| Basic Information | |
|---|---|
| Family ID | F050273 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MSYNLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKAEEEEE |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Archaea |
| % of genes with valid RBS motifs | 73.10 % |
| % of genes near scaffold ends (potentially truncated) | 15.17 % |
| % of genes from short scaffolds (< 2000 bps) | 66.90 % |
| Associated GOLD sequencing projects | 66 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Archaea (98.621 % of family members) |
| NCBI Taxonomy ID | 2157 |
| Taxonomy | All Organisms → cellular organisms → Archaea |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (48.276 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.517 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.345 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00270 | DEAD | 43.45 |
| PF00149 | Metallophos | 9.66 |
| PF00271 | Helicase_C | 8.97 |
| PF08494 | DEAD_assoc | 6.21 |
| PF01336 | tRNA_anti-codon | 3.45 |
| PF12850 | Metallophos_2 | 2.07 |
| PF07282 | OrfB_Zn_ribbon | 2.07 |
| PF07883 | Cupin_2 | 0.69 |
| PF14595 | Thioredoxin_9 | 0.69 |
| PF07617 | DUF1579 | 0.69 |
| PF00464 | SHMT | 0.69 |
| PF01545 | Cation_efflux | 0.69 |
| PF04138 | GtrA | 0.69 |
| PF01813 | ATP-synt_D | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG1201 | Lhr-like helicase | Replication, recombination and repair [L] | 6.21 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.69 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.69 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.69 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.69 |
| COG1394 | Archaeal/vacuolar-type H+-ATPase subunit D/Vma8 | Energy production and conversion [C] | 0.69 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002557|JGI25381J37097_1019426 | All Organisms → cellular organisms → Archaea | 1192 | Open in IMG/M |
| 3300002558|JGI25385J37094_10000398 | All Organisms → cellular organisms → Archaea | 11416 | Open in IMG/M |
| 3300002558|JGI25385J37094_10000445 | All Organisms → cellular organisms → Archaea | 10999 | Open in IMG/M |
| 3300002558|JGI25385J37094_10001199 | All Organisms → cellular organisms → Archaea | 8092 | Open in IMG/M |
| 3300002558|JGI25385J37094_10005550 | All Organisms → cellular organisms → Archaea | 4441 | Open in IMG/M |
| 3300002558|JGI25385J37094_10021551 | All Organisms → cellular organisms → Archaea | 2298 | Open in IMG/M |
| 3300002558|JGI25385J37094_10034621 | All Organisms → cellular organisms → Archaea | 1766 | Open in IMG/M |
| 3300002558|JGI25385J37094_10068048 | All Organisms → cellular organisms → Archaea | 1144 | Open in IMG/M |
| 3300002561|JGI25384J37096_10126506 | All Organisms → cellular organisms → Archaea | 849 | Open in IMG/M |
| 3300002562|JGI25382J37095_10044397 | All Organisms → cellular organisms → Archaea | 1725 | Open in IMG/M |
| 3300002562|JGI25382J37095_10067166 | All Organisms → cellular organisms → Archaea | 1344 | Open in IMG/M |
| 3300002908|JGI25382J43887_10046318 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia | 2365 | Open in IMG/M |
| 3300002912|JGI25386J43895_10004254 | All Organisms → cellular organisms → Archaea | 3846 | Open in IMG/M |
| 3300005166|Ga0066674_10134680 | All Organisms → cellular organisms → Archaea | 1161 | Open in IMG/M |
| 3300005167|Ga0066672_10363586 | All Organisms → cellular organisms → Archaea | 945 | Open in IMG/M |
| 3300005167|Ga0066672_10805598 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 590 | Open in IMG/M |
| 3300005172|Ga0066683_10130327 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1537 | Open in IMG/M |
| 3300005172|Ga0066683_10731700 | All Organisms → cellular organisms → Archaea | 583 | Open in IMG/M |
| 3300005176|Ga0066679_10018788 | All Organisms → cellular organisms → Archaea | 3621 | Open in IMG/M |
| 3300005176|Ga0066679_10785088 | All Organisms → cellular organisms → Archaea | 609 | Open in IMG/M |
| 3300005180|Ga0066685_10365806 | All Organisms → cellular organisms → Archaea | 1001 | Open in IMG/M |
| 3300005445|Ga0070708_100028516 | All Organisms → cellular organisms → Bacteria | 4804 | Open in IMG/M |
| 3300005446|Ga0066686_10615099 | All Organisms → cellular organisms → Archaea | 738 | Open in IMG/M |
| 3300005518|Ga0070699_100012681 | All Organisms → cellular organisms → Archaea | 7268 | Open in IMG/M |
| 3300005540|Ga0066697_10085666 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1823 | Open in IMG/M |
| 3300005540|Ga0066697_10513888 | All Organisms → cellular organisms → Archaea | 678 | Open in IMG/M |
| 3300005542|Ga0070732_10000425 | All Organisms → cellular organisms → Archaea | 27415 | Open in IMG/M |
| 3300005554|Ga0066661_10166265 | All Organisms → cellular organisms → Archaea | 1356 | Open in IMG/M |
| 3300005554|Ga0066661_10173204 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1329 | Open in IMG/M |
| 3300005555|Ga0066692_11003697 | All Organisms → cellular organisms → Archaea | 511 | Open in IMG/M |
| 3300005556|Ga0066707_10034978 | All Organisms → cellular organisms → Archaea | 2818 | Open in IMG/M |
| 3300005561|Ga0066699_10030772 | All Organisms → cellular organisms → Archaea | 3103 | Open in IMG/M |
| 3300005568|Ga0066703_10221686 | All Organisms → cellular organisms → Archaea | 1150 | Open in IMG/M |
| 3300005568|Ga0066703_10292152 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 987 | Open in IMG/M |
| 3300005586|Ga0066691_10437960 | All Organisms → cellular organisms → Archaea | 780 | Open in IMG/M |
| 3300006034|Ga0066656_10383888 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 908 | Open in IMG/M |
| 3300006034|Ga0066656_10593907 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 717 | Open in IMG/M |
| 3300006794|Ga0066658_10000014 | All Organisms → cellular organisms → Archaea | 56174 | Open in IMG/M |
| 3300006806|Ga0079220_10689754 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 748 | Open in IMG/M |
| 3300007255|Ga0099791_10073420 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1553 | Open in IMG/M |
| 3300007255|Ga0099791_10504111 | All Organisms → cellular organisms → Archaea | 588 | Open in IMG/M |
| 3300007255|Ga0099791_10659174 | All Organisms → cellular organisms → Archaea | 514 | Open in IMG/M |
| 3300007258|Ga0099793_10009149 | All Organisms → cellular organisms → Archaea | 3776 | Open in IMG/M |
| 3300007258|Ga0099793_10056827 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1741 | Open in IMG/M |
| 3300007258|Ga0099793_10266570 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 829 | Open in IMG/M |
| 3300007265|Ga0099794_10135651 | All Organisms → cellular organisms → Archaea | 1245 | Open in IMG/M |
| 3300007265|Ga0099794_10279677 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 863 | Open in IMG/M |
| 3300007265|Ga0099794_10484470 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 650 | Open in IMG/M |
| 3300007265|Ga0099794_10805306 | All Organisms → cellular organisms → Archaea | 502 | Open in IMG/M |
| 3300009012|Ga0066710_103429285 | All Organisms → cellular organisms → Archaea | 601 | Open in IMG/M |
| 3300009038|Ga0099829_10072067 | All Organisms → cellular organisms → Archaea | 2622 | Open in IMG/M |
| 3300009038|Ga0099829_10353712 | All Organisms → cellular organisms → Archaea | 1210 | Open in IMG/M |
| 3300009038|Ga0099829_10372682 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1177 | Open in IMG/M |
| 3300009038|Ga0099829_10553821 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 956 | Open in IMG/M |
| 3300009038|Ga0099829_11539517 | All Organisms → cellular organisms → Archaea | 549 | Open in IMG/M |
| 3300009088|Ga0099830_10378577 | All Organisms → Viruses → Predicted Viral | 1142 | Open in IMG/M |
| 3300009088|Ga0099830_10780766 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 788 | Open in IMG/M |
| 3300009088|Ga0099830_10946453 | All Organisms → cellular organisms → Archaea | 713 | Open in IMG/M |
| 3300009089|Ga0099828_10027146 | All Organisms → cellular organisms → Archaea | 4564 | Open in IMG/M |
| 3300009089|Ga0099828_11093468 | All Organisms → cellular organisms → Archaea | 709 | Open in IMG/M |
| 3300009090|Ga0099827_10009578 | All Organisms → cellular organisms → Archaea | 6159 | Open in IMG/M |
| 3300009090|Ga0099827_10131035 | All Organisms → cellular organisms → Archaea | 2031 | Open in IMG/M |
| 3300009090|Ga0099827_10380216 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1205 | Open in IMG/M |
| 3300009090|Ga0099827_11454494 | All Organisms → cellular organisms → Archaea | 596 | Open in IMG/M |
| 3300009090|Ga0099827_11961127 | All Organisms → cellular organisms → Archaea | 509 | Open in IMG/M |
| 3300010333|Ga0134080_10004874 | All Organisms → cellular organisms → Archaea | 4608 | Open in IMG/M |
| 3300010335|Ga0134063_10435655 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 648 | Open in IMG/M |
| 3300010336|Ga0134071_10453929 | All Organisms → cellular organisms → Archaea | 658 | Open in IMG/M |
| 3300011269|Ga0137392_10234023 | All Organisms → cellular organisms → Archaea | 1509 | Open in IMG/M |
| 3300011269|Ga0137392_11084658 | All Organisms → cellular organisms → Archaea | 657 | Open in IMG/M |
| 3300011270|Ga0137391_10125488 | All Organisms → cellular organisms → Archaea | 2229 | Open in IMG/M |
| 3300011270|Ga0137391_10298555 | All Organisms → cellular organisms → Archaea | 1390 | Open in IMG/M |
| 3300011270|Ga0137391_11157271 | All Organisms → cellular organisms → Archaea | 621 | Open in IMG/M |
| 3300011271|Ga0137393_11532620 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 556 | Open in IMG/M |
| 3300012096|Ga0137389_10409633 | All Organisms → cellular organisms → Archaea | 1158 | Open in IMG/M |
| 3300012189|Ga0137388_10806926 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 870 | Open in IMG/M |
| 3300012199|Ga0137383_10524710 | All Organisms → cellular organisms → Archaea | 867 | Open in IMG/M |
| 3300012199|Ga0137383_11211393 | All Organisms → cellular organisms → Archaea | 542 | Open in IMG/M |
| 3300012201|Ga0137365_10004292 | All Organisms → cellular organisms → Archaea | 11446 | Open in IMG/M |
| 3300012203|Ga0137399_10013679 | All Organisms → cellular organisms → Archaea | 5024 | Open in IMG/M |
| 3300012203|Ga0137399_10027419 | All Organisms → cellular organisms → Archaea | 3863 | Open in IMG/M |
| 3300012203|Ga0137399_10078760 | All Organisms → cellular organisms → Archaea | 2495 | Open in IMG/M |
| 3300012203|Ga0137399_10127894 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 2004 | Open in IMG/M |
| 3300012203|Ga0137399_11045139 | All Organisms → cellular organisms → Archaea | 688 | Open in IMG/M |
| 3300012206|Ga0137380_11310531 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 609 | Open in IMG/M |
| 3300012207|Ga0137381_11561690 | All Organisms → cellular organisms → Archaea | 551 | Open in IMG/M |
| 3300012210|Ga0137378_10968660 | All Organisms → cellular organisms → Archaea | 764 | Open in IMG/M |
| 3300012349|Ga0137387_10041928 | All Organisms → cellular organisms → Archaea | 3013 | Open in IMG/M |
| 3300012360|Ga0137375_10073484 | All Organisms → cellular organisms → Archaea | 3598 | Open in IMG/M |
| 3300012362|Ga0137361_10788147 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 865 | Open in IMG/M |
| 3300012363|Ga0137390_10699465 | All Organisms → cellular organisms → Archaea | 976 | Open in IMG/M |
| 3300012918|Ga0137396_10005526 | All Organisms → cellular organisms → Archaea | 7348 | Open in IMG/M |
| 3300012918|Ga0137396_10057742 | All Organisms → cellular organisms → Archaea | 2679 | Open in IMG/M |
| 3300012927|Ga0137416_10582554 | All Organisms → cellular organisms → Archaea | 973 | Open in IMG/M |
| 3300012977|Ga0134087_10241342 | All Organisms → cellular organisms → Archaea | 825 | Open in IMG/M |
| 3300012977|Ga0134087_10453906 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 635 | Open in IMG/M |
| 3300017654|Ga0134069_1131618 | All Organisms → cellular organisms → Archaea | 828 | Open in IMG/M |
| 3300018431|Ga0066655_10341468 | All Organisms → cellular organisms → Archaea | 981 | Open in IMG/M |
| 3300018431|Ga0066655_10868722 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 615 | Open in IMG/M |
| 3300018431|Ga0066655_11219053 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 534 | Open in IMG/M |
| 3300018468|Ga0066662_10035901 | All Organisms → cellular organisms → Archaea | 3007 | Open in IMG/M |
| 3300018468|Ga0066662_11764611 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 648 | Open in IMG/M |
| 3300021046|Ga0215015_10103201 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1992 | Open in IMG/M |
| 3300021046|Ga0215015_10256106 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1442 | Open in IMG/M |
| 3300021088|Ga0210404_10084526 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1570 | Open in IMG/M |
| 3300024330|Ga0137417_1070184 | All Organisms → cellular organisms → Archaea | 871 | Open in IMG/M |
| 3300026296|Ga0209235_1000392 | All Organisms → cellular organisms → Archaea | 21733 | Open in IMG/M |
| 3300026296|Ga0209235_1003305 | All Organisms → cellular organisms → Archaea | 8996 | Open in IMG/M |
| 3300026296|Ga0209235_1025703 | All Organisms → cellular organisms → Archaea | 3096 | Open in IMG/M |
| 3300026296|Ga0209235_1262609 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 530 | Open in IMG/M |
| 3300026297|Ga0209237_1188513 | All Organisms → cellular organisms → Archaea | 688 | Open in IMG/M |
| 3300026298|Ga0209236_1000502 | All Organisms → cellular organisms → Archaea | 22654 | Open in IMG/M |
| 3300026298|Ga0209236_1190700 | All Organisms → cellular organisms → Archaea | 790 | Open in IMG/M |
| 3300026309|Ga0209055_1024878 | All Organisms → cellular organisms → Archaea | 2818 | Open in IMG/M |
| 3300026309|Ga0209055_1195862 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 619 | Open in IMG/M |
| 3300026317|Ga0209154_1009962 | All Organisms → cellular organisms → Archaea | 4688 | Open in IMG/M |
| 3300026318|Ga0209471_1022859 | All Organisms → cellular organisms → Archaea | 3132 | Open in IMG/M |
| 3300026325|Ga0209152_10000093 | All Organisms → cellular organisms → Archaea | 44453 | Open in IMG/M |
| 3300026328|Ga0209802_1000724 | All Organisms → cellular organisms → Archaea | 25414 | Open in IMG/M |
| 3300026334|Ga0209377_1248465 | All Organisms → cellular organisms → Archaea | 585 | Open in IMG/M |
| 3300026342|Ga0209057_1016178 | All Organisms → cellular organisms → Archaea | 4367 | Open in IMG/M |
| 3300026469|Ga0257169_1074300 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 552 | Open in IMG/M |
| 3300026507|Ga0257165_1093291 | All Organisms → cellular organisms → Archaea | 557 | Open in IMG/M |
| 3300026538|Ga0209056_10025022 | All Organisms → cellular organisms → Archaea | 5752 | Open in IMG/M |
| 3300026548|Ga0209161_10003339 | All Organisms → cellular organisms → Archaea | 12966 | Open in IMG/M |
| 3300026551|Ga0209648_10383690 | All Organisms → cellular organisms → Archaea | 938 | Open in IMG/M |
| 3300027643|Ga0209076_1083613 | All Organisms → cellular organisms → Archaea | 907 | Open in IMG/M |
| 3300027655|Ga0209388_1038501 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 1377 | Open in IMG/M |
| 3300027671|Ga0209588_1037264 | All Organisms → cellular organisms → Archaea | 1565 | Open in IMG/M |
| 3300027748|Ga0209689_1018188 | All Organisms → cellular organisms → Archaea | 4412 | Open in IMG/M |
| 3300027846|Ga0209180_10189367 | All Organisms → cellular organisms → Archaea | 1187 | Open in IMG/M |
| 3300027846|Ga0209180_10548333 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 644 | Open in IMG/M |
| 3300027862|Ga0209701_10026627 | All Organisms → cellular organisms → Archaea | 3761 | Open in IMG/M |
| 3300027862|Ga0209701_10496303 | All Organisms → cellular organisms → Archaea | 664 | Open in IMG/M |
| 3300027862|Ga0209701_10710176 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 517 | Open in IMG/M |
| 3300027875|Ga0209283_10015654 | All Organisms → cellular organisms → Archaea | 4577 | Open in IMG/M |
| 3300027875|Ga0209283_10456067 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 827 | Open in IMG/M |
| 3300027875|Ga0209283_10497264 | All Organisms → cellular organisms → Archaea | 785 | Open in IMG/M |
| 3300027882|Ga0209590_10046544 | All Organisms → cellular organisms → Archaea | 2392 | Open in IMG/M |
| 3300027882|Ga0209590_10111259 | All Organisms → cellular organisms → Archaea | 1652 | Open in IMG/M |
| 3300027882|Ga0209590_10120865 | All Organisms → cellular organisms → Archaea | 1591 | Open in IMG/M |
| 3300027882|Ga0209590_10338799 | All Organisms → cellular organisms → Archaea | 968 | Open in IMG/M |
| 3300028536|Ga0137415_10014104 | All Organisms → cellular organisms → Archaea | 7934 | Open in IMG/M |
| 3300028536|Ga0137415_10226182 | All Organisms → cellular organisms → Archaea | 1684 | Open in IMG/M |
| 3300028536|Ga0137415_11115226 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 602 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 48.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 22.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 18.62% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.38% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25381J37097_10194262 | 3300002557 | Grasslands Soil | MSYSLQPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGESKKKVAEEEE* |
| JGI25385J37094_100003983 | 3300002558 | Grasslands Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGESKKKVEEEE* |
| JGI25385J37094_1000044510 | 3300002558 | Grasslands Soil | LSYSLPPDQGFALLQLLLYIFSFVSLILIFLYIAAERPGEAKKKTAEEEE* |
| JGI25385J37094_100011996 | 3300002558 | Grasslands Soil | MSYSLPPDQGYALLQLLLYIFSFVSLVLIFLYIAAERPGEAKKKAAEEEE* |
| JGI25385J37094_100055503 | 3300002558 | Grasslands Soil | MSYSLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKAAEEEE* |
| JGI25385J37094_100215512 | 3300002558 | Grasslands Soil | MSYSLDPNSEYALLQLLLYIFSFVTLILIFLYIASERPGEGKKKVEEEE* |
| JGI25385J37094_100346212 | 3300002558 | Grasslands Soil | MSYNLDPNSEYALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKKAEEEE* |
| JGI25385J37094_100680481 | 3300002558 | Grasslands Soil | MSYSLPPEQEFALLQLLLYIFSFATLVLIFLYIAAERPGEGKKKAEEEEE* |
| JGI25384J37096_101265062 | 3300002561 | Grasslands Soil | EMSYSLDPNSEYALLQLLLYIFSFVTLILIFLYIASERPGEGKKKVEEEE* |
| JGI25382J37095_100443972 | 3300002562 | Grasslands Soil | MSYSLPPDQEFALLQLLLYIFSFATLVLIFLYIAAERPGEGKKKAEEEE* |
| JGI25382J37095_100671663 | 3300002562 | Grasslands Soil | MSYNLDPNSEYALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKKAEEEEE* |
| JGI25382J43887_100463182 | 3300002908 | Grasslands Soil | MSYNLDPNSEYALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKXAEEEEE* |
| JGI25386J43895_100042544 | 3300002912 | Grasslands Soil | MSYNLDPNSEYALLQLLLYIFSFVTLVLIFLYVAAERPGEGKKKAEEEEE* |
| Ga0066674_101346802 | 3300005166 | Soil | MSYSLQPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE* |
| Ga0066672_103635862 | 3300005167 | Soil | MSYSLDQNSEYALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKKAEEEEE* |
| Ga0066672_108055982 | 3300005167 | Soil | MSYNLDPNSEYALLQLLLYIFSFATLVLIFLYIAAERPGEGKKKAEEEEE* |
| Ga0066683_101303271 | 3300005172 | Soil | MSYSLPPDTEYSLLQLILYIFSFVTLVLIFFYIASERPGEKRKKEEE |
| Ga0066683_107317001 | 3300005172 | Soil | MSYSLLPEQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKAEEEEE* |
| Ga0066679_100187882 | 3300005176 | Soil | MSYNLDPNQEFALLQLLLYILSFVSLILIFLYIAAERPGEAKKKAAEEEE* |
| Ga0066679_107850882 | 3300005176 | Soil | VSYSLDQNSEYALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKKAEEEEE* |
| Ga0066685_103658062 | 3300005180 | Soil | MSYSLPPDTEYSLLQLILYVFSFVTLVLIFFYIASERPGEKKKKEEEED* |
| Ga0070708_1000285168 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYSLPPDQEYALLQLLLYIFSFVSLILIFLYIAAERPGEAKKKAAEEEE* |
| Ga0066686_106150992 | 3300005446 | Soil | MSYSLDPNSEYALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE* |
| Ga0070699_1000126812 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSYSLPPDQEFALLQLLLYIFSFISLILIFLYIAAERPGEAKKKAAEEEE* |
| Ga0066697_100856662 | 3300005540 | Soil | MSYSLAPEQEFALLQLLLYIFSFVTLIMIFLYIAAERPGEGKKKVEEEE* |
| Ga0066697_105138882 | 3300005540 | Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEEE* |
| Ga0070732_1000042518 | 3300005542 | Surface Soil | VSYGLSPDSEYSLLQLLLYIFSFVAIILIFFYIASERPAEKKKKDEED* |
| Ga0066661_101662652 | 3300005554 | Soil | PDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE* |
| Ga0066661_101732042 | 3300005554 | Soil | MSYNLLPDQEFALLQLLLYIFGFVTLIMIFLYIAAERPGEGKKKVEEEEE* |
| Ga0066692_110036971 | 3300005555 | Soil | MSYNLDPNSEYALLQLLLYIFSFATLVLIFLYIAAERPGEGKKKAEEEE* |
| Ga0066707_100349785 | 3300005556 | Soil | MSYSLPSDQEFALLQLLLYIFSFVALILIFLYIAAERPGEGKKKAAEEEE* |
| Ga0066699_100307722 | 3300005561 | Soil | MSYSLLPDQEFALLQLLLYIFSFVTLIMIFLYIAAERPGEGKKKVEEEEE* |
| Ga0066703_102216861 | 3300005568 | Soil | DMSYNLDPNSEYALLQLLLYIFSFATLVLIFLYIAAERPGEGKKKAEEEEE* |
| Ga0066703_102921523 | 3300005568 | Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE* |
| Ga0066691_104379602 | 3300005586 | Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGESKKKAVEEEE* |
| Ga0066656_103838882 | 3300006034 | Soil | MSYSLQPEQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE* |
| Ga0066656_105939071 | 3300006034 | Soil | MSYSLQPDQEFALLQLLLYIFSFVTLILIFLYIAAERP |
| Ga0066658_1000001438 | 3300006794 | Soil | MSYNLLPDQEFALLQLLLYIFSFVTLIMIFLYIAAERPGEGKKKVEEEEE* |
| Ga0079220_106897542 | 3300006806 | Agricultural Soil | MSYNLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEAKKKSEEEE* |
| Ga0099791_100734202 | 3300007255 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVTLILIFLYIAAERPGEAKKKAAEEEE* |
| Ga0099791_105041112 | 3300007255 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEAKKKAEEEE* |
| Ga0099791_106591741 | 3300007255 | Vadose Zone Soil | GFRERTGQADMSYNLPTDQQYALLQLLLYIFSFVSLILIFLYIAAERPGEGKKKAAEEEE |
| Ga0099793_100091492 | 3300007258 | Vadose Zone Soil | MSYNLDPNQEFALLQLLLYIFSFVSLILIFLYIAAERPGEAKKKAAEEEE* |
| Ga0099793_100568272 | 3300007258 | Vadose Zone Soil | MSYSLPPDQGYALLQLLLYIFSFVSLVLIFLYIAAERPGEAKKKVEEEEE* |
| Ga0099793_102665701 | 3300007258 | Vadose Zone Soil | MSYNLDPNQEFALLQLLLYIFSFVALILIFLYIAAERPGEGKKKAAEEEE* |
| Ga0099794_101356512 | 3300007265 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKAEEEE* |
| Ga0099794_102796772 | 3300007265 | Vadose Zone Soil | MSYNLQPDQQYALIQLLLYIFSFLALILIFLYIAAERPGESKKKVEEEE* |
| Ga0099794_104844702 | 3300007265 | Vadose Zone Soil | MSYSLPPDQEFALLQLILYIFSFVSLILIFLYIAAERPGEAKKKVEEEEE* |
| Ga0099794_108053061 | 3300007265 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFVTLVLIFLYIAAERPGEAKKKAEEEEE* |
| Ga0066710_1034292851 | 3300009012 | Grasslands Soil | EPADMSYSLQPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGESKKKVAEEEE |
| Ga0099829_100720672 | 3300009038 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFATLILIFLYIAAERPGEAKKKAAEEEE* |
| Ga0099829_103537122 | 3300009038 | Vadose Zone Soil | MSYNLQPDQQFALLQLLLYIFSFLTLILIFLYIAAERPGESKKKVEEEEE* |
| Ga0099829_103726823 | 3300009038 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKAEEEEE* |
| Ga0099829_105538213 | 3300009038 | Vadose Zone Soil | VSYNPSPDAQFQILQLILYIFSFVALILIFLYIAAERPGETKKKEEEEE* |
| Ga0099829_115395171 | 3300009038 | Vadose Zone Soil | MSYSLPADQEFALLQLLLYIFSFVSLILIFLYIAAERPGEAKKKAAEEEE* |
| Ga0099830_103785772 | 3300009088 | Vadose Zone Soil | DQEFALLQLLLYIFSFATLILIFLYIAAERPGEGQKKAAEEEE* |
| Ga0099830_107807662 | 3300009088 | Vadose Zone Soil | VSYNPSPDTQFQILQLILYIFSFVALIHIFLYIAAERPGETKKKEEEEEE* |
| Ga0099830_109464532 | 3300009088 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVSLILIFLYIAAERPGEARKKAAEEEE* |
| Ga0099828_100271463 | 3300009089 | Vadose Zone Soil | VSYNPSPDTQFQILQLILYIFSFVALILIFLYIAAERPGETKKKEEEEE* |
| Ga0099828_110934682 | 3300009089 | Vadose Zone Soil | MSYSLPPDQGYALLQLLLYIFSFVSLILIFLYIAAERPGEGKKKPAEEEE* |
| Ga0099827_100095783 | 3300009090 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVSLILIFLYIAAERPGEGKKKAAEEEE* |
| Ga0099827_101310352 | 3300009090 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKKAEEEEE* |
| Ga0099827_103802162 | 3300009090 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKAAEEEE* |
| Ga0099827_114544942 | 3300009090 | Vadose Zone Soil | MSYNLQPDQQYALIQLLLYIFSFLTLILIFLYIAAERPGESKKKVEEEEE* |
| Ga0099827_119611272 | 3300009090 | Vadose Zone Soil | MSYSLPADQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKAEEEEEE* |
| Ga0134080_100048743 | 3300010333 | Grasslands Soil | MSYSLLPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE* |
| Ga0134063_104356551 | 3300010335 | Grasslands Soil | MSYTLQPHQEFALLELLLYILSFVTLILIFLYIAAERPGESKKKV |
| Ga0134071_104539292 | 3300010336 | Grasslands Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEAKKKVEEEEE* |
| Ga0137392_102340232 | 3300011269 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVSLILIFLYIAAERPREGRKKAAEEEE* |
| Ga0137392_110846582 | 3300011269 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKAVEEEE* |
| Ga0137391_101254882 | 3300011270 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEAKKKAAEEEE* |
| Ga0137391_102985552 | 3300011270 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFATLVLIFLYIAAERPGEGKKKAEEEEE* |
| Ga0137391_111572711 | 3300011270 | Vadose Zone Soil | ADMSYSLPPDQGYALLQLLLYIFSFVSLILIFLYIAAERPGEAKKKAVEEEEE* |
| Ga0137393_115326201 | 3300011271 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVSLILIFLYIAAERPGEGKKKAAEE |
| Ga0137389_104096332 | 3300012096 | Vadose Zone Soil | MSYNLQPDQEYALLQLLLYIFSFVTLILIFLYIAAERPGESKKKVEEEEE* |
| Ga0137388_108069261 | 3300012189 | Vadose Zone Soil | MSYNLQPDQEYALLQLLLYIFSFLTLILIFLYIAAERPGESKKKVEEEEE* |
| Ga0137383_105247102 | 3300012199 | Vadose Zone Soil | MSYNLDPNQEFALLQLLLYIFSFATLILIFLYIAAERPGEAKKKAAEEEE* |
| Ga0137383_112113932 | 3300012199 | Vadose Zone Soil | MSYNLDPNQEFALLQLLLYIFSFVTLILIFLYIAAERPGEAKKKAAEEEE* |
| Ga0137365_1000429210 | 3300012201 | Vadose Zone Soil | MSYSLPSDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEAKKKVEEEEE* |
| Ga0137399_100136792 | 3300012203 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVSLILIFLYIAAERPGEGRKKAEEEEE* |
| Ga0137399_100274192 | 3300012203 | Vadose Zone Soil | MSYNLQPDQQFALLQLLLYIFSFVTLILIFLYIAAERPGESKKKVEEEEE* |
| Ga0137399_100787603 | 3300012203 | Vadose Zone Soil | MSYSLPPDQEFALIQLLLYIFSFVCLILIFLYIAAERPGEARKKAEEEEE* |
| Ga0137399_101278943 | 3300012203 | Vadose Zone Soil | LSYSLPPDQEFALLQLLLYIFSFVSLILIFLYIAAERPGEAKKKTPEEEE* |
| Ga0137399_110451392 | 3300012203 | Vadose Zone Soil | MSYNLDPNQEFALLQLLLYIFSFVTLIMIFLYIAAERPGESRKKVEEEEE* |
| Ga0137380_113105311 | 3300012206 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVTLILIFLYIAAERPGEAKKKAAE |
| Ga0137381_115616901 | 3300012207 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVTLVLIFLYIAAERPGEAKKKAVEEEE* |
| Ga0137378_109686601 | 3300012210 | Vadose Zone Soil | QEFALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKKAEEEE* |
| Ga0137387_100419282 | 3300012349 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGESKKKVAEEEE* |
| Ga0137375_100734844 | 3300012360 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPG* |
| Ga0137361_107881472 | 3300012362 | Vadose Zone Soil | MSYNLDPNQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGRKKAAEEEE* |
| Ga0137390_106994652 | 3300012363 | Vadose Zone Soil | MSYNLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKAVEEEE* |
| Ga0137396_100055268 | 3300012918 | Vadose Zone Soil | LSYNLPPDQEFALLQLLLYIFSFVALILIFLYIAAERPGEAKKKVEEEEE* |
| Ga0137396_100577424 | 3300012918 | Vadose Zone Soil | MSYSLPPDQEFALIQLLLYIFSFVCLILIFLYIAGEGPGEARKKAEEEEEYIVLADD* |
| Ga0137416_105825543 | 3300012927 | Vadose Zone Soil | MSYSLPPDQGYALLQLLLYIFSFATLVLIFLYIAAERPGESKKKAAEEEE* |
| Ga0134087_102413422 | 3300012977 | Grasslands Soil | YSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE* |
| Ga0134087_104539062 | 3300012977 | Grasslands Soil | MSYSLQPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVE |
| Ga0134069_11316182 | 3300017654 | Grasslands Soil | MSYSLLPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE |
| Ga0066655_103414682 | 3300018431 | Grasslands Soil | MSYSLDPNSEYALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE |
| Ga0066655_108687222 | 3300018431 | Grasslands Soil | MSYSLPPDTEYSLLQLILYIFSFVTLVLIFFYIASERPGEKRKKEEEE |
| Ga0066655_112190532 | 3300018431 | Grasslands Soil | MSYSLQPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGESKKKVAEEEE |
| Ga0066662_100359013 | 3300018468 | Grasslands Soil | MSYNLDPNSEYALLQLLLYIFSFVTLVLIFLYVAAERPGEGKKKAEEEEE |
| Ga0066662_117646112 | 3300018468 | Grasslands Soil | MSYSLPPEQEFALLQLLLYIFSFATLVLIFLYIAAERPGEGKKKAEEEEE |
| Ga0215015_101032012 | 3300021046 | Soil | MSYNLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKAEEEEE |
| Ga0215015_102561063 | 3300021046 | Soil | VSYNLQPDQQYALLQLLLYIFSFVSMILIFLYIAAERPGESKKKAEEEEE |
| Ga0210404_100845261 | 3300021088 | Soil | MSYNLDPNQEFALLQLLLYIFSFVSLILIFLYIAAER |
| Ga0137417_10701842 | 3300024330 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKAVEEEE |
| Ga0209235_100039220 | 3300026296 | Grasslands Soil | MSYSLPPDQGYALLQLLLYIFSFVSLVLIFLYIAAERPGEAKKKAAEEEE |
| Ga0209235_10033056 | 3300026296 | Grasslands Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGESKKKVEEEE |
| Ga0209235_10257032 | 3300026296 | Grasslands Soil | MSYNLDPNSEYALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKKAEEEE |
| Ga0209235_12626091 | 3300026296 | Grasslands Soil | MSYSLDPNSEYALLQLLLYIFSFVTLILIFLYIASERPGEGKKKV |
| Ga0209237_11885131 | 3300026297 | Grasslands Soil | MSYSLPPDQEFALLQLLLYIFSFATLVLIFLYIAAERPGEGKKKAEEEE |
| Ga0209236_100050218 | 3300026298 | Grasslands Soil | LSYSLPPDQGFALLQLLLYIFSFVSLILIFLYIAAERPGEAKKKTAEEEE |
| Ga0209236_11907002 | 3300026298 | Grasslands Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEAKKKVEEEEE |
| Ga0209055_10248782 | 3300026309 | Soil | MSYSLQPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE |
| Ga0209055_11958621 | 3300026309 | Soil | MSYNLLPDQEFALLQLLLYIFSFVTLIMIFLYIAAERPGEG |
| Ga0209154_10099623 | 3300026317 | Soil | MSYSLDQNSEYALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKKAEEEEE |
| Ga0209471_10228592 | 3300026318 | Soil | MSYNLDPNQEFALLQLLLYILSFVSLILIFLYIAAERPGEAKKKAAEEEE |
| Ga0209152_1000009323 | 3300026325 | Soil | MSYNLLPDQEFALLQLLLYIFSFVTLIMIFLYIAAERPGEGKKKVEEEEE |
| Ga0209802_100072423 | 3300026328 | Soil | MSYNLDPNSEYALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKKAEEEEE |
| Ga0209377_12484652 | 3300026334 | Soil | MSYNLDPNSEYALLQLLLYIFSFATLVLIFLYIAAERPGEGKKKAEEEE |
| Ga0209057_10161782 | 3300026342 | Soil | MSYSLQPEQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKVEEEE |
| Ga0257169_10743002 | 3300026469 | Soil | MSYNLPTDQQYALLQLLLYIFSFVSLILIFLYIAAERPGE |
| Ga0257165_10932911 | 3300026507 | Soil | MSYSLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEAKKKAEEEE |
| Ga0209056_100250224 | 3300026538 | Soil | MSYSLPPDTEYSLLQLILYIFSFVTLVLIFFYIASERPGEKRKKEEEED |
| Ga0209161_100033392 | 3300026548 | Soil | MSYSLPSDQEFALLQLLLYIFSFVALILIFLYIAAERPGEGKKKAAEEEE |
| Ga0209648_103836902 | 3300026551 | Grasslands Soil | MSYSLPSDQEFALLQLLLYIFSFVALIMIFLYIAAERPGEAKKKAAEEEE |
| Ga0209076_10836132 | 3300027643 | Vadose Zone Soil | MSYNLDPNQEFALLQLLLYIFSFVALILIFLYIAAERPGEGKKKAAEEEE |
| Ga0209388_10385012 | 3300027655 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVTLILIFLYIAAERPGEAKKKAAEEEE |
| Ga0209588_10372643 | 3300027671 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKAEEEE |
| Ga0209689_10181886 | 3300027748 | Soil | MSYNLDPNSEYALLQLLLYIFSFATLVLIFLYIAAERPGEGKKKA |
| Ga0209180_101893673 | 3300027846 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKAEEEEE |
| Ga0209180_105483331 | 3300027846 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFATLILIFLYIAAERPGEAKKKAAEEEE |
| Ga0209701_100266272 | 3300027862 | Vadose Zone Soil | VSYNPSPDAQFQILQLILYIFSFVALILIFLYIAAERPGETKKKEEEEE |
| Ga0209701_104963032 | 3300027862 | Vadose Zone Soil | MSYNLQPDQQFALLQLLLYIFSFLTLILIFLYIAAERPGESKKKVEEEEE |
| Ga0209701_107101762 | 3300027862 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKA |
| Ga0209283_100156545 | 3300027875 | Vadose Zone Soil | MSYSLPADQEFALLQLLLYIFSFATLILIFLYIAAERPGEGKKKAEEEEEE |
| Ga0209283_104560672 | 3300027875 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFVTLVLIFLYIAAERPGEAKKKAEEEEE |
| Ga0209283_104972642 | 3300027875 | Vadose Zone Soil | MSYSLPPDQEYALLQLLLYIFSFVSLILIFLYIAAERPGEAKKKAAEEEE |
| Ga0209590_100465442 | 3300027882 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVSLILIFLYIAAERPGEGKKKAAEEEE |
| Ga0209590_101112592 | 3300027882 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFVTLVLIFLYIAAERPGEGKKKAEEEEE |
| Ga0209590_101208653 | 3300027882 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKAAEEEE |
| Ga0209590_103387992 | 3300027882 | Vadose Zone Soil | MSYSLPPDQEFALLQLLLYIFSFITLILIFLYIAAERPGEGKKKAEEEEE |
| Ga0137415_100141042 | 3300028536 | Vadose Zone Soil | MSYNLPTDQQYALLQLLLYIFSFVTLILIFLYIAAERPGEGKKKAAEEEE |
| Ga0137415_102261823 | 3300028536 | Vadose Zone Soil | MSYSLPPDQEFALIQLLLYIFSFVCLILIFLYIAAERPGEARKKAEEEEE |
| Ga0137415_111152262 | 3300028536 | Vadose Zone Soil | MSYNLDPNQEFALLQLLLYIFSFVSLILIFLYIAAERPGEAKKKAAEEEE |
| ⦗Top⦘ |