ga0206685_10270885 | Not Available | 575 | Open in IMG/M |
3300022074|Ga0224906_1015730 | All Organisms → Viruses → Predicted Viral | 2811 | Open in IMG/M |
3300022187|Ga0196899_1151625 | Not Available | 644 | Open in IMG/M |
3300022225|Ga0187833_10349168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 804 | Open in IMG/M |
3300023235|Ga0222634_1005650 | Not Available | 2858 | Open in IMG/M |
3300023294|Ga0222670_1010813 | All Organisms → Viruses → Predicted Viral | 1957 | Open in IMG/M |
3300024248|Ga0228676_1070623 | Not Available | 778 | Open in IMG/M |
3300024417|Ga0228650_1132844 | Not Available | 658 | Open in IMG/M |
3300025078|Ga0208668_1085582 | Not Available | 557 | Open in IMG/M |
3300025099|Ga0208669_1010093 | All Organisms → Viruses → Predicted Viral | 2664 | Open in IMG/M |
3300025138|Ga0209634_1111376 | All Organisms → Viruses → Predicted Viral | 1188 | Open in IMG/M |
3300025138|Ga0209634_1208064 | Not Available | 742 | Open in IMG/M |
3300025276|Ga0208814_1067614 | All Organisms → Viruses | 986 | Open in IMG/M |
3300025438|Ga0208770_1058838 | Not Available | 742 | Open in IMG/M |
3300025483|Ga0209557_1111383 | Not Available | 546 | Open in IMG/M |
3300025508|Ga0208148_1121210 | Not Available | 539 | Open in IMG/M |
3300025543|Ga0208303_1047119 | All Organisms → Viruses → Predicted Viral | 1063 | Open in IMG/M |
3300025590|Ga0209195_1013479 | All Organisms → Viruses → Predicted Viral | 2862 | Open in IMG/M |
3300025592|Ga0209658_1066442 | All Organisms → Viruses | 912 | Open in IMG/M |
3300025632|Ga0209194_1006304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 5172 | Open in IMG/M |
3300025680|Ga0209306_1053804 | All Organisms → Viruses | 1287 | Open in IMG/M |
3300025849|Ga0209603_1330563 | Not Available | 521 | Open in IMG/M |
3300027159|Ga0208020_1033146 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 995 | Open in IMG/M |
3300027196|Ga0208438_1082844 | Not Available | 520 | Open in IMG/M |
3300027668|Ga0209482_1101028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 924 | Open in IMG/M |
3300027685|Ga0209554_1096327 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 975 | Open in IMG/M |
3300027686|Ga0209071_1012160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 2811 | Open in IMG/M |
3300027752|Ga0209192_10099460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1205 | Open in IMG/M |
3300027813|Ga0209090_10230140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 945 | Open in IMG/M |
3300027830|Ga0209359_10164413 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 979 | Open in IMG/M |
3300027847|Ga0209402_10158972 | All Organisms → Viruses → Predicted Viral | 1506 | Open in IMG/M |
3300027849|Ga0209712_10333698 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 858 | Open in IMG/M |
3300028190|Ga0257108_1097549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 870 | Open in IMG/M |
3300028194|Ga0257106_1169114 | Not Available | 761 | Open in IMG/M |
3300028233|Ga0256417_1054511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1083 | Open in IMG/M |
3300029448|Ga0183755_1070074 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 789 | Open in IMG/M |
3300029637|Ga0257131_103207 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 848 | Open in IMG/M |
3300031142|Ga0308022_1023673 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1978 | Open in IMG/M |
3300031143|Ga0308025_1210417 | Not Available | 660 | Open in IMG/M |
3300031510|Ga0308010_1215423 | Not Available | 688 | Open in IMG/M |
3300031571|Ga0308141_1019186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1225 | Open in IMG/M |
3300031598|Ga0308019_10129741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 1011 | Open in IMG/M |
3300031599|Ga0308007_10082308 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
3300031599|Ga0308007_10180641 | Not Available | 741 | Open in IMG/M |
3300031599|Ga0308007_10219706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 654 | Open in IMG/M |
3300031608|Ga0307999_1078230 | Not Available | 770 | Open in IMG/M |
3300031644|Ga0308001_10178231 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 855 | Open in IMG/M |
3300031647|Ga0308012_10354880 | Not Available | 574 | Open in IMG/M |
3300031658|Ga0307984_1101325 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 836 | Open in IMG/M |
3300031688|Ga0308011_10090842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 941 | Open in IMG/M |
3300031696|Ga0307995_1244513 | Not Available | 617 | Open in IMG/M |
3300032011|Ga0315316_10255650 | All Organisms → Viruses → Predicted Viral | 1466 | Open in IMG/M |
3300032130|Ga0315333_10550970 | Not Available | 539 | Open in IMG/M |
3300032360|Ga0315334_10592613 | All Organisms → Viruses | 955 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 17.24% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 16.55% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 13.79% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 8.97% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 5.52% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 4.14% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 3.45% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 3.45% |
Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.76% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.76% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.76% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.76% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.07% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.07% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.38% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.38% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.38% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.38% |
Polar Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine | 1.38% |
Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.69% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.69% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 0.69% |
Background Seawater | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater | 0.69% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.69% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 0.69% |
Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000149 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 10m | Environmental | Open in IMG/M |
3300000159 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 10m | Environmental | Open in IMG/M |
3300000190 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 1000m | Environmental | Open in IMG/M |
3300000247 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P26 500m | Environmental | Open in IMG/M |
3300000260 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_A_09_P20_500 | Environmental | Open in IMG/M |
3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
3300001943 | Marine microbial communities from Cape May, New Jersey, USA - GS010 | Environmental | Open in IMG/M |
3300003498 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_130m_DNA | Environmental | Open in IMG/M |
3300006336 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_2_0500m | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006900 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300007160 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_1000m | Environmental | Open in IMG/M |
3300007513 | Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate b | Environmental | Open in IMG/M |
3300007543 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-3 | Environmental | Open in IMG/M |
3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
3300007756 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assembly | Environmental | Open in IMG/M |
3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
3300009422 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 | Environmental | Open in IMG/M |
3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
3300009436 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome | Environmental | Open in IMG/M |
3300009438 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110506 | Environmental | Open in IMG/M |
3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
3300009495 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 | Environmental | Open in IMG/M |
3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
3300012418 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012419 | Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300012969 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017724 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17 | Environmental | Open in IMG/M |
3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
3300017734 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2) | Environmental | Open in IMG/M |
3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
3300020311 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX556071-ERR599171) | Environmental | Open in IMG/M |
3300020363 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX555958-ERR599173) | Environmental | Open in IMG/M |
3300020365 | Marine microbial communities from Tara Oceans - TARA_B100000034 (ERX555943-ERR599143) | Environmental | Open in IMG/M |
3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
3300020385 | Marine microbial communities from Tara Oceans - TARA_B100001059 (ERX556045-ERR598965) | Environmental | Open in IMG/M |
3300020430 | Marine microbial communities from Tara Oceans - TARA_B100000683 (ERX556126-ERR599160) | Environmental | Open in IMG/M |
3300020437 | Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074) | Environmental | Open in IMG/M |
3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
3300020456 | Marine microbial communities from Tara Oceans - TARA_B100001741 (ERX555984-ERR599123) | Environmental | Open in IMG/M |
3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
3300020472 | Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995) | Environmental | Open in IMG/M |
3300020475 | Marine microbial communities from Tara Oceans - TARA_B100002029 (ERX555951-ERR599001) | Environmental | Open in IMG/M |
3300021068 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015 | Environmental | Open in IMG/M |
3300021345 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021348 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021355 | Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022225 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014_SV_400_PacBio MetaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300023235 | Saline water microbial communities from Ace Lake, Antarctica - #50 | Environmental | Open in IMG/M |
3300023294 | Saline water microbial communities from Ace Lake, Antarctica - #732 | Environmental | Open in IMG/M |
3300024248 | Seawater microbial communities from Monterey Bay, California, United States - 48D_r | Environmental | Open in IMG/M |
3300024417 | Seawater microbial communities from Monterey Bay, California, United States - 62D | Environmental | Open in IMG/M |
3300025078 | Marine viral communities from the Subarctic Pacific Ocean - 18_ETSP_OMZAT15316 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
3300025438 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 (SPAdes) | Environmental | Open in IMG/M |
3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025590 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 (SPAdes) | Environmental | Open in IMG/M |
3300025592 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_150m_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
3300025680 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328 (SPAdes) | Environmental | Open in IMG/M |
3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
3300027159 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes) | Environmental | Open in IMG/M |
3300027196 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 (SPAdes) | Environmental | Open in IMG/M |
3300027668 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG104-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027685 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Bottom_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
3300027686 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) | Environmental | Open in IMG/M |
3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
3300027813 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes) | Environmental | Open in IMG/M |
3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
3300027847 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 (SPAdes) | Environmental | Open in IMG/M |
3300027849 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes) | Environmental | Open in IMG/M |
3300028190 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_1000m | Environmental | Open in IMG/M |
3300028194 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_10m | Environmental | Open in IMG/M |
3300028233 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
3300029637 | Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_2000m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031142 | Marine microbial communities from water near the shore, Antarctic Ocean - #353 | Environmental | Open in IMG/M |
3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
3300031510 | Marine microbial communities from water near the shore, Antarctic Ocean - #129 | Environmental | Open in IMG/M |
3300031571 | Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_535_32.3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031598 | Marine microbial communities from water near the shore, Antarctic Ocean - #284 | Environmental | Open in IMG/M |
3300031599 | Marine microbial communities from water near the shore, Antarctic Ocean - #71 | Environmental | Open in IMG/M |
3300031608 | Marine microbial communities from water near the shore, Antarctic Ocean - #1 | Environmental | Open in IMG/M |
3300031644 | Marine microbial communities from water near the shore, Antarctic Ocean - #5 | Environmental | Open in IMG/M |
3300031647 | Marine microbial communities from water near the shore, Antarctic Ocean - #179 | Environmental | Open in IMG/M |
3300031658 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78 | Environmental | Open in IMG/M |
3300031688 | Marine microbial communities from water near the shore, Antarctic Ocean - #177 | Environmental | Open in IMG/M |
3300031696 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #262 | Environmental | Open in IMG/M |
3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
3300032130 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 34915 | Environmental | Open in IMG/M |
3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2011_100536484 | 3300000115 | Marine | MVKLLGFEITRKDNDLEKPAEAKQAFTIPSPDDGTTTISAG |
DelMOWin2010_100979433 | 3300000117 | Marine | MVQLLGFQITRQNDDKEKPAEAKQAFTVASPEDGTTTISAGG |
LPaug09P1610mDRAFT_10297192 | 3300000149 | Marine | MVQLLGFQITRQNDDKEKPAEAKQAFTVPSPDDGTTTISAGGY |
LPaug08P2610mDRAFT_10072083 | 3300000159 | Marine | MAKILGFQITRDSNLEKSATSKQAFTVATPDDGTTTISA |
LPjun09P161000mDRAFT_10184181 | 3300000190 | Marine | MANLLGFQITRNNDLGKAAEAKQAFTVATPDDGTTTISAGGYF |
LPaug09P26500mDRAFT_10173332 | 3300000247 | Marine | MANLLGFQITRNNDLGKAAEAKQAFTVATPDDGTTTISAGGYFRPILGYGS* |
LP_A_09_P20_500DRAFT_10272171 | 3300000260 | Marine | MANLLGFQITRNNDLGKPAESKQAFTVATPDDGTTTI |
BBAY94_102064582 | 3300000949 | Macroalgal Surface | MVQLLGFQITRANDDREKPAEAKQAFTVATPDDGTTTISAGGY |
JGI24004J15324_100399941 | 3300001472 | Marine | MVKLLGFEITRKDNDLEKPAEAKQAFTIPSPDDGTTTIS |
JGI24005J15628_101500232 | 3300001589 | Marine | MVQLLGFQITRQTDDKEKPAEAKQAFTVPSPDDGTTTISAGGY |
GOS2226_10223961 | 3300001943 | Marine | MANLLGFQITRNNNDLGKPAEAKQAFTVSSPDDGTTTIAAGGHFGQY |
JGI26239J51126_10376603 | 3300003498 | Marine | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTTTISAGGYFGQ |
Ga0068502_11561533 | 3300006336 | Marine | MVQLLGFQITRPKKETDSKSTQAFTVPSSDDGTTTIS |
Ga0098038_11993171 | 3300006735 | Marine | MVQLLGFQITRQTDDKEKPAEAKQAFTVPSPDDGTTT |
Ga0066376_104609721 | 3300006900 | Marine | MANLLGFQITRNKDLGKTAEAKQAFTVASPDDGTTTISAGGY |
Ga0066376_106892631 | 3300006900 | Marine | MANLLGFQITRNKDLGKTAESKQAFTVASPDDGTTTIS |
Ga0098036_10335083 | 3300006929 | Marine | MANLLGFQITRNNQDSGKPAEAKQAFTVASPDDGTTTISAG |
Ga0099959_10940163 | 3300007160 | Marine | MVQLLGFQITRPKKETDSKSTQAFTVPSSDDGTTTISAGGY |
Ga0105019_10416391 | 3300007513 | Marine | MANLLGFQITRNKDSEKPVDAKQAFTVASPDDGTTT |
Ga0102853_10108023 | 3300007543 | Estuarine | MVKLLGFEITRKDNDLEKPAEAKQAFTIPSPDDGTTTISAGGYF |
Ga0102817_11104222 | 3300007555 | Estuarine | MVQLLGFQITRQSDDREKPAEAKQAFTVPSPDDGTTT |
Ga0105664_10303423 | 3300007756 | Background Seawater | MANLLGFQITRNTDLGKAPEAKQAFTVASPDDGTTTISAGGYF |
Ga0102816_12882101 | 3300008999 | Estuarine | MANLLGFQITRNNNDLGKSAEEKQAFTVATPDDGTTTIAA |
Ga0102814_104188292 | 3300009079 | Estuarine | MVKLLGFEITRKDNDLEKPAEAKQAFTIPSPDDGTTTISAGG |
Ga0114993_104263531 | 3300009409 | Marine | MANLLGFQITRNNNDLGKSAEAKQAFTVATPDDGTTTI |
Ga0114993_109735182 | 3300009409 | Marine | MAQLLGFQITRLNDERNKPAEAKQAFTVPSPDDGTTTI |
Ga0114998_103675121 | 3300009422 | Marine | MANLLGFQITRNNQDLGKPAEAKQAFTVATPDDGTTTI |
Ga0115005_105088673 | 3300009432 | Marine | MVKLLGFEITRKDNDLEKPAQAKQAFTIPSPDDGTTT |
Ga0115546_11674181 | 3300009435 | Pelagic Marine | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTTTISAGG |
Ga0115008_105446623 | 3300009436 | Marine | MVQLLGFQITRQSDDKEKPAEAKQAFTVPSPDDGTTTISAG |
Ga0115559_10954781 | 3300009438 | Pelagic Marine | MVKLLGFEITRKDNDLEKPASAKQAFTIPSPDDGTTTISAGGYF |
Ga0114932_103797264 | 3300009481 | Deep Subsurface | MVELLGFQITRNNEKEKPAEAKQAFTVPSPDDGTTTISAGGYF |
Ga0114932_106016021 | 3300009481 | Deep Subsurface | MVQLLGFQITRQTDDKEKPAEAKQAFTVPSPDDGTTTISA |
Ga0115571_13930411 | 3300009495 | Pelagic Marine | MVDLLGFQITRNNDKEKPAEAKQAFTVSSPDDGTTTISAGGY |
Ga0115572_102404163 | 3300009507 | Pelagic Marine | MVKLLGFEITRKDDDLEKPASAKQAFTIPSPDDGTTTISAGGYF |
Ga0115105_104921671 | 3300009679 | Marine | MAKILGFQITRDSNQDKPATSKQAFTVATPDDGTTTISA |
Ga0114999_105861981 | 3300009786 | Marine | MVQLLGFQITRQTDDRDKPAEAKQAFTVPSPDDGTTTISAGGY |
Ga0098059_11993681 | 3300010153 | Marine | MANLLGFQITRNNDLGKAAEAKQAFTVATPDDGTTTI |
Ga0151671_10005271 | 3300011253 | Marine | MVKLLGFEITRKDNDLEKPANAKQAFTIPSPDDGTTTI |
Ga0151671_10005291 | 3300011253 | Marine | MVKLLGFEITRKDDDLEKPAKAKQAFTIPSPDDGTTTISAG |
Ga0138261_14463161 | 3300012418 | Polar Marine | MANLLGFQITRNNTDLGKPAEAKQAFTVSSPDDGTTTIAAGGHFGQYM |
Ga0138260_100003892 | 3300012419 | Polar Marine | MANLLGFQITRNNNDLGKPAEAKQAFTVSSPDDGTTTISAGGHFG |
Ga0163179_107326763 | 3300012953 | Seawater | MVQLLGFQITRANDDREKPAEAKQAFTVATPDDGTTTISAGG |
Ga0163179_110513612 | 3300012953 | Seawater | MVKILGFEITRKDDDLEKPAKAKQAFTIPSPDDGTTTISAGGYF |
Ga0163111_123307011 | 3300012954 | Surface Seawater | MANLLGFQITRNNQDSGKPVDAKQAFTVASPDDGTTT |
Ga0129332_13254223 | 3300012969 | Aqueous | MVQLLGFQITRQTDDKDKPAEAKQAFTVPSPDDGTTTISA |
Ga0181403_10380161 | 3300017710 | Seawater | MVQLLGFQITRQNDDKEKPAEAKQAFTVASPEDGTTTISA |
Ga0181390_10985141 | 3300017719 | Seawater | MAKILGFQITRDSNQDKPATSKQAFTVATPDDGTTTISAGGY |
Ga0181388_10401671 | 3300017724 | Seawater | MVKLLGFEITRKDNDLEKPASAKQAFTIPSPDDGTTTISAGGY |
Ga0181381_10437601 | 3300017726 | Seawater | MVKLLGFEITRKDDDLEKPANAKQAFTIPSPDDGTTTIS |
Ga0181419_10568713 | 3300017728 | Seawater | MIKLLVFEITRKDDDLEKPAKAKQAFTIPSPDDGTTTISAGGYFGQ |
Ga0181396_10175791 | 3300017729 | Seawater | MAQLLGFQITRLNDDKDKPAEAKQAFTVPSPDDGTTTISAGG |
Ga0181416_10553773 | 3300017731 | Seawater | MAKILGFQITRDSNQDKPATSKQAFTVATPDDGTT |
Ga0187222_10544153 | 3300017734 | Seawater | MVKLLGFEITRKDDDLEKPAKAKQAFTIPSPDDGTTTISA |
Ga0181428_11360142 | 3300017738 | Seawater | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTTTISAG |
Ga0181418_11087542 | 3300017740 | Seawater | MVQLLGFQITRANDDREKPAEAKQAFTVATPDDGTTTIS |
Ga0181421_11519581 | 3300017741 | Seawater | MVQLLGFQITRQTDEKEKPAEAKQAFTVPSPDDGTTTISAGGY |
Ga0181397_10064371 | 3300017744 | Seawater | MAKILGFQITRDSNQDKPATSKQAFTVATPDDGTTTISAG |
Ga0181427_10156551 | 3300017745 | Seawater | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTTTISAGGYFG |
Ga0181411_12100961 | 3300017755 | Seawater | MVKLLGFEITRKDDDLEKPAKSKQAFTIPSPDDGTTTI |
Ga0181414_11770902 | 3300017759 | Seawater | MVQLLGFQITRQTDEREKPAEAKQAFTVPSPDDGTT |
Ga0181385_11171323 | 3300017764 | Seawater | MVKLLGFEITRKDDDLEKPAKAKQAFTIPSPDDGT |
Ga0181413_10080151 | 3300017765 | Seawater | MVKILGFQITRDSNQDKPATSKQAFTVATPDDGTTTISAGGYF |
Ga0187220_12647832 | 3300017768 | Seawater | MVKLLGFEITRKDNDLEKPAKAKQAFTIPSPDDGTTTI |
Ga0181432_11004411 | 3300017775 | Seawater | MANLLGFQITRNTDLGKTAEAKQAFTVASPDDGTTTISAGG |
Ga0181432_11330301 | 3300017775 | Seawater | MANLLGFQITRNKDLGKAPEAKQAFTVASPDDGTTTISAGGY |
Ga0181395_12564801 | 3300017779 | Seawater | MVKLLGFEITRKDNDLEKPANAKQAFTIPSPDDGTTTISAGG |
Ga0181423_12912892 | 3300017781 | Seawater | MVQLLGFQITRQTDDKEKPAEAKQAFTVPSPDDGTTTISAGG |
Ga0181380_11967642 | 3300017782 | Seawater | MVKLLGFEITRKDNDLEKPATVKQAFTIPSPDDGT |
Ga0181563_106594641 | 3300018420 | Salt Marsh | MVQLLGFEITRKNDTLEKPAEAKQAFTIPSPDDGV |
Ga0211667_10732861 | 3300020282 | Marine | MVQLLGFQITRANDDREKPAEAKQAFTVPTPDDGT |
Ga0211628_10127703 | 3300020311 | Marine | MVQLLGFQITRQTDDKEKPAEAKQAFTVPSPDDGTT |
Ga0211493_11092842 | 3300020363 | Marine | MVKLLGFEITRKDNDLEKPANAKQAFTIPSPDDGTTTISAG |
Ga0211493_11564571 | 3300020363 | Marine | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTTTIAAG |
Ga0211506_12083011 | 3300020365 | Marine | MVQLLGFQITRQTDDREKPAEAKQAFTVPSPDDGTTTISA |
Ga0211703_100409793 | 3300020367 | Marine | MANLLGFQITRNTDLGKPVDAKQAFTVASPDDGTTTISAGGY |
Ga0211677_101351451 | 3300020385 | Marine | MVQLLGFQITRQTDDKEKPAEAKQAFTVPSPDDGTTTISAG |
Ga0211622_100717331 | 3300020430 | Marine | MVELLGFQITRAKEDGELKKDGASKQAFTIPTPDDGTTTI |
Ga0211539_100492073 | 3300020437 | Marine | MVQLLGFQITRANDDREKPAEAKQAFTVPSPDDGTT |
Ga0211559_104812862 | 3300020442 | Marine | MVQLLGFEITRKNDTLEKPAEAKQAFTIPSPDDGVTTISAGGYFG |
Ga0211691_101357671 | 3300020447 | Marine | MVKLLGFEITRKDNDLEKPAEAKQAFTIPSPDDGTTTI |
Ga0211551_100798701 | 3300020456 | Marine | MVKLLGFQITRAEDDLEKPANAKQAFTIPSPDDGTTTISA |
Ga0211551_105902221 | 3300020456 | Marine | MVQLLGFQITRANDDKEKPAEAKQAFTVASPDDGT |
Ga0211640_105112201 | 3300020465 | Marine | MVQLLGFQITRANDDREKPAEAKQAFTVATPDDGTTTISAGGYFGQ |
Ga0211579_108451161 | 3300020472 | Marine | MVKLLGFEITRKDDDLEKPAKAKQAFTIPSPDDGTTTISAGG |
Ga0211541_104214302 | 3300020475 | Marine | MVQLLGFQITRQNDDKEKPAEAKQAFTVPSPDDGTTTISA |
Ga0206684_12108991 | 3300021068 | Seawater | MANLLGFQITRNNDLGKAAEAKQAFTVATPDDGTTTISA |
Ga0206688_101273051 | 3300021345 | Seawater | MANLLGFQITRNNQDLGKSPEAKQAFTVASPDDGTTTISA |
Ga0206695_10974581 | 3300021348 | Seawater | MANLLGFQITRNKDDREKPAEAKQAFTVASPDDGTTTIS |
Ga0206690_107243091 | 3300021355 | Seawater | MANLLGFQITRNNDLGKAAEAKQAFTVATPDDGTTTISAGGY |
Ga0213868_100477791 | 3300021389 | Seawater | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTT |
Ga0206685_102708852 | 3300021442 | Seawater | MANLLGFQITRNNDLGKAAEAKQAFTVATPDDGTT |
Ga0224906_10157303 | 3300022074 | Seawater | MVKLLGFEITRKDNDLEKPANAKQAFTIPSPDDGTTTIS |
Ga0196899_11516251 | 3300022187 | Aqueous | MVKLLGFEITRKDDDLEKPASAKQAFTIPSPDDGT |
Ga0187833_103491681 | 3300022225 | Seawater | MVQLLGFQITRPKKETDSKSTQAFTVPSPDDGTTTIS |
Ga0222634_10056504 | 3300023235 | Saline Water | MVQLLGFQITRQTDDRDKPAEAKQAFTVPSPDDGTTTISA |
Ga0222670_10108131 | 3300023294 | Saline Water | MVKLLGFEITRKDNDLEKPAEAKQAFTIPSPDDGTTTISAGGYFG |
Ga0228676_10706231 | 3300024248 | Seawater | MVKLLGFEITRKDDDLEKPAKAKQAFTIPSPDDGTTTIYAGG |
Ga0228650_11328442 | 3300024417 | Seawater | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTTTISAGGYF |
Ga0208668_10855821 | 3300025078 | Marine | MANLLGFQITRNKDTLGKPAESKQAFTVASPDDGT |
Ga0208669_10100933 | 3300025099 | Marine | MVKLLGFEITRKDDDLEKPAKAKQAFTIPSPDDGTT |
Ga0209634_11113761 | 3300025138 | Marine | MANLLGFQITRNNTDLGKPAEAKQAFTVSSPDDGTTTIA |
Ga0209634_12080642 | 3300025138 | Marine | MVELLGFQITRNNNLGKPAEAKQAFTVASPDDGTTTISAGGHFGQYM |
Ga0208814_10676141 | 3300025276 | Deep Ocean | MANLLGFQITRNNTDLGKPAEAKQAFTVSSPDDGT |
Ga0208770_10588382 | 3300025438 | Saline Lake | MVQLLGFQITRQTDDRDKPAEAKQAFTVPSPDDGTTTISAGG |
Ga0209557_11113832 | 3300025483 | Marine | MVQLLGFQITRQTDDTEKPAEAKQAFTVPSPDDGTTTISAG |
Ga0208148_11212101 | 3300025508 | Aqueous | MVKLLGFEITRKDDDLEKPAKAKQAFTIPSPDDGTTTISAGGYF |
Ga0208303_10471191 | 3300025543 | Aqueous | MVKLLGFEITRKDDDLEKPAKAKQAFTIPSPDDGTTT |
Ga0209195_10134791 | 3300025590 | Pelagic Marine | MVKLLGFEITRKDDDLEKPAKAKQAFTIPSPDDGTTTI |
Ga0209658_10664423 | 3300025592 | Marine | MVKLLGFEITRKDNDLEKPASAKQAFTIPSPDDGTTTISAGGYFG |
Ga0209194_10063046 | 3300025632 | Pelagic Marine | MVKLLGFEITRKDDDLEKPAKAKQAFTIPSPDDGTTTISAGGY |
Ga0209306_10538041 | 3300025680 | Pelagic Marine | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTTTIS |
Ga0209603_13305632 | 3300025849 | Pelagic Marine | MVQLLGFQITRQTDEKEKPAEAKQAFTVPSPDDGTTTISAGGYF |
Ga0208020_10331461 | 3300027159 | Estuarine | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTTTI |
Ga0208438_10828441 | 3300027196 | Estuarine | MVKLLGFEITRKDNDLEKPAEAKQAFTIPSPDDGT |
Ga0209482_11010281 | 3300027668 | Marine | MANLLGFQITRNNSDLGKPAEAKQAFTVSSPDDGTTTISAGGHFGQYM |
Ga0209554_10963273 | 3300027685 | Marine | MANLLGFQITRNNTDLGKPAEAKQAFTVSSPDDGTTT |
Ga0209071_10121601 | 3300027686 | Marine | MVKLLGFEITRKDNDLEKPASAKQAFTIPSPDDGT |
Ga0209192_100994601 | 3300027752 | Marine | MANLLGFQITRNNTDLGKPAEAKQAFTVASPDDGT |
Ga0209090_102301403 | 3300027813 | Marine | MVKLLGFEITRKDNDLEKPAEAKQAFTIPSPDDGTTT |
Ga0209359_101644131 | 3300027830 | Marine | MVQLLGFEITRKDNNLEKPAEAKQAFTIPSPDDGVTTISAGGYFG |
Ga0209402_101589723 | 3300027847 | Marine | MANLLGFQITRNNNDLGKSAEAKQAFTVATPDDGTTTIAAG |
Ga0209712_103336981 | 3300027849 | Marine | MANLLGFQITRNNNDLGKSAEAKQAFTVATPDDGTTTIAAGGHFGQYMDM |
Ga0257108_10975491 | 3300028190 | Marine | MANLLGFQITRNNDLGKAAEAKQAFTVATPDDGTTTISAGG |
Ga0257106_11691142 | 3300028194 | Marine | MVKLLGFEITRKDNDLEKPAEAKQAFTIPSPDDGTTTISAGGYFGQYL |
Ga0256417_10545113 | 3300028233 | Seawater | MANLLGFQITRNNNDLGKPAEAKQAFTVSSPDDGTTTIAAGG |
Ga0183755_10700741 | 3300029448 | Marine | MVQLLGFQITRANDDREKPAEAKQAFTVATPDDGTTTI |
Ga0257131_1032073 | 3300029637 | Marine | MVKLLGFEITRKDNDLEKPAEAKQAFTIPSPDDGTTTISA |
Ga0308022_10236731 | 3300031142 | Marine | MVKLLGFEITRKDNDLEKPASAKQAFTIPSPDDGTTTIS |
Ga0308025_12104171 | 3300031143 | Marine | MANLLGFQITRNNTDLGKPAEAKQAFTVSSPDDGTTTIS |
Ga0308010_12154231 | 3300031510 | Marine | MVELLGFQITRNKDLEKSAEAKQAFTVASPDDGTTT |
Ga0308141_10191861 | 3300031571 | Marine | MVQLLGFQITRKDNDLEKPAKAKQAFTIPSPDDGTTTISA |
Ga0308019_101297411 | 3300031598 | Marine | MANLLGFQITRNNSDLGKPAEAKQAFTVSSPDDGTTTISAGGH |
Ga0308007_100823081 | 3300031599 | Marine | MANLLGFQITRNNTDLGKPAEAKQAFTVSSPDDGTTTISAGGHFGQYMDME |
Ga0308007_101806412 | 3300031599 | Marine | MANLLGFQITRNNTDLGKPADAKQAFTVSSPDDGTTIS |
Ga0308007_102197061 | 3300031599 | Marine | MVKLLGFEITRKDNDLEKPANAKQAFTIPSPDDGT |
Ga0307999_10782301 | 3300031608 | Marine | MANLLGFQITRNNTDLGKPAEAKQAFTVSSPDDGTTTISAGGHFGQ |
Ga0308001_101782311 | 3300031644 | Marine | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGTSTISAGGYFGQ |
Ga0308012_103548802 | 3300031647 | Marine | MANLLGFQITRNNTDLGKPADAKQAFTVSSPDDGTTTIAAGGHFGQY |
Ga0307984_11013251 | 3300031658 | Marine | MVKLLGFEITRKDNDLEKPASAKQAFTIPSPDDGTTTISAG |
Ga0308011_100908423 | 3300031688 | Marine | MVKLLGFEITRKDNDLEKPATAKQAFTIPSPDDGTTTI |
Ga0307995_12445131 | 3300031696 | Marine | MANLLGFQITRNNTDLGKPAEAKQAFTVSSPDDGTTTI |
Ga0315316_102556503 | 3300032011 | Seawater | MANLLGFQITRNNNDLGKPAEAKQAFTVASPDDGT |
Ga0315333_105509701 | 3300032130 | Seawater | MANLLGFQITRNTDLGKSAETKQAFTVASPDDGTTTISAGGYF |
Ga0315334_105926131 | 3300032360 | Seawater | MANLLGFQITRNNDLGKAAEAKQAFTVATPDDGTSTISAGGYFG |
⦗Top⦘ |