| Basic Information | |
|---|---|
| Family ID | F050410 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 40 residues |
| Representative Sequence | LDNGRMKRELRVRLRYPDPAALLAEIAPRDLKKQLALPL |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.93 % |
| % of genes from short scaffolds (< 2000 bps) | 90.34 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.897 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.586 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.207 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (47.586 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.90% β-sheet: 0.00% Coil/Unstructured: 79.10% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF01040 | UbiA | 87.59 |
| PF03167 | UDG | 4.14 |
| PF01977 | UbiD | 1.38 |
| PF00106 | adh_short | 0.69 |
| PF07884 | VKOR | 0.69 |
| PF00202 | Aminotran_3 | 0.69 |
| PF01568 | Molydop_binding | 0.69 |
| PF07690 | MFS_1 | 0.69 |
| PF04039 | MnhB | 0.69 |
| PF08327 | AHSA1 | 0.69 |
| PF01738 | DLH | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 4.14 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 4.14 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 4.14 |
| COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 1.38 |
| COG2111 | Multisubunit Na+/H+ antiporter, MnhB subunit | Inorganic ion transport and metabolism [P] | 0.69 |
| COG4243 | Vitamin K epoxide reductase (VKOR) family protein, predicted involvement in disulfide bond formation | General function prediction only [R] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.90 % |
| All Organisms | root | All Organisms | 33.10 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908043|A2_c1_ConsensusfromContig13101 | Not Available | 741 | Open in IMG/M |
| 3300000890|JGI11643J12802_11721136 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 641 | Open in IMG/M |
| 3300005179|Ga0066684_10422114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 896 | Open in IMG/M |
| 3300005181|Ga0066678_10965485 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 554 | Open in IMG/M |
| 3300005328|Ga0070676_10298004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1092 | Open in IMG/M |
| 3300005330|Ga0070690_100959809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 672 | Open in IMG/M |
| 3300005338|Ga0068868_100126846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2085 | Open in IMG/M |
| 3300005340|Ga0070689_101307577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 653 | Open in IMG/M |
| 3300005355|Ga0070671_101279369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 647 | Open in IMG/M |
| 3300005356|Ga0070674_101327905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 642 | Open in IMG/M |
| 3300005366|Ga0070659_100014910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5813 | Open in IMG/M |
| 3300005518|Ga0070699_100289918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1467 | Open in IMG/M |
| 3300005535|Ga0070684_100698080 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 946 | Open in IMG/M |
| 3300005539|Ga0068853_102128807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 544 | Open in IMG/M |
| 3300005561|Ga0066699_10050693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2547 | Open in IMG/M |
| 3300005576|Ga0066708_10965857 | Not Available | 530 | Open in IMG/M |
| 3300005578|Ga0068854_101361062 | Not Available | 641 | Open in IMG/M |
| 3300005618|Ga0068864_101298805 | Not Available | 728 | Open in IMG/M |
| 3300005718|Ga0068866_11268993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 534 | Open in IMG/M |
| 3300005840|Ga0068870_10989716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 599 | Open in IMG/M |
| 3300006032|Ga0066696_10322107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1006 | Open in IMG/M |
| 3300006358|Ga0068871_100249769 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus | 1545 | Open in IMG/M |
| 3300006606|Ga0074062_11857521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia | 718 | Open in IMG/M |
| 3300006755|Ga0079222_10331569 | Not Available | 1015 | Open in IMG/M |
| 3300006791|Ga0066653_10646792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 541 | Open in IMG/M |
| 3300006800|Ga0066660_10060678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2519 | Open in IMG/M |
| 3300006881|Ga0068865_100287043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1312 | Open in IMG/M |
| 3300007076|Ga0075435_100455718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1103 | Open in IMG/M |
| 3300009091|Ga0102851_11278660 | Not Available | 810 | Open in IMG/M |
| 3300009093|Ga0105240_10456446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1429 | Open in IMG/M |
| 3300009093|Ga0105240_10976662 | Not Available | 907 | Open in IMG/M |
| 3300009094|Ga0111539_12110394 | Not Available | 654 | Open in IMG/M |
| 3300009098|Ga0105245_10714008 | Not Available | 1036 | Open in IMG/M |
| 3300009137|Ga0066709_103227050 | Not Available | 594 | Open in IMG/M |
| 3300009174|Ga0105241_10799817 | Not Available | 869 | Open in IMG/M |
| 3300009174|Ga0105241_11690273 | Not Available | 615 | Open in IMG/M |
| 3300009179|Ga0115028_10654922 | Not Available | 794 | Open in IMG/M |
| 3300009545|Ga0105237_11997234 | Not Available | 588 | Open in IMG/M |
| 3300009553|Ga0105249_10550402 | Not Available | 1204 | Open in IMG/M |
| 3300010046|Ga0126384_11360442 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
| 3300010359|Ga0126376_10468552 | Not Available | 1156 | Open in IMG/M |
| 3300010397|Ga0134124_12761245 | Not Available | 535 | Open in IMG/M |
| 3300011119|Ga0105246_12582753 | Not Available | 501 | Open in IMG/M |
| 3300012203|Ga0137399_10937543 | Not Available | 729 | Open in IMG/M |
| 3300012209|Ga0137379_10497800 | Not Available | 1126 | Open in IMG/M |
| 3300012532|Ga0137373_10306586 | Not Available | 1260 | Open in IMG/M |
| 3300012923|Ga0137359_10219958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1696 | Open in IMG/M |
| 3300012984|Ga0164309_10941986 | Not Available | 707 | Open in IMG/M |
| 3300012989|Ga0164305_12063737 | Not Available | 522 | Open in IMG/M |
| 3300013104|Ga0157370_10010102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9969 | Open in IMG/M |
| 3300013105|Ga0157369_10454903 | Not Available | 1326 | Open in IMG/M |
| 3300013297|Ga0157378_11329207 | Not Available | 760 | Open in IMG/M |
| 3300013297|Ga0157378_12302595 | Not Available | 590 | Open in IMG/M |
| 3300013306|Ga0163162_12728477 | Not Available | 569 | Open in IMG/M |
| 3300013306|Ga0163162_13224527 | Not Available | 523 | Open in IMG/M |
| 3300013307|Ga0157372_11006663 | Not Available | 965 | Open in IMG/M |
| 3300013308|Ga0157375_10243088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1960 | Open in IMG/M |
| 3300014969|Ga0157376_11648603 | Not Available | 676 | Open in IMG/M |
| 3300018032|Ga0187788_10518515 | Not Available | 517 | Open in IMG/M |
| 3300018083|Ga0184628_10441312 | Not Available | 678 | Open in IMG/M |
| 3300018084|Ga0184629_10302311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 842 | Open in IMG/M |
| 3300018433|Ga0066667_11322257 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 630 | Open in IMG/M |
| 3300018433|Ga0066667_11668377 | Not Available | 571 | Open in IMG/M |
| 3300018469|Ga0190270_12721131 | Not Available | 557 | Open in IMG/M |
| 3300018476|Ga0190274_10943038 | Not Available | 933 | Open in IMG/M |
| 3300018481|Ga0190271_13538393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 523 | Open in IMG/M |
| 3300018482|Ga0066669_11203766 | Not Available | 684 | Open in IMG/M |
| 3300018482|Ga0066669_12249828 | Not Available | 518 | Open in IMG/M |
| 3300019888|Ga0193751_1088771 | Not Available | 1216 | Open in IMG/M |
| 3300019890|Ga0193728_1203989 | Not Available | 828 | Open in IMG/M |
| 3300020062|Ga0193724_1091991 | Not Available | 622 | Open in IMG/M |
| 3300021384|Ga0213876_10042970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2389 | Open in IMG/M |
| 3300022309|Ga0224510_10007430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5640 | Open in IMG/M |
| 3300022756|Ga0222622_10567611 | Not Available | 817 | Open in IMG/M |
| 3300025443|Ga0208081_1045887 | Not Available | 727 | Open in IMG/M |
| 3300025461|Ga0208851_1027725 | Not Available | 1060 | Open in IMG/M |
| 3300025893|Ga0207682_10286026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300025906|Ga0207699_11301798 | Not Available | 538 | Open in IMG/M |
| 3300025907|Ga0207645_10253696 | Not Available | 1164 | Open in IMG/M |
| 3300025907|Ga0207645_10507910 | Not Available | 816 | Open in IMG/M |
| 3300025908|Ga0207643_10408550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 859 | Open in IMG/M |
| 3300025913|Ga0207695_10393932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1270 | Open in IMG/M |
| 3300025913|Ga0207695_10647768 | Not Available | 937 | Open in IMG/M |
| 3300025913|Ga0207695_11005493 | Not Available | 713 | Open in IMG/M |
| 3300025914|Ga0207671_10849604 | Not Available | 723 | Open in IMG/M |
| 3300025916|Ga0207663_11683694 | Not Available | 510 | Open in IMG/M |
| 3300025917|Ga0207660_10525416 | Not Available | 961 | Open in IMG/M |
| 3300025921|Ga0207652_11805957 | Not Available | 516 | Open in IMG/M |
| 3300025925|Ga0207650_10835147 | Not Available | 781 | Open in IMG/M |
| 3300025927|Ga0207687_10598752 | Not Available | 929 | Open in IMG/M |
| 3300025928|Ga0207700_11589731 | Not Available | 579 | Open in IMG/M |
| 3300025940|Ga0207691_11077600 | Not Available | 669 | Open in IMG/M |
| 3300025942|Ga0207689_10099664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2387 | Open in IMG/M |
| 3300025945|Ga0207679_10460124 | Not Available | 1130 | Open in IMG/M |
| 3300025960|Ga0207651_10723089 | Not Available | 878 | Open in IMG/M |
| 3300025966|Ga0210105_1051209 | Not Available | 626 | Open in IMG/M |
| 3300025981|Ga0207640_12181100 | Not Available | 503 | Open in IMG/M |
| 3300026023|Ga0207677_11420454 | Not Available | 640 | Open in IMG/M |
| 3300026041|Ga0207639_12193291 | Not Available | 514 | Open in IMG/M |
| 3300026041|Ga0207639_12213708 | Not Available | 511 | Open in IMG/M |
| 3300026067|Ga0207678_10563690 | Not Available | 997 | Open in IMG/M |
| 3300026095|Ga0207676_12183476 | Not Available | 552 | Open in IMG/M |
| 3300026121|Ga0207683_11532916 | Not Available | 615 | Open in IMG/M |
| 3300026142|Ga0207698_10065695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2851 | Open in IMG/M |
| 3300026357|Ga0256810_1043704 | Not Available | 616 | Open in IMG/M |
| 3300026538|Ga0209056_10351443 | Not Available | 967 | Open in IMG/M |
| 3300027885|Ga0209450_10064244 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
| 3300028592|Ga0247822_10813534 | Not Available | 762 | Open in IMG/M |
| 3300028732|Ga0302264_1012862 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300028743|Ga0302262_10263646 | Not Available | 586 | Open in IMG/M |
| 3300028770|Ga0302258_1020447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1484 | Open in IMG/M |
| 3300028770|Ga0302258_1143716 | Not Available | 586 | Open in IMG/M |
| 3300029984|Ga0311332_10022114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 4269 | Open in IMG/M |
| 3300029990|Ga0311336_11716738 | Not Available | 554 | Open in IMG/M |
| 3300030010|Ga0302299_10308371 | Not Available | 822 | Open in IMG/M |
| 3300030010|Ga0302299_10398599 | Not Available | 703 | Open in IMG/M |
| 3300030114|Ga0311333_10037749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 3407 | Open in IMG/M |
| 3300031232|Ga0302323_102598254 | Not Available | 578 | Open in IMG/M |
| 3300031562|Ga0310886_10807851 | Not Available | 591 | Open in IMG/M |
| 3300031720|Ga0307469_11778033 | Not Available | 595 | Open in IMG/M |
| 3300031772|Ga0315288_10727028 | Not Available | 931 | Open in IMG/M |
| 3300031820|Ga0307473_10410226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei → Burkholderia pseudomallei 1710b | 890 | Open in IMG/M |
| 3300031834|Ga0315290_10944071 | Not Available | 729 | Open in IMG/M |
| 3300031847|Ga0310907_10821472 | Not Available | 521 | Open in IMG/M |
| 3300031918|Ga0311367_12172991 | Not Available | 533 | Open in IMG/M |
| 3300031939|Ga0308174_10044834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2949 | Open in IMG/M |
| 3300031996|Ga0308176_11045594 | Not Available | 862 | Open in IMG/M |
| 3300032008|Ga0318562_10080047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae | 1834 | Open in IMG/M |
| 3300032008|Ga0318562_10287878 | Not Available | 955 | Open in IMG/M |
| 3300032076|Ga0306924_12630841 | Not Available | 501 | Open in IMG/M |
| 3300032092|Ga0315905_11004037 | Not Available | 702 | Open in IMG/M |
| 3300032174|Ga0307470_11379294 | Not Available | 581 | Open in IMG/M |
| 3300032256|Ga0315271_11274648 | Not Available | 635 | Open in IMG/M |
| 3300032256|Ga0315271_11530839 | Not Available | 574 | Open in IMG/M |
| 3300032261|Ga0306920_101238553 | Not Available | 1076 | Open in IMG/M |
| 3300032420|Ga0335397_10952184 | Not Available | 581 | Open in IMG/M |
| 3300032516|Ga0315273_13120633 | Not Available | 515 | Open in IMG/M |
| 3300032770|Ga0335085_12449164 | Not Available | 519 | Open in IMG/M |
| 3300032782|Ga0335082_10411335 | Not Available | 1217 | Open in IMG/M |
| 3300033413|Ga0316603_11597965 | Not Available | 618 | Open in IMG/M |
| 3300033414|Ga0316619_11080519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300033482|Ga0316627_100927952 | Not Available | 837 | Open in IMG/M |
| 3300033513|Ga0316628_104000382 | Not Available | 527 | Open in IMG/M |
| 3300033521|Ga0316616_100008518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 5770 | Open in IMG/M |
| 3300034129|Ga0370493_0174910 | Not Available | 710 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.21% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 6.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.83% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.83% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.14% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.14% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.76% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.07% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.07% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.07% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.07% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.38% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.38% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.69% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.69% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.69% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.69% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.69% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.69% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.69% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.69% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025443 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025966 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026357 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 10-16 PU5 | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028732 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300028743 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300034129 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_c1_00004130 | 2124908043 | Soil | MKRELRVRLKYPTPQTLFAEVAPKALRKQLALPLGAVNVNSA |
| JGI11643J12802_117211362 | 3300000890 | Soil | RLVNDRLKRELRISLAHPTPQAMLAQTAPRALTRQLPLPIG |
| Ga0066684_104221141 | 3300005179 | Soil | SNTRLKRELRVKLKFPTPQALLAQIAPRELKKQLALPIE* |
| Ga0066678_109654852 | 3300005181 | Soil | ESRRLSNARMKRELRVRLRYPTPATLLAEVAPRELKKQIQLPL* |
| Ga0070676_102980041 | 3300005328 | Miscanthus Rhizosphere | RLVNDRLKRELRLSLAHPTPHAMLAQAAPRALTRQLALPIG* |
| Ga0070690_1009598091 | 3300005330 | Switchgrass Rhizosphere | MSESRRLSNTRMKRELRVRLEFATPDALLADIAPRALKKQLALPLGVR* |
| Ga0068868_1001268464 | 3300005338 | Miscanthus Rhizosphere | LSNTRMKRELRVRLEFATPDALLADIAPRALKKQLALPLGVR* |
| Ga0070689_1013075771 | 3300005340 | Switchgrass Rhizosphere | RRLVNTRMKRELRVRLAYPTPQVLLAAVAPRELKKQLPLAL* |
| Ga0070671_1012793691 | 3300005355 | Switchgrass Rhizosphere | NTRMKRELRVRLEFATPDALLADIAPRALKKQLALPLGVR* |
| Ga0070674_1013279052 | 3300005356 | Miscanthus Rhizosphere | SYMSESRRLSNARMKRELRVRLRYRTPQQLLDEIAPRDLKKQMALPL* |
| Ga0070659_1000149107 | 3300005366 | Corn Rhizosphere | RRLANARMKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG* |
| Ga0070699_1002899181 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | ESRRLSNARMKRELRVRLRYPTPQALLAEVAPRELKKQLNLLL* |
| Ga0070684_1006980802 | 3300005535 | Corn Rhizosphere | MNESRRLSNARMKRELRLRLLHPTPHAMLAQVAPRELTRQLALPIGA* |
| Ga0068853_1021288071 | 3300005539 | Corn Rhizosphere | SRRLVNARMKRELRVRLRYPSPLALLREVAPRDLKRQLALPL* |
| Ga0066699_100506934 | 3300005561 | Soil | FMSESRRLANQRMKRELRVRLKYPTPQTLFAEVAPKALRKQLALPLGAVNVDSA* |
| Ga0066708_109658572 | 3300005576 | Soil | RLKYPTPQTLFAEVAPKALRKQLALPLGAVNVDSA* |
| Ga0068854_1013610621 | 3300005578 | Corn Rhizosphere | NDRMKRELRVALRYPEPATLLARIAPREPKKQLALPLG* |
| Ga0068864_1012988052 | 3300005618 | Switchgrass Rhizosphere | MKRELRVRLRYRTPQELLDEIAPRDLKKQMTLPL* |
| Ga0068866_112689931 | 3300005718 | Miscanthus Rhizosphere | SRRLDNDRLKRELRVRLRFPTPDALLSDVARRGLKKQLALPL* |
| Ga0068870_109897161 | 3300005840 | Miscanthus Rhizosphere | NESRRLSNARMKRELRVRLRYPEPQALLAQIAPRDLRKQLNLPL* |
| Ga0066696_103221072 | 3300006032 | Soil | SFMSESRRLSNTRMKRELRIGLDYPTPQKLLKEIAPRELKKQLALAI* |
| Ga0068871_1002497691 | 3300006358 | Miscanthus Rhizosphere | RMKRELRVRLRYPIPQAMLEAVAPRELRKQLALPI* |
| Ga0074062_118575211 | 3300006606 | Soil | LTNGRMKRELRVRLRYPVPDVMLSQIAPRNLKRQLALPL* |
| Ga0079222_103315691 | 3300006755 | Agricultural Soil | KRELRVRLRHPTPDAMLAQCAPRELRKQLALPIG* |
| Ga0066653_106467922 | 3300006791 | Soil | SNARMKRELRVRLRYPTSQALLAEVAPRELKKQLNLPL* |
| Ga0066660_100606781 | 3300006800 | Soil | ESRRLANQRMKRELRVRLKYPTPHTLFAEVAPKALRKQLALPLGAVKVDSA* |
| Ga0068865_1002870433 | 3300006881 | Miscanthus Rhizosphere | LVNARMKRELRVRLRYPSPLALLREVAPRDLKRQLALPL* |
| Ga0075435_1004557182 | 3300007076 | Populus Rhizosphere | RRLANMRMKDELRVRLRYPTPQHLLDAVAPRDLKKQLALPL* |
| Ga0102851_112786602 | 3300009091 | Freshwater Wetlands | LSNARMKRELRLRLQYPTPHRLLDEIAPRDLRKQLALPL* |
| Ga0105240_104564461 | 3300009093 | Corn Rhizosphere | RMKRELRVRLRHPTPDAMLAQCAPRELRRQLALPIG* |
| Ga0105240_109766622 | 3300009093 | Corn Rhizosphere | RLSNTRMKRELRVRLAYATPDALLTDIAPRALKKQLALPLGVR* |
| Ga0111539_121103941 | 3300009094 | Populus Rhizosphere | RRLSNTRMKRELRVRQRYPTPAAFLADMVPREFRKQLALPI* |
| Ga0105245_107140082 | 3300009098 | Miscanthus Rhizosphere | SESRRLSNARMKRELRVRLRYKTPQQLLDEIAPRDLKKQLALPL* |
| Ga0066709_1032270501 | 3300009137 | Grasslands Soil | KRELRVRLKYPTPQTLFAQVAPRELKKQMPLPLDY* |
| Ga0105241_107998171 | 3300009174 | Corn Rhizosphere | SESRRLGNARMKRELRVRLRHPTPDAMLAQCAPRELKRQLALPIG* |
| Ga0105241_116902731 | 3300009174 | Corn Rhizosphere | RMKRELRMRLRHPTPHAMLAQTAPRELRRQLALPIG* |
| Ga0115028_106549221 | 3300009179 | Wetland | SESRRLSNARMKGELRVRLRYPTPQRLLDEIAPRDLKKQLALPL* |
| Ga0105237_119972342 | 3300009545 | Corn Rhizosphere | LVNARMKRELRVRLAYPTPQVLLAAVAPRELKKQLALAL* |
| Ga0105249_105504021 | 3300009553 | Switchgrass Rhizosphere | RAKRELRMRLAYPTPQSLLAEVAPRELKKQLPLAL* |
| Ga0126384_113604422 | 3300010046 | Tropical Forest Soil | MKRELRVSLRYPTPERLLAEVARRDLKKQMPLPL* |
| Ga0126376_104685521 | 3300010359 | Tropical Forest Soil | MKRELRVSLRYPTPERLLAEVARRDFKKQMPLPL* |
| Ga0134124_127612452 | 3300010397 | Terrestrial Soil | NARMKRELRVRLRYPSPLALLREVAPRDLKRQLALPL* |
| Ga0105246_125827532 | 3300011119 | Miscanthus Rhizosphere | LSNARMKRELRLRLLYPTPQRLLAEIAPRDLKKQLALAL* |
| Ga0137399_109375431 | 3300012203 | Vadose Zone Soil | TRMKRELRVRLRYSTPQAMLARIAPRELKKQLALPI* |
| Ga0137379_104978001 | 3300012209 | Vadose Zone Soil | NTRMKRELRVRLKYPTPQTLLAQVAPRELRKQMALPLD* |
| Ga0137373_103065861 | 3300012532 | Vadose Zone Soil | NARMKRELRVRLRYPTPMPLLDAIAPRDLKKQLTLPL* |
| Ga0137359_102199583 | 3300012923 | Vadose Zone Soil | RLANQRMKRELRVRLKYPTPQTLFAEVAPKALRKQLALPLGAVNVDSA* |
| Ga0164309_109419862 | 3300012984 | Soil | NESRRLRNLRMKRELRVALRYPEPAALLARIAPREPKKQLALPLG* |
| Ga0164305_120637371 | 3300012989 | Soil | RELRLRLLHPTPHAMLAQVAPRELTRQLALPIGA* |
| Ga0157370_100101021 | 3300013104 | Corn Rhizosphere | SRRLVNARMKRELRVTLRHPTPHDVLKEAAPRALRRQLSLPIA* |
| Ga0157369_104549032 | 3300013105 | Corn Rhizosphere | MSESRRLSNARLKRELRARLAHPTPHAMLAQVAPRELTRQLALPIGT* |
| Ga0157378_113292072 | 3300013297 | Miscanthus Rhizosphere | ESRRLSNARMKRELRLRLLYPTPQKLLAEIAPRDLKKQLALPL* |
| Ga0157378_123025951 | 3300013297 | Miscanthus Rhizosphere | KRELRLSLAHPTPHAMLAQAAPRALTRQLALPIG* |
| Ga0163162_127284772 | 3300013306 | Switchgrass Rhizosphere | VRLKRELRLRLLHPTPHAMLAQVAPRELTRQLALPIGT* |
| Ga0163162_132245271 | 3300013306 | Switchgrass Rhizosphere | RRLSNSRMKRELRVRLKYPTPQQLLDDVAPRDLRKQLALPI* |
| Ga0157372_110066631 | 3300013307 | Corn Rhizosphere | RMKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG* |
| Ga0157375_102430884 | 3300013308 | Miscanthus Rhizosphere | VNTRMKRELRVRLLYPTPQHLLSEIAPRDLKKQLALPL* |
| Ga0157376_116486032 | 3300014969 | Miscanthus Rhizosphere | RLSNARMKLELRLRLLYPTPQRLLAEIAPRDLKKQLALPL* |
| Ga0187788_105185151 | 3300018032 | Tropical Peatland | RMKRELRLRLKYPEPGALLAEVARRRPKKQLALPL |
| Ga0184628_104413122 | 3300018083 | Groundwater Sediment | MSESRRLVNTRMKRELRVRLKYPTPQHLLAEVAPRDLKKQLALPL |
| Ga0184629_103023111 | 3300018084 | Groundwater Sediment | RLSNVRMKRELRVTLRYPNPQQLLDEVAPRDLRKQLALPL |
| Ga0066667_113222572 | 3300018433 | Grasslands Soil | MSESRRLTNTRMKRELRLHLKYPTPDTFLAEVAPRALRKQLALPL |
| Ga0066667_116683772 | 3300018433 | Grasslands Soil | NTRMKRELRVRLKYATPQALLQEVAPRELKKQLPLPL |
| Ga0190270_127211311 | 3300018469 | Soil | NARAKRELRMRLAYPTPQSLLAEVAPRELKKQLPLAL |
| Ga0190274_109430381 | 3300018476 | Soil | RRLVNTRMKRELRLRLKYPTPQHLLAEVAPRDLKKQLALPL |
| Ga0190271_135383932 | 3300018481 | Soil | SRRLTNVRMKRELRVRLRYPTPQRLFDEAAPRDLKKQLVLPL |
| Ga0066669_112037661 | 3300018482 | Grasslands Soil | RRLSNTRMKRELRVRLRYPTPAILLAQVARRELRKQIPLPL |
| Ga0066669_122498281 | 3300018482 | Grasslands Soil | SESRRLTNVRMKRELRVNLKYPTPQVLLNQIAPRELKKQLALPI |
| Ga0193751_10887711 | 3300019888 | Soil | RELRVRLKYPTPQVLFAEVAPKALKKQLALPLGNAP |
| Ga0193728_12039892 | 3300019890 | Soil | RLANERMKRELRVRLKYPTPQTLFAEVAPRALKKQLALPLGAINVNSA |
| Ga0193724_10919911 | 3300020062 | Soil | RMKRELRVRLEFATPDALLADIAPRALKKQLALPLGAQ |
| Ga0213876_100429701 | 3300021384 | Plant Roots | LRLKRELRVRLRYPTPQALLSDIARRELKKQLALPI |
| Ga0224510_100074307 | 3300022309 | Sediment | ANARMKRELRVRLRYPAPQDLLAEIAPRDLRKQMALPL |
| Ga0222622_105676112 | 3300022756 | Groundwater Sediment | ESRRLINTRMKRELRVRLLYPTPQHLLSEIAPRDLKKQLALPL |
| Ga0208081_10458872 | 3300025443 | Arctic Peat Soil | SNARMKGELRVRLRYPTAQTMLGEIAPRDLKKQMALPL |
| Ga0208851_10277251 | 3300025461 | Arctic Peat Soil | RLKRELRVRLQFPTPDTLLSGVAPRDLKKQLALPL |
| Ga0207682_102860261 | 3300025893 | Miscanthus Rhizosphere | VNDRLKRELRLSLAHPTPHAMLAQAAPRALTRQLALPIG |
| Ga0207699_113017981 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MKRELRVRLRHPTPDAMLAQCAPRELKRQLALPIG |
| Ga0207645_102536963 | 3300025907 | Miscanthus Rhizosphere | RRLVNDRLKRELRLSLAHPTPHAMLAQAAPRALTRQLALPIG |
| Ga0207645_105079102 | 3300025907 | Miscanthus Rhizosphere | RRLSNARMKRELRVRLRYRTPQALLDEIAPRDLKKQLTLPL |
| Ga0207643_104085501 | 3300025908 | Miscanthus Rhizosphere | RLSNARMKRELRVRLRYPEPQALLAQIAPRDLRKQLNLPL |
| Ga0207695_103939323 | 3300025913 | Corn Rhizosphere | NDRMKRELRVRLRHPTPDAMLAQCAPRELRRQLALPIG |
| Ga0207695_106477682 | 3300025913 | Corn Rhizosphere | GNARMKRELRVRLRHPTPDAMLAQCAPRELKRQLALPIG |
| Ga0207695_110054932 | 3300025913 | Corn Rhizosphere | MSESRRLSNTRMKRELRVRLEFATPDALLADIAPRALKKQLALPLGVR |
| Ga0207671_108496042 | 3300025914 | Corn Rhizosphere | SESRRLANARMKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG |
| Ga0207663_116836941 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RMKRELRLKLHHPTAERMLADVARRALKKQLALPL |
| Ga0207660_105254161 | 3300025917 | Corn Rhizosphere | ARMKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG |
| Ga0207652_118059571 | 3300025921 | Corn Rhizosphere | RMKRELRVRLRHPTPHAVLAKAAPRELRRQLTLPIG |
| Ga0207650_108351471 | 3300025925 | Switchgrass Rhizosphere | RRLSNARLKRELRVRLAHPTPHAMLAQVAPRELTRQLALPIGT |
| Ga0207687_105987522 | 3300025927 | Miscanthus Rhizosphere | RRLCNARMKRELRVRLAFPTPDALLADIAPRALKKQLALPLGAQ |
| Ga0207700_115897312 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RRLVNSRMKRELRVRLRHPTPHGELAQTAPRELRRQLALPIG |
| Ga0207691_110776001 | 3300025940 | Miscanthus Rhizosphere | RMKRELRVALRYPEPAALLARIAPREPKKQLALPLG |
| Ga0207689_100996641 | 3300025942 | Miscanthus Rhizosphere | RLSNARMKRELQVRLKYPTPAAMLAAVAPRALRKQLALPI |
| Ga0207679_104601241 | 3300025945 | Corn Rhizosphere | KRELRVRLAFPTPDALLADIAPRALKKQLALPLGAQ |
| Ga0207651_107230891 | 3300025960 | Switchgrass Rhizosphere | ARMKRELQVRLKYPTPAAMLAAVAPRALRKQLALPI |
| Ga0210105_10512092 | 3300025966 | Natural And Restored Wetlands | NARMKRELRLRLRYPLPQVLLDEVAPRDLRKQLALPL |
| Ga0207640_121811001 | 3300025981 | Corn Rhizosphere | RLVNDRMKRELRVALRYPEPATLLARIAPREPKKQLALPLG |
| Ga0207677_114204542 | 3300026023 | Miscanthus Rhizosphere | MNESRRLGNRRMKRELRVALRYPEPAALLARIAPREPKKQLALPLG |
| Ga0207639_121932911 | 3300026041 | Corn Rhizosphere | DRMKRELRVALRYPEPAALLARIAPREPKKQLALPLG |
| Ga0207639_122137082 | 3300026041 | Corn Rhizosphere | DRLKRELRVRLRFPTPDAMLGDVARRDLKKQLALPL |
| Ga0207678_105636901 | 3300026067 | Corn Rhizosphere | MKRELRVALRYPEPAALLARIAPREPKKQLALPLG |
| Ga0207676_121834761 | 3300026095 | Switchgrass Rhizosphere | SNVRMKRELRVRLRYPIPQAMLEAVAPRELRKQLALPI |
| Ga0207683_115329162 | 3300026121 | Miscanthus Rhizosphere | SRRLSNARLKRELRVRLAHPTPHAMLAQVAPRELTRQLALPIGT |
| Ga0207698_100656955 | 3300026142 | Corn Rhizosphere | MKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG |
| Ga0256810_10437041 | 3300026357 | Sediment | LSNRRMKRELRLVLRHPTITQTLAEAAPRTLRKQLALPI |
| Ga0209056_103514431 | 3300026538 | Soil | RRLANTRMKRELRGRLKDPTPQALLREVAPLELKKQLALPL |
| Ga0209450_100642441 | 3300027885 | Freshwater Lake Sediment | SRRLVNARMKRELRVKLRYPTPQDLLDEVAPRDLRKQLALPL |
| Ga0247822_108135341 | 3300028592 | Soil | RRLVNARAKRELRLRLAHPTPQPLLAEVAPRELRKQLALQL |
| Ga0302264_10128621 | 3300028732 | Fen | DRLKRELRVQLRYPTPDALLSGIVPRDLKKQLALAL |
| Ga0302262_102636461 | 3300028743 | Fen | RLANTRMKRELRLKLRYPTPEALLAEVAPRALKKQLALSL |
| Ga0302258_10204471 | 3300028770 | Fen | NDRLKRELRVRLRYPTPDALLSGIAPRDLKKQLALAL |
| Ga0302258_11437161 | 3300028770 | Fen | DRLKHELRVRLQFPTPDTLLSGVAPRDLKKQLALPI |
| Ga0311332_100221146 | 3300029984 | Fen | DRLKRELRVRLQFPTPDTLLSGVAPRDLKKQLALPL |
| Ga0311336_117167381 | 3300029990 | Fen | RMKRELRLKLRYPTPEALLAEVAPRALKKQLALSL |
| Ga0302299_103083712 | 3300030010 | Fen | RLKRELRVRLRYPTPDALLSGIAPRDLKKQLALAL |
| Ga0302299_103985992 | 3300030010 | Fen | LGNDRLKRELRVRLQYPTPDALLSGIAPRDLKKQLALAL |
| Ga0311333_100377491 | 3300030114 | Fen | LVNDRLKRELRVRLQFPTPDTLLSGVAPRDLKKQLALPL |
| Ga0302323_1025982542 | 3300031232 | Fen | RMKRELRVNLRYPTPQHLLTAIAPRDLRKQMALPL |
| Ga0310886_108078511 | 3300031562 | Soil | ESRRLSNARMKRELRVRLRYRTPQALLDEIAPRDLKKQLALPL |
| Ga0307469_117780331 | 3300031720 | Hardwood Forest Soil | RMKRELRVRLEFATPDALLADIAPRALKKQLALPLGAR |
| Ga0315288_107270281 | 3300031772 | Sediment | ARMKRELRVRLKYETPQQLLTEIAPRDLKKQLALPL |
| Ga0307473_104102262 | 3300031820 | Hardwood Forest Soil | RLSNARMKRELRLRLKYPLPQAMLDEIAPRQLRRQLALPLATDR |
| Ga0315290_109440712 | 3300031834 | Sediment | RMKRELRVRLKYETPQQLLTEIAPRDLKKQLALPL |
| Ga0310907_108214721 | 3300031847 | Soil | GESRRLANRRMKGELRVRLRYPTPQAMLDALAPRALRKQMPLTF |
| Ga0311367_121729912 | 3300031918 | Fen | RLTNERLKSELRVRLRYPTPEAMLRDIAPRDLKKQLALPL |
| Ga0308174_100448345 | 3300031939 | Soil | ANTRMKRELRVRLRHPTPHAMLAQCAPRELRRQLSLPIG |
| Ga0308176_110455941 | 3300031996 | Soil | MKRELRVRLRHPTPHAMLAQCAPRELRRQLLLPIG |
| Ga0318562_100800471 | 3300032008 | Soil | RLSNARMKRELRVRLRYSTPQQLLDEIAPRDLKKQLALPL |
| Ga0318562_102878782 | 3300032008 | Soil | MKRELRLHLRYPRPQVLLAEVAPRELRKQLALPLGS |
| Ga0306924_126308412 | 3300032076 | Soil | RLSNARMKRELRLHLRYPRPQVLLAEVAPRELRKQLALPLGS |
| Ga0315905_110040372 | 3300032092 | Freshwater | RLANVRMKRELRVRLRYPVPQVLLDEVAPRDLRKQLALPI |
| Ga0307470_113792941 | 3300032174 | Hardwood Forest Soil | LDNGRMKRELRVRLRYPDPAALLAEIAPRDLKKQLALPL |
| Ga0315271_112746481 | 3300032256 | Sediment | LSNARMKRELRVRLCYPIPQRLLDEIAPRDLKKQLALPL |
| Ga0315271_115308392 | 3300032256 | Sediment | RLVNARMKRELRVRLQYETPQQLLTEIAPRDLKKQLALPL |
| Ga0306920_1012385531 | 3300032261 | Soil | MNESRRLANARMKRELRLRLKYPTPDVLFAEVARRSPKKQLALPL |
| Ga0335397_109521842 | 3300032420 | Freshwater | RMKRELRVRLAFPTPQVMLAAVVPKQLKKQLPLAL |
| Ga0315273_131206331 | 3300032516 | Sediment | FMGESRRLTNVRMKRELRVRLKYPTPQRLLDEVAPRDLKKQLVLPL |
| Ga0335085_124491641 | 3300032770 | Soil | ARMKRELRVRLLYPTPARLLEAIAPRDLKKQLALPL |
| Ga0335082_104113353 | 3300032782 | Soil | ARMKRELRVRLRYRTPQQLLDEVAPRDLKKQLALPL |
| Ga0316603_115979651 | 3300033413 | Soil | SFMSESRRLVNRRMKHELRVRLAYATPATLLAAVAPRELKKQLPLAL |
| Ga0316619_110805192 | 3300033414 | Soil | MSESRRVGNGRMKRELRVRLAYPTPQRLLDEVAPRNLRKQLALPI |
| Ga0316627_1009279522 | 3300033482 | Soil | LVNTRMKRELRVRLRYPIPQGLLDEVAPRDLKNQLPLPL |
| Ga0316628_1040003822 | 3300033513 | Soil | NARMKRELRVVLRYATPQRLLAEIAPRDLKKQLALPL |
| Ga0316616_1000085187 | 3300033521 | Soil | SNARMKRELRLVLKYPNPQQMLDEIAPRDLRKQLALPL |
| Ga0370493_0174910_7_123 | 3300034129 | Untreated Peat Soil | MKRELRVRLTYPNPHQLLKEVAPRNLKRQLALPLGAEE |
| ⦗Top⦘ |