 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F050330 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPKKKK |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 56.25 % |
| % of genes near scaffold ends (potentially truncated) | 13.10 % |
| % of genes from short scaffolds (< 2000 bps) | 71.72 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.345 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.759 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.724 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (66.207 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.43% β-sheet: 0.00% Coil/Unstructured: 86.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF01832 | Glucosaminidase | 47.59 |
| PF02195 | ParBc | 5.52 |
| PF01501 | Glyco_transf_8 | 4.14 |
| PF01381 | HTH_3 | 1.38 |
| PF03237 | Terminase_6N | 1.38 |
| PF06147 | DUF968 | 1.38 |
| PF06114 | Peptidase_M78 | 1.38 |
| PF00149 | Metallophos | 0.69 |
| PF13489 | Methyltransf_23 | 0.69 |
| PF00777 | Glyco_transf_29 | 0.69 |
| PF02178 | AT_hook | 0.69 |
| PF16784 | HNHc_6 | 0.69 |
| PF11351 | GTA_holin_3TM | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG1442 | Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase | Cell wall/membrane/envelope biogenesis [M] | 4.14 |
| COG5597 | N-acetylglucosaminyl transferase | Cell wall/membrane/envelope biogenesis [M] | 4.14 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.34 % |
| All Organisms | root | All Organisms | 29.66 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 15.17% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 11.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 9.66% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 8.28% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.52% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 3.45% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.76% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.07% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.38% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.38% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.38% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.38% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.38% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.69% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.69% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.69% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.69% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.69% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.69% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.69% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 0.69% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.69% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020537 | Freshwater microbial communities from Lake Mendota, WI - 21SEP2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300024490 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027499 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027730 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8m | Environmental | Open in IMG/M |
| 3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028083 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GOS2236_10269722 | 3300001968 | Marine | MSNETTSSSVSVLYTAKKKVKGTYKVFKPKPLKMPKKK* |
| B570J29581_1015312 | 3300002274 | Freshwater | MGITTSSSLSVLYTNKVKTKGTYRVYKPKPLKMPKRKKK* |
| B570J29032_1090655243 | 3300002408 | Freshwater | ANETTSTSVSVLITPQKGKGTYRVYKPKKPKKKK* |
| JGI25930J51415_10637222 | 3300003499 | Freshwater Lake | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPKKKK* |
| Ga0007787_100195557 | 3300004240 | Freshwater Lake | MSNETTSTSLNKLYTNKVKTKGSYRIYKPKPLKMPKKKK* |
| Ga0049083_100211355 | 3300005580 | Freshwater Lentic | MANETTSTSTAVLYTNRKAKGTYRVYKPKTLKMPKRKKK* |
| Ga0049081_100924093 | 3300005581 | Freshwater Lentic | MANETTSTSVGVLITTQKGKGTYRVYKPKKMPSKKK* |
| Ga0049081_101033102 | 3300005581 | Freshwater Lentic | MANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPRKKK* |
| Ga0049081_102934791 | 3300005581 | Freshwater Lentic | MANETTSTSVSVLITPQKGKGTYRVYKPKKMPSKKK* |
| Ga0049080_100279484 | 3300005582 | Freshwater Lentic | MAGETTSSSIGVLYTNRKAKGTYRVYKPKTLKMPKRKKK* |
| Ga0049080_102416972 | 3300005582 | Freshwater Lentic | MANETTSTTLNKLYTNKVKTKGTYRVYRPKPLKMPRKKK* |
| Ga0049084_103024031 | 3300005585 | Freshwater Lentic | MAGETTSTSVSVLITPQKGKGTYRVYKPKKMPSKKK* |
| Ga0079957_10465374 | 3300005805 | Lake | MANETTSTSVSKLYTNKVKTKGTYRVYKPKPLKMPKRKK* |
| Ga0079957_10829784 | 3300005805 | Lake | MANETTSTSVSKLYTNKVKVKGTYKIFKPKPLKMPKKKK* |
| Ga0079957_11628793 | 3300005805 | Lake | MAGETTSSSIGVLYTNRKAKGTYRVYKPKKMPRKKK* |
| Ga0079957_12551802 | 3300005805 | Lake | MANETTSTSVSVLITPQKAKGSYRVYKPKKTKKKK* |
| Ga0079957_13212582 | 3300005805 | Lake | MANETTSASISVLITNKKGKGTYRVYKPKKMNKRKK* |
| Ga0073913_100745171 | 3300005940 | Sand | IMANETTSTSTAVLYTNRKAKGTYRVYKPKTLKMPKRKKK* |
| Ga0079301_10363842 | 3300006639 | Deep Subsurface | MANETTSTSLNSLYQKRVKVKGTYRVYRPKPLKMPRKKK* |
| Ga0079301_12440552 | 3300006639 | Deep Subsurface | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPRKKK* |
| Ga0075464_101666845 | 3300006805 | Aqueous | MANETTSTSLNKLYTNKVKAKGTYRVYKPKPLKMPRKKK* |
| Ga0105747_13045782 | 3300007974 | Estuary Water | MAGETTSTTLSKLYTNKVKTKGTYRVYRPKPLKMPRKKK* |
| Ga0114340_10941772 | 3300008107 | Freshwater, Plankton | MANETTSTSLSKLYTNKVKTKGTYRVYRPKPLKMPRKKK* |
| Ga0114343_11531551 | 3300008110 | Freshwater, Plankton | TTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPRKKK* |
| Ga0114347_10110666 | 3300008114 | Freshwater, Plankton | MANETTSTSTAVLYTNRKTKGTYRVYKPKTLKMPKRKKK* |
| Ga0114347_10257255 | 3300008114 | Freshwater, Plankton | MANETTSTSLSKLYTNKVKTKGTYRVYKPKPLKMPRKKK* |
| Ga0114351_10176029 | 3300008117 | Freshwater, Plankton | MANETTSTSVSVLITPQKGKGTYRVYKPKKPKKKK* |
| Ga0114351_12336142 | 3300008117 | Freshwater, Plankton | MANETTSSSLAVLYTNRKSKGTYRVYKTKKMPRKKK* |
| Ga0114355_11381402 | 3300008120 | Freshwater, Plankton | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPKRKK* |
| Ga0114841_100076926 | 3300008259 | Freshwater, Plankton | MAGETTSTSIGVLYTNRKAKGTYRVYKPKKMPRKKK* |
| Ga0114841_10079049 | 3300008259 | Freshwater, Plankton | MANETTSTSLNSLYQKRVKVKGTYRVYRPKPLKMPKKKK* |
| Ga0114841_11285783 | 3300008259 | Freshwater, Plankton | MAGETTSTSIATLYTKKVKTKGTYRVYKPKPLKMPRKKK* |
| Ga0114363_10099048 | 3300008266 | Freshwater, Plankton | MANETTSTSIATLYTKKVKTKGTYRVYKPKPLKMPKRKK* |
| Ga0114363_10561262 | 3300008266 | Freshwater, Plankton | MANETTSTTLNKLYTNKVKTKGTYRVYKPKPLKMPRKKK* |
| Ga0114980_1000184311 | 3300009152 | Freshwater Lake | MANETTSSTLSKLYTNKTKVKGTYRVYKPKPLKQTKKK* |
| Ga0114977_100068036 | 3300009158 | Freshwater Lake | MANETTSTSLSKLYTNKTKVKGTYRVYKPKPLKQPKKK* |
| Ga0105097_102835973 | 3300009169 | Freshwater Sediment | MAGETTSTTLSKLYTNKVKTKGTYRVYKPKPLKMPKKKK* |
| Ga0129336_101945072 | 3300010370 | Freshwater To Marine Saline Gradient | MANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPKKKK* |
| Ga0151517_112721 | 3300011113 | Freshwater | MANETTSTSLNKLYTNKVKVKGTYRVYKPKPLKMPRKKK* |
| Ga0153799_10023224 | 3300012012 | Freshwater | MGITTSSSLAVLYTNKVKTKGTYRVYKPKPLKMPKRKKK* |
| Ga0164293_100215108 | 3300013004 | Freshwater | MANETTSTSVSVLITPQKAKGSYRVYKPKKSKKKK* |
| Ga0164293_102815382 | 3300013004 | Freshwater | MPNKTTSTSLAVLYTNRRVKGTYRVYKPKKAPKKKK* |
| Ga0164293_102843171 | 3300013004 | Freshwater | NETTSTSTAVLYTNRKAKGTYRVYKPKTLKMPKRKKK* |
| Ga0164293_103383343 | 3300013004 | Freshwater | MANETTSTSLNKLYTNKVKTKGSYRVYKAKPLKMPKRKK* |
| Ga0164293_107745732 | 3300013004 | Freshwater | MAGETTSTTLSKLYTNKVKTKGTYRVYKPKPLKMPRKKK* |
| Ga0164292_102848302 | 3300013005 | Freshwater | MAGETTSTSVSVLITPQKGKGTYRVYKPKKAPKRKK* |
| Ga0164292_107380032 | 3300013005 | Freshwater | MAGETTSTTLSKLYTNKVKTKGTYRVYKPKPLKMPKK* |
| Ga0164292_109664272 | 3300013005 | Freshwater | MANETTSTSVATLYTKKVKVKGTYRVYKPKPLKMPKKKK* |
| (restricted) Ga0172374_12532962 | 3300013122 | Freshwater | MTGETTSSSLGVLYTNRKAKGTYRVYKPKPLKMSKK |
| (restricted) Ga0172367_104304631 | 3300013126 | Freshwater | MAGETTSSSLGVLYTNRKAKGTYRVYKPKPLKMPRKKK* |
| (restricted) Ga0172373_100685212 | 3300013131 | Freshwater | MADETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPRKKK* |
| (restricted) Ga0172375_102647734 | 3300013137 | Freshwater | MTGETTSSSLGVLYTNRKAKGTYRVYKPKPLKMPKKK* |
| (restricted) Ga0172371_108028402 | 3300013138 | Freshwater | MAGETTSSSVGVLYTNRKAKGTYRVYKPKPLKMPKKK* |
| Ga0181347_11698773 | 3300017722 | Freshwater Lake | MANETTSTSVGVLITTQKGKGTYRVYKPKKMPSKKK |
| Ga0181347_12088932 | 3300017722 | Freshwater Lake | MANETTSTNTAVLYTNRKAKGTYRVYKPKKAPKRKK |
| Ga0181362_10599592 | 3300017723 | Freshwater Lake | MAGETTSTSVGVLITTQKGKGTYRVYKPKKAPKRKKXRNQ |
| Ga0181362_10988051 | 3300017723 | Freshwater Lake | KIMANETTSTSVGVLITTQKGKGTYRVYKPKKVPKRKK |
| Ga0181356_10456412 | 3300017761 | Freshwater Lake | MANETTSTNTAVLYTNRKAKGTYRVYKPKPLKMPKRKKK |
| Ga0181343_11166022 | 3300017766 | Freshwater Lake | MAGETTSTTLSKLYTNKVKTKGTYRVYRPKPLKMPRKKK |
| Ga0169931_105993511 | 3300017788 | Freshwater | MAGETTSSSIGVLYTNRKAKGTYRVYKPKPLKMSKKKK |
| Ga0181359_10044756 | 3300019784 | Freshwater Lake | MANETTSTSVSVLITPQKGKGTYRVYKPKKAPKRKK |
| Ga0181359_10230403 | 3300019784 | Freshwater Lake | MANETTSTSVGVLITTQKGKGTYRVYKPKKAPKRKK |
| Ga0181359_11415133 | 3300019784 | Freshwater Lake | MANETTSTSTAVLYTNRKAKGTYRVYKPKTLKMPKRKKK |
| Ga0181359_11929743 | 3300019784 | Freshwater Lake | MANETTSTSVGVLITTQKGKGTYRVYKPKKVPKRKK |
| Ga0181359_12293821 | 3300019784 | Freshwater Lake | MANETTSTSVSVLITPQKGKGTYRVYKPKKMPSKKK |
| Ga0181359_12675821 | 3300019784 | Freshwater Lake | MAGETTSTGTGVLYTNRKTKGTYRVYKPKPLKMPKRKKK |
| Ga0211732_13332172 | 3300020141 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPRKKKXT |
| Ga0211736_103894965 | 3300020151 | Freshwater | MANETTSSSLNKLYTNKVKTKGSYRVYKAKPLKMPKGKK |
| Ga0211733_111263388 | 3300020160 | Freshwater | MSNETTSTSLNKLYTNKVKTKGSYRVYKPKPLKMPKKKK |
| Ga0211726_104496723 | 3300020161 | Freshwater | MANETTSTSVATLYTKKVKVKGTYRVYKPKPLKMPRKKK |
| Ga0211726_110517372 | 3300020161 | Freshwater | MANETTSTSLNKLYTNKKAKGTYRVYKPKPLKMPKKKK |
| Ga0211729_113536762 | 3300020172 | Freshwater | MANETGTNNLSVLITNKRGKGSYRVYKAKPLKMPKKKK |
| Ga0208050_10026635 | 3300020498 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPRKKKXRNLFI |
| Ga0208050_10087162 | 3300020498 | Freshwater | MAGETTSTSVSVLITPQKGKGTYRVYKPKKAPKRKKXRSQSGKEIDQKD |
| Ga0208091_100028230 | 3300020506 | Freshwater | MANETTSTSVSVLITPQKAKGSYRVYKPKKPKKKK |
| Ga0208091_100030215 | 3300020506 | Freshwater | MGITTSSSLSVLYTNKVKTKGTYRVYKPKPLKMPKRKKK |
| Ga0208091_100055613 | 3300020506 | Freshwater | MGITTSNSVSVLYTNKVKTKGTYRVYKPKPLKMPKKKK |
| Ga0208232_10025663 | 3300020527 | Freshwater | MGITTSSSLAVLYTNKVKTKGTYRVYKPKPLKMPKRKKK |
| Ga0208235_10156222 | 3300020530 | Freshwater | MANETTSTSVATLYTKKVKVKGTYRVYKPKPLKMPKKKK |
| Ga0208235_10207583 | 3300020530 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPRKKKXKNLFI |
| Ga0208235_10407341 | 3300020530 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPRKKKKXVYLTK |
| Ga0207939_10320032 | 3300020536 | Freshwater | MGITTSNSVSVLYTNKVKTKGTYRVYKPKPLKMPRKKKXKNLFI |
| Ga0208722_10088233 | 3300020537 | Freshwater | MANETTSNSLNKLYTNKTNTKGSYRVYKPKPLKMPKGKK |
| Ga0208360_10010328 | 3300020551 | Freshwater | MAGETTSTSVSVLITPQKGKGTYRVYKPKKAPKRKK |
| Ga0208360_10462243 | 3300020551 | Freshwater | RQDIMANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPRKKKXRNLFI |
| Ga0208599_10025969 | 3300020554 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPRKKK |
| Ga0222714_103261582 | 3300021961 | Estuarine Water | MAGETTSSSIGVLYTNRKAKGTYRVYKPKKMPRKKKXKNLFGKERGQQV |
| Ga0222713_102211751 | 3300021962 | Estuarine Water | MAGETTSSSIGVLYTNRKAKGTYRVYKPKKMPRKKK |
| Ga0181354_10505612 | 3300022190 | Freshwater Lake | MAGETTSTSVGVLITTQKGKGTYRVYKPKKAPKRKK |
| Ga0181354_11572364 | 3300022190 | Freshwater Lake | MAGETTSTSVSVLITPQKGKGTYRVYKPKKMPSKKK |
| Ga0255185_10168952 | 3300024490 | Freshwater | MVNETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPRKKK |
| Ga0208916_102470412 | 3300025896 | Aqueous | MANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPKKKK |
| Ga0208788_11449311 | 3300027499 | Deep Subsurface | MANETTSTSLNSLYQKRVKVKGTYRVYRPKPLKMPRKKK |
| Ga0209651_10257481 | 3300027581 | Freshwater Lake | IMANETTSTSTAVLYTNRKAKGTYRVYKPKPLKMPKRKKK |
| Ga0208974_10486102 | 3300027608 | Freshwater Lentic | MAGETTSSSIGVLYTNRKAKGTYRVYKPKTLKMPKRKKK |
| (restricted) Ga0247836_10269998 | 3300027728 | Freshwater | MANETTSTSTAVLYTNRKAKGTYKVYKPKPLKMPRKKK |
| (restricted) Ga0247833_10670193 | 3300027730 | Freshwater | MAGETTSSSIGVLYTNRKAKGTYRVYKPKPLKMPKKKK |
| Ga0209297_100162131 | 3300027733 | Freshwater Lake | MANETTSTSLSKLYTNKTKVKGTYRVYKPKPLKQPKKK |
| Ga0209355_11549272 | 3300027744 | Freshwater Lake | MANETTSTSLSKLYTNKVKTKGTYRVYKPKPLKMPKRKKK |
| Ga0209296_10339434 | 3300027759 | Freshwater Lake | MANETTSSTLSKLYTNKTKVKGTYRVYKPKPLKQPKKK |
| Ga0209134_101160084 | 3300027764 | Freshwater Lake | MANETTSTSLNKLYTNKVKTKGYYRVYKAKPLKMPKGKK |
| Ga0209246_101469571 | 3300027785 | Freshwater Lake | MAGETTSTGTGVLYTNRKAKGTYRVYKPKPLKMPKRKKK |
| Ga0209353_104630152 | 3300027798 | Freshwater Lake | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPKKKKXTITNI |
| Ga0209354_100252766 | 3300027808 | Freshwater Lake | NIMANETTSTSTAVLYTNRKAKGTYRVYKPKTLKMPKRKKK |
| Ga0209230_108301551 | 3300027836 | Freshwater And Sediment | MANETTSTSVGVLVTNQKGKGTYRVYKPKKAPKRKK |
| Ga0209253_108286042 | 3300027900 | Freshwater Lake Sediment | MANETTSSSLNKLYTNKVKTKGSYRVYKAKPLKMPKKKK |
| (restricted) Ga0233418_101865802 | 3300027995 | Sediment | MAGETTSTSIAVLYSKSKAKGTYRVYKPKPLKKKK |
| Ga0247723_10042102 | 3300028025 | Deep Subsurface Sediment | MANETTSTTLNKLYTNKVKTKGTYRVYKPKPLKMPRKKK |
| Ga0255190_10508831 | 3300028083 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPRKKKXKNQ |
| (restricted) Ga0247831_12470134 | 3300028559 | Freshwater | MAGETTSTSVSVLITPQKGKGTYRVYKPKKMPRKKK |
| Ga0119944_100275510 | 3300029930 | Aquatic | MANETTSTSLNKLYTNKVKTKGTYRVYKPKKMPRKKK |
| Ga0119945_10085721 | 3300029933 | Aquatic | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPR |
| Ga0315907_1006099010 | 3300031758 | Freshwater | MANETTSTSIATLYTKKVKTKGTYRVYKPKPLKMPKRKK |
| Ga0315907_101551512 | 3300031758 | Freshwater | MANETTSTSLSKLYTNKVKTKGTYRVYKPKPLKMPRKKK |
| Ga0315907_102560903 | 3300031758 | Freshwater | MANETTSTSVSVLITPQKGKGTYRVYKPKKPKKKK |
| Ga0315909_1000106823 | 3300031857 | Freshwater | MANETTSSSLAVLYTNRKSKGTYRVYKTKKMPRKKK |
| Ga0315909_1001477319 | 3300031857 | Freshwater | MANETTSTSTAVLYTNRKTKGTYIVYKPKTLKMPKRKKK |
| Ga0315909_1001618524 | 3300031857 | Freshwater | MAGETTSTSIGVLYTNRKAKGTYRVYKPKKMPRKKK |
| Ga0315909_102096694 | 3300031857 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPIKKK |
| Ga0315909_105865202 | 3300031857 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPKKKKXIYLTK |
| Ga0315904_101729407 | 3300031951 | Freshwater | ADTNQIQRQVIMANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPRKKK |
| Ga0315904_109541651 | 3300031951 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMTRKKK |
| Ga0315906_105884182 | 3300032050 | Freshwater | MANETTSSSLSVLITNKKSKGTYRVYKPKKMAKNKK |
| Ga0315902_102555902 | 3300032093 | Freshwater | MANETTSTSLNKLYTNRVKTKGTYRVYKPKPLKMPRKKK |
| Ga0315903_101652295 | 3300032116 | Freshwater | MANETTSTSTAVLYTNRKTKGTYRVYKPKTLKMPKRKKK |
| Ga0315903_101894824 | 3300032116 | Freshwater | MANETTSTTLNKLYTNKVKTKGTYRVYRPKPLKMPRKKK |
| Ga0315903_103390291 | 3300032116 | Freshwater | MANETTSTSLSKLYTNKVKTKGTYRVYKPKPLKMPRK |
| Ga0315903_108585891 | 3300032116 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPRK |
| Ga0334982_0271630_59_169 | 3300033981 | Freshwater | MANETTSTSVSVLITPQKGKGTYRVYKPKKMPRKKK |
| Ga0334994_0414320_271_408 | 3300033993 | Freshwater | MANETTSTSLNKLYTNKIKTKGTYRVYRPKPLKMPRKKKWKNLFI |
| Ga0334994_0425864_190_327 | 3300033993 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPRKKKWRNLFI |
| Ga0334994_0444510_249_386 | 3300033993 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPRKKKWKNLFI |
| Ga0334986_0464547_331_468 | 3300034012 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPRKKKWKNLFI |
| Ga0334995_0144639_178_288 | 3300034062 | Freshwater | MPNKTTSTSLAVLYTNRRVKGTYRVYKPKKMPSKKK |
| Ga0334995_0284997_549_683 | 3300034062 | Freshwater | MGITTSNSVSVLYTNKVKTKGTYRVYKPKPLKMPRKKKWRNLFI |
| Ga0334995_0324954_2_130 | 3300034062 | Freshwater | ETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPRKKKWRNLFI |
| Ga0334995_0535764_296_433 | 3300034062 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPKKKKWTITNI |
| Ga0310127_132249_196_315 | 3300034072 | Fracking Water | MANETTSTSLNSLYQKRVKVKGTYRVYKPKPLKMPRKKK |
| Ga0335012_0028650_1391_1507 | 3300034093 | Freshwater | MGITTSNSVSVLYTNKVKTKGTYRVYRPKPLKMPRKKK |
| Ga0335012_0039135_1653_1772 | 3300034093 | Freshwater | MAITTSSSLAVLYTNKVKTKGTYRVYKPKTLKMPKRKKK |
| Ga0335027_0803863_3_143 | 3300034101 | Freshwater | IMANETTSTSLNKLYTNKVKTKGTYRVYRPKPLKMPRKKKWKNLFI |
| Ga0335029_0464228_503_640 | 3300034102 | Freshwater | MANETTSTSLNKLYTNKVKTKGTYRVYKPKPLKMPKKKKWTITNI |
| Ga0335036_0125249_180_290 | 3300034106 | Freshwater | MPNKTTSTSLAVLYTNRRVKGTYRVYKPKKAPKRKK |
| Ga0335007_0758019_422_532 | 3300034283 | Freshwater | MANETTSTSTAVLYTNRKAKGTYRVYKPKTLKMPKRK |
| Ga0335048_0433008_3_131 | 3300034356 | Freshwater | MGITTSNSVSVLYTNKVKTKGTYRVYKPKPLKMPRKKKWKNLF |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |