| Basic Information | |
|---|---|
| Family ID | F050261 |
| Family Type | Metagenome |
| Number of Sequences | 145 |
| Average Sequence Length | 42 residues |
| Representative Sequence | AMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHTRLIVSDE |
| Number of Associated Samples | 125 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.21 % |
| % of genes near scaffold ends (potentially truncated) | 92.41 % |
| % of genes from short scaffolds (< 2000 bps) | 86.21 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.310 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (17.931 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.448 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.897 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 2.94% Coil/Unstructured: 92.65% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF01266 | DAO | 62.76 |
| PF08352 | oligo_HPY | 6.21 |
| PF04392 | ABC_sub_bind | 2.76 |
| PF00496 | SBP_bac_5 | 2.07 |
| PF13229 | Beta_helix | 1.38 |
| PF02515 | CoA_transf_3 | 0.69 |
| PF13419 | HAD_2 | 0.69 |
| PF08240 | ADH_N | 0.69 |
| PF13649 | Methyltransf_25 | 0.69 |
| PF00528 | BPD_transp_1 | 0.69 |
| PF09335 | SNARE_assoc | 0.69 |
| PF01494 | FAD_binding_3 | 0.69 |
| PF04324 | Fer2_BFD | 0.69 |
| PF02615 | Ldh_2 | 0.69 |
| PF07992 | Pyr_redox_2 | 0.69 |
| PF03060 | NMO | 0.69 |
| PF13660 | DUF4147 | 0.69 |
| PF05598 | DUF772 | 0.69 |
| PF00583 | Acetyltransf_1 | 0.69 |
| PF00534 | Glycos_transf_1 | 0.69 |
| PF00497 | SBP_bac_3 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 2.76 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.38 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.69 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.69 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.69 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.69 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.69 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.69 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.69 |
| COG2055 | Malate/lactate/ureidoglycolate dehydrogenase, LDH2 family | Energy production and conversion [C] | 0.69 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.31 % |
| Unclassified | root | N/A | 0.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000559|F14TC_101430445 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300002908|JGI25382J43887_10169330 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300004463|Ga0063356_105377985 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005174|Ga0066680_10490180 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005178|Ga0066688_10185585 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300005295|Ga0065707_10024869 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300005330|Ga0070690_100651688 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300005332|Ga0066388_101084723 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300005445|Ga0070708_100263383 | All Organisms → cellular organisms → Bacteria | 1621 | Open in IMG/M |
| 3300005447|Ga0066689_10146098 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1403 | Open in IMG/M |
| 3300005447|Ga0066689_10778642 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
| 3300005459|Ga0068867_101954966 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300005471|Ga0070698_100311678 | All Organisms → cellular organisms → Bacteria | 1504 | Open in IMG/M |
| 3300005547|Ga0070693_101603653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia oxyphila | 511 | Open in IMG/M |
| 3300005552|Ga0066701_10621898 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 655 | Open in IMG/M |
| 3300005556|Ga0066707_10514497 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 776 | Open in IMG/M |
| 3300005558|Ga0066698_10000840 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 12513 | Open in IMG/M |
| 3300005558|Ga0066698_11094510 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300005559|Ga0066700_10598206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 769 | Open in IMG/M |
| 3300005576|Ga0066708_10758415 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300005598|Ga0066706_11052521 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 624 | Open in IMG/M |
| 3300005713|Ga0066905_101055270 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300005764|Ga0066903_102417339 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300005764|Ga0066903_103913664 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300006032|Ga0066696_10674795 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300006034|Ga0066656_10354908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 947 | Open in IMG/M |
| 3300006049|Ga0075417_10111102 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1251 | Open in IMG/M |
| 3300006796|Ga0066665_10084604 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
| 3300006844|Ga0075428_100007972 | All Organisms → cellular organisms → Bacteria | 11748 | Open in IMG/M |
| 3300006844|Ga0075428_100589278 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300006846|Ga0075430_100280928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1377 | Open in IMG/M |
| 3300006847|Ga0075431_101290764 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300006852|Ga0075433_10414689 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300006852|Ga0075433_11960472 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
| 3300006854|Ga0075425_100132844 | All Organisms → cellular organisms → Bacteria | 2846 | Open in IMG/M |
| 3300006854|Ga0075425_101006753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 951 | Open in IMG/M |
| 3300006871|Ga0075434_100016829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7034 | Open in IMG/M |
| 3300006880|Ga0075429_100251094 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300006903|Ga0075426_10403727 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300006904|Ga0075424_102625235 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
| 3300006914|Ga0075436_100630549 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300006914|Ga0075436_101087877 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006954|Ga0079219_11057376 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300007076|Ga0075435_101543011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 582 | Open in IMG/M |
| 3300009012|Ga0066710_100286472 | All Organisms → cellular organisms → Bacteria | 2405 | Open in IMG/M |
| 3300009012|Ga0066710_100604509 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1664 | Open in IMG/M |
| 3300009089|Ga0099828_10549444 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1041 | Open in IMG/M |
| 3300009090|Ga0099827_10089555 | All Organisms → cellular organisms → Bacteria | 2423 | Open in IMG/M |
| 3300009137|Ga0066709_100101799 | All Organisms → cellular organisms → Bacteria | 3522 | Open in IMG/M |
| 3300009147|Ga0114129_10470448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1646 | Open in IMG/M |
| 3300009148|Ga0105243_11857434 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 634 | Open in IMG/M |
| 3300009177|Ga0105248_10616361 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1224 | Open in IMG/M |
| 3300009553|Ga0105249_11688746 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 706 | Open in IMG/M |
| 3300009792|Ga0126374_10126031 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300009792|Ga0126374_10438420 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 924 | Open in IMG/M |
| 3300009792|Ga0126374_11380958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 573 | Open in IMG/M |
| 3300010046|Ga0126384_10206653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1558 | Open in IMG/M |
| 3300010046|Ga0126384_10816988 | Not Available | 836 | Open in IMG/M |
| 3300010047|Ga0126382_11997278 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 552 | Open in IMG/M |
| 3300010303|Ga0134082_10009497 | All Organisms → cellular organisms → Bacteria | 3495 | Open in IMG/M |
| 3300010336|Ga0134071_10504493 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 625 | Open in IMG/M |
| 3300010358|Ga0126370_11298576 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 682 | Open in IMG/M |
| 3300010358|Ga0126370_12366900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 527 | Open in IMG/M |
| 3300010359|Ga0126376_10671746 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300010359|Ga0126376_11952162 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300010360|Ga0126372_11417812 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 728 | Open in IMG/M |
| 3300010362|Ga0126377_10227381 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1803 | Open in IMG/M |
| 3300010366|Ga0126379_12734416 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
| 3300010376|Ga0126381_101816640 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 880 | Open in IMG/M |
| 3300010398|Ga0126383_10139877 | All Organisms → cellular organisms → Bacteria | 2240 | Open in IMG/M |
| 3300010399|Ga0134127_11972367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 661 | Open in IMG/M |
| 3300010399|Ga0134127_12079041 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 646 | Open in IMG/M |
| 3300010401|Ga0134121_11022860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 813 | Open in IMG/M |
| 3300010403|Ga0134123_11690028 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 683 | Open in IMG/M |
| 3300012199|Ga0137383_10322231 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1132 | Open in IMG/M |
| 3300012200|Ga0137382_10691530 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 731 | Open in IMG/M |
| 3300012203|Ga0137399_10457565 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1068 | Open in IMG/M |
| 3300012208|Ga0137376_10412128 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1173 | Open in IMG/M |
| 3300012210|Ga0137378_11491908 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
| 3300012582|Ga0137358_10653005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 704 | Open in IMG/M |
| 3300012930|Ga0137407_10544723 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1086 | Open in IMG/M |
| 3300012944|Ga0137410_10145714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1799 | Open in IMG/M |
| 3300012944|Ga0137410_11669536 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 560 | Open in IMG/M |
| 3300012948|Ga0126375_11107418 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300014154|Ga0134075_10001938 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7235 | Open in IMG/M |
| 3300014166|Ga0134079_10054113 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1421 | Open in IMG/M |
| 3300015053|Ga0137405_1211686 | All Organisms → cellular organisms → Bacteria | 3099 | Open in IMG/M |
| 3300015371|Ga0132258_11076928 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2032 | Open in IMG/M |
| 3300015371|Ga0132258_12627830 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1257 | Open in IMG/M |
| 3300015374|Ga0132255_100808529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1398 | Open in IMG/M |
| 3300016319|Ga0182033_11124517 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 702 | Open in IMG/M |
| 3300016445|Ga0182038_10833523 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 810 | Open in IMG/M |
| 3300018061|Ga0184619_10288753 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 752 | Open in IMG/M |
| 3300018429|Ga0190272_12085709 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300020170|Ga0179594_10140249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 890 | Open in IMG/M |
| 3300020170|Ga0179594_10150909 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 859 | Open in IMG/M |
| 3300021560|Ga0126371_10925779 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1015 | Open in IMG/M |
| 3300025899|Ga0207642_10341699 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 880 | Open in IMG/M |
| 3300025922|Ga0207646_10963445 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 755 | Open in IMG/M |
| 3300025922|Ga0207646_11848945 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 515 | Open in IMG/M |
| 3300025930|Ga0207701_11697104 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 505 | Open in IMG/M |
| 3300025931|Ga0207644_11657939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 536 | Open in IMG/M |
| 3300025935|Ga0207709_11188499 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 628 | Open in IMG/M |
| 3300025941|Ga0207711_10052720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium | 3487 | Open in IMG/M |
| 3300026095|Ga0207676_12388996 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
| 3300026309|Ga0209055_1061104 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1594 | Open in IMG/M |
| 3300026315|Ga0209686_1006936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 4881 | Open in IMG/M |
| 3300026323|Ga0209472_1266958 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 546 | Open in IMG/M |
| 3300026324|Ga0209470_1334067 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
| 3300026332|Ga0209803_1071356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1472 | Open in IMG/M |
| 3300026334|Ga0209377_1237155 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300026342|Ga0209057_1195015 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
| 3300026529|Ga0209806_1031473 | All Organisms → cellular organisms → Bacteria | 2632 | Open in IMG/M |
| 3300026530|Ga0209807_1245269 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300026548|Ga0209161_10408729 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 596 | Open in IMG/M |
| 3300026552|Ga0209577_10632918 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300027654|Ga0209799_1059717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 855 | Open in IMG/M |
| 3300027655|Ga0209388_1061304 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1085 | Open in IMG/M |
| 3300027748|Ga0209689_1248543 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 731 | Open in IMG/M |
| 3300027748|Ga0209689_1345342 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 569 | Open in IMG/M |
| 3300027862|Ga0209701_10025634 | All Organisms → cellular organisms → Bacteria | 3833 | Open in IMG/M |
| 3300027873|Ga0209814_10019853 | All Organisms → cellular organisms → Bacteria | 2719 | Open in IMG/M |
| 3300028711|Ga0307293_10230988 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
| 3300028791|Ga0307290_10385392 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 513 | Open in IMG/M |
| 3300028807|Ga0307305_10409458 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 612 | Open in IMG/M |
| 3300031544|Ga0318534_10675955 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 584 | Open in IMG/M |
| 3300031561|Ga0318528_10044351 | All Organisms → cellular organisms → Bacteria | 2234 | Open in IMG/M |
| 3300031681|Ga0318572_10572906 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
| 3300031720|Ga0307469_10528555 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1040 | Open in IMG/M |
| 3300031724|Ga0318500_10695075 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 518 | Open in IMG/M |
| 3300031751|Ga0318494_10536539 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 683 | Open in IMG/M |
| 3300031771|Ga0318546_10227762 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1279 | Open in IMG/M |
| 3300031793|Ga0318548_10323177 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 758 | Open in IMG/M |
| 3300031819|Ga0318568_10655568 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 653 | Open in IMG/M |
| 3300031831|Ga0318564_10068861 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1557 | Open in IMG/M |
| 3300031835|Ga0318517_10135201 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1097 | Open in IMG/M |
| 3300031860|Ga0318495_10006194 | All Organisms → cellular organisms → Bacteria | 4766 | Open in IMG/M |
| 3300031945|Ga0310913_10259500 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1222 | Open in IMG/M |
| 3300032044|Ga0318558_10133573 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1185 | Open in IMG/M |
| 3300032067|Ga0318524_10125800 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300032068|Ga0318553_10165270 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1149 | Open in IMG/M |
| 3300032091|Ga0318577_10074773 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1558 | Open in IMG/M |
| 3300032174|Ga0307470_10773932 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 740 | Open in IMG/M |
| 3300032180|Ga0307471_103696818 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 541 | Open in IMG/M |
| 3300032180|Ga0307471_103963986 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 523 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.93% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.72% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.45% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.76% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.76% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.07% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.38% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| F14TC_1014304453 | 3300000559 | Soil | WVSWFGIPTQFSPHWEAGMAIDEPTAHTRLIMSDE* |
| JGI25382J43887_101693302 | 3300002908 | Grasslands Soil | LWPADEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIMSEE* |
| Ga0063356_1053779851 | 3300004463 | Arabidopsis Thaliana Rhizosphere | AAMREDWVSWFGIPTQFSPHWTAGMVVDEPTAHARLIVSEE* |
| Ga0066680_104901801 | 3300005174 | Soil | VLWPADEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLILSDE* |
| Ga0066688_101855852 | 3300005178 | Soil | DEPPAMRGDWVSWFGIPTQFSPHWEAGMVIDEPTAHGRLILSDE* |
| Ga0065707_100248691 | 3300005295 | Switchgrass Rhizosphere | PAMREEWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE* |
| Ga0070690_1006516881 | 3300005330 | Switchgrass Rhizosphere | PADEPPAMREDWVSWFGIATQFSPHWEGPPIDEPTYHTRLVGE* |
| Ga0066388_1010847232 | 3300005332 | Tropical Forest Soil | PLPLNVLWPADEPPAMREHWVGWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE* |
| Ga0070708_1002633831 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EPPAMRGDWVSWFGIPTQFSPHWEAGMAIDEPTAHGRLILSDE* |
| Ga0066689_101460982 | 3300005447 | Soil | MRGDWVSWFGIPTQFSPHWEAGMAMDEPTAHGRLIMSDE* |
| Ga0066689_107786422 | 3300005447 | Soil | DEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIMSDE* |
| Ga0068867_1019549661 | 3300005459 | Miscanthus Rhizosphere | PLNVLWPTDEPPAMREHWVSWFGIPTQFSPHWEAGMAVAEPTAQTPLILSDE* |
| Ga0070698_1003116782 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLILRDE* |
| Ga0070693_1016036531 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MREEWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE* |
| Ga0066701_106218982 | 3300005552 | Soil | REEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIMSDE* |
| Ga0066707_105144971 | 3300005556 | Soil | MREDWVSWFGIPTQFSPHWTAGMAVDEPTAHARLILSEE* |
| Ga0066698_1000084015 | 3300005558 | Soil | AAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIVSE* |
| Ga0066698_110945102 | 3300005558 | Soil | WVSWFGIPTQFSPHWEAGMAVAEPTAQAPLILSDE* |
| Ga0066700_105982061 | 3300005559 | Soil | DEPAAMREDWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE* |
| Ga0066708_107584152 | 3300005576 | Soil | NVLWPADEPAAMREDWVSWFGIPTQFSPHWTAGMAVDEPTAHARLILSEE* |
| Ga0066706_110525212 | 3300005598 | Soil | MRGDWVSWFGIPTQFSPHWEAGMAVDEPTAHGRLIMSDE* |
| Ga0066905_1010552702 | 3300005713 | Tropical Forest Soil | ADEPPAMREHWVGWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE* |
| Ga0066903_1024173391 | 3300005764 | Tropical Forest Soil | AMREDWVSWFGIPTQFSPHWDGAPIDEPTAHARLVGE* |
| Ga0066903_1039136643 | 3300005764 | Tropical Forest Soil | EEWVSWFGIPTQFSPHWTAGMAIDEPTAHTRLIMSDE* |
| Ga0066696_106747951 | 3300006032 | Soil | SVLWPGDEPPAMRGDWVSWFGIPTQFSPHWEAGMAIDEPTAHGRLILSDE* |
| Ga0066656_103549082 | 3300006034 | Soil | WVSWFGIPTQFSPHWTAGMAMDEPTAHTRLILSDE* |
| Ga0075417_101111021 | 3300006049 | Populus Rhizosphere | EDWVSWFGIPTQFSPHWEAGMAADEPTAQARFIRER* |
| Ga0066665_100846043 | 3300006796 | Soil | EDRVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE* |
| Ga0075428_10000797216 | 3300006844 | Populus Rhizosphere | WVSWFGIPTQFSPHWEAGMAADEPTAQARFIRER* |
| Ga0075428_1005892781 | 3300006844 | Populus Rhizosphere | ADEPAAMREDWVSWFGIPTQFSPHWTAGMALDEPTAHARLIMSDE* |
| Ga0075430_1002809281 | 3300006846 | Populus Rhizosphere | DWVSWFGIPTQFSPHWEPGMVLDEPTAHARLIVSDE* |
| Ga0075431_1012907642 | 3300006847 | Populus Rhizosphere | PADEPAAMREDWVSWFGIPTQFSPHWTAGMALDEPTAHARLIMSDE* |
| Ga0075433_104146892 | 3300006852 | Populus Rhizosphere | MREEWVSWFGIPTQFSPHWTAGMAVDEPTAHTRLISE* |
| Ga0075433_119604722 | 3300006852 | Populus Rhizosphere | DWVSWFGIPTQFSPHWEAGMVGDEPTARARFITHEE* |
| Ga0075425_1001328441 | 3300006854 | Populus Rhizosphere | DEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHTRLISE* |
| Ga0075425_1010067531 | 3300006854 | Populus Rhizosphere | MREHWVSWFGIPTQFSPHWEPGMVLDEPTAHTRLILSDE* |
| Ga0075434_1000168296 | 3300006871 | Populus Rhizosphere | VLWPADEPAAMREEWVSWFGIPTQFSPHWTAGMAVDEPTAHTRLISE* |
| Ga0075429_1002510943 | 3300006880 | Populus Rhizosphere | NVLWPADEPAAMREDWVSWFGIPTQFSPHWTAGMALDEPTAHARLIMSDE* |
| Ga0075426_104037271 | 3300006903 | Populus Rhizosphere | DEPAAMREEWVSWFGIPTQFSPHWTAGMAVDEPTAHTRLISE* |
| Ga0075424_1026252351 | 3300006904 | Populus Rhizosphere | EDWVSWFGIPTQFSPHWEAGMAIDEPTAHARLIVSDE* |
| Ga0075436_1006305491 | 3300006914 | Populus Rhizosphere | AMREDWVSWFGIPTQFSPHWDGPPIDEPTYHTRLVGE* |
| Ga0075436_1010878771 | 3300006914 | Populus Rhizosphere | LWPADEPAAMREEWVSWFGIPTQFSPHWTAGMAVDEPTAHTRLISE* |
| Ga0079219_110573761 | 3300006954 | Agricultural Soil | MREEWVSWFGIPTQFSPHWTAGMAIDEPTAHTRLIGE* |
| Ga0075435_1015430112 | 3300007076 | Populus Rhizosphere | REQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE* |
| Ga0066710_1002864721 | 3300009012 | Grasslands Soil | DEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIMSDE |
| Ga0066710_1006045091 | 3300009012 | Grasslands Soil | NVLWPADEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLILSDE |
| Ga0099828_105494441 | 3300009089 | Vadose Zone Soil | WVSWFGIPTQFSPHWEAGMAIDEPTARARLIVSDE* |
| Ga0099827_100895555 | 3300009090 | Vadose Zone Soil | VLWPGDEPPAMRGDWVSWFGIPTQFSPHWEAGMAVDEPTAHGRLILSDE* |
| Ga0066709_1001017991 | 3300009137 | Grasslands Soil | NVLWPADEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLILSDE* |
| Ga0114129_104704482 | 3300009147 | Populus Rhizosphere | WVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE* |
| Ga0105243_118574342 | 3300009148 | Miscanthus Rhizosphere | EHWVSWFGIPTQFSPHWEAGMAVAEPTAQTPLILSDE* |
| Ga0105248_106163614 | 3300009177 | Switchgrass Rhizosphere | NVLWPTDEPPAMREEWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE* |
| Ga0105249_116887462 | 3300009553 | Switchgrass Rhizosphere | MREEWVSWYGIPTQFSPHWAAGMAIAEPTAQTRLIVSDE* |
| Ga0126374_101260313 | 3300009792 | Tropical Forest Soil | WVSWFGIPTQFSPHWTAGMAIDEPTAHTRLIMSDE* |
| Ga0126374_104384201 | 3300009792 | Tropical Forest Soil | DELPAMREEWVGWFGIPTQFSPHWAAGMAIAEPTAQTRLIVSDE* |
| Ga0126374_113809582 | 3300009792 | Tropical Forest Soil | HDELPAMREEWVSWYGIPTQFSPHWAAGMAIAEPTAQTRLIVSDE* |
| Ga0126384_102066531 | 3300010046 | Tropical Forest Soil | AAMREEWVSWFGIPAQFSPHWTAGMAIDEPTAHTRLIMSDE* |
| Ga0126384_108169881 | 3300010046 | Tropical Forest Soil | PLPLNVLWPHDELPAMREEWVSWYGIPTQFSPHWAAGMAIAEPTAQTRLIVSDE* |
| Ga0126382_119972782 | 3300010047 | Tropical Forest Soil | AMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHTRLIVSDE* |
| Ga0134082_100094976 | 3300010303 | Grasslands Soil | MREDWVSWFGIPTQFSPHWEAGMAIDEPTARGRLIVSEE* |
| Ga0134071_105044932 | 3300010336 | Grasslands Soil | LNVLWPADEPPAMREHWVSWFGIPTQFSPHWEAGMAVAEPTAQAPLILSDE* |
| Ga0126370_112985761 | 3300010358 | Tropical Forest Soil | PQDEPPAMREQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLIRSDE* |
| Ga0126370_123669001 | 3300010358 | Tropical Forest Soil | EEWVGWFGIPTQFSPHWAAGMAIAEPTAQTRLIVSDE* |
| Ga0126376_106717462 | 3300010359 | Tropical Forest Soil | MREEWVSWYGIPTQFSPHWEAGMAIAEPTAQTRLIVSDE* |
| Ga0126376_119521621 | 3300010359 | Tropical Forest Soil | MREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIGE* |
| Ga0126372_114178122 | 3300010360 | Tropical Forest Soil | PPAMREQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE* |
| Ga0126377_102273812 | 3300010362 | Tropical Forest Soil | MREQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE* |
| Ga0126379_127344161 | 3300010366 | Tropical Forest Soil | LNVLWPADEPPAMREHWVGWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE* |
| Ga0126381_1018166401 | 3300010376 | Tropical Forest Soil | PADEPPAMREHWVGWFGIPTQFSPHWEAGMAIAEPTAQTPLIPSDE* |
| Ga0126383_101398771 | 3300010398 | Tropical Forest Soil | MREEWVSWFGIPTQFSPHWTVGMAIDEPTAHARLIGE* |
| Ga0134127_119723672 | 3300010399 | Terrestrial Soil | PADEPSAMREDWVSWFGIPTQFSPHWEGPPIDEPTYHTRLVGE* |
| Ga0134127_120790411 | 3300010399 | Terrestrial Soil | APADEPTAMREDWVSWFGIPTQFSPHYDGPPIDEPTYHTRLVGE* |
| Ga0134121_110228602 | 3300010401 | Terrestrial Soil | IREDWVSWFGIPTQFSPHWDGAPLVEPTAHTRLIVSDE* |
| Ga0134123_116900281 | 3300010403 | Terrestrial Soil | TDEPPAMREQWVSWFGIPTQFSPHWEAGMAVAEPTAQTPLILSDE* |
| Ga0137383_103222312 | 3300012199 | Vadose Zone Soil | WVSWFGIPTQFSPHWTAGMAIDEPTAHARLIMSDE* |
| Ga0137382_106915302 | 3300012200 | Vadose Zone Soil | PGDEPPAMRGDWVSWFGIPTQFSPHWEAGMAIDEPTAHGRLILSDE* |
| Ga0137399_104575651 | 3300012203 | Vadose Zone Soil | AMREDWVSWFGIPTQFSPHWEAGMAIAEPTAQTRIILSDE* |
| Ga0137376_104121282 | 3300012208 | Vadose Zone Soil | WPADEPAAMREEWVSWFGIPTQFSPHWTAGIAIDEPTAHARLIMSDE* |
| Ga0137378_114919081 | 3300012210 | Vadose Zone Soil | AMREDWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE* |
| Ga0137358_106530052 | 3300012582 | Vadose Zone Soil | MREHWVSWFGIPTQFSPHWEAGMAIDEPTARARLIVSDE* |
| Ga0137407_105447231 | 3300012930 | Vadose Zone Soil | EEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIMNDE* |
| Ga0137410_101457143 | 3300012944 | Vadose Zone Soil | WVSWFGIPTQFSPHWTAGMAIDEPTAHVRLIMSDE* |
| Ga0137410_116695361 | 3300012944 | Vadose Zone Soil | VLAPADESAAIREDWVSWFGIPTQFSPHWDGAPIDEPTAHTRLIVSDE* |
| Ga0126375_111074181 | 3300012948 | Tropical Forest Soil | AAMREHWVGWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE* |
| Ga0134075_100019388 | 3300014154 | Grasslands Soil | LSVLWPGDEPPAMRGDWVSWFGIPTQFSPHWEAGMAMDEPTAHGRLIMSDE* |
| Ga0134079_100541132 | 3300014166 | Grasslands Soil | DWVSWFGIPTQFSPHWEAGMAIDEPTAHGRLILSDE* |
| Ga0137405_12116863 | 3300015053 | Vadose Zone Soil | WPVDEPPAMREHWVSWFGIPTQFSPHWEAGMAVAEPTAQAPFILSDE* |
| Ga0132258_110769284 | 3300015371 | Arabidopsis Rhizosphere | NVLWPTDELPAMREEWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDSDPAGY* |
| Ga0132258_126278302 | 3300015371 | Arabidopsis Rhizosphere | TDEPSAMRVDWVGWFGIPTQFSPHWEPGMVLDEPTAHARLIMSDE* |
| Ga0132255_1008085291 | 3300015374 | Arabidopsis Rhizosphere | VLWPADEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHTRLIMSDE* |
| Ga0182033_111245171 | 3300016319 | Soil | NVLWPADEPPAMREQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE |
| Ga0182038_108335232 | 3300016445 | Soil | NVLWPADEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIGE |
| Ga0184619_102887532 | 3300018061 | Groundwater Sediment | EWVSWFGIPTQFSPHWEAGMAIDEPTARARLIVSDE |
| Ga0190272_120857092 | 3300018429 | Soil | MREEWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE |
| Ga0179594_101402492 | 3300020170 | Vadose Zone Soil | WPGDEPPAMRGDWVSWFGIPTQFSPHWEAGMAIDEPTAHGRLILSDE |
| Ga0179594_101509091 | 3300020170 | Vadose Zone Soil | DEPAAMREDWVSWFGIPTQFSPHWTAGMAMDEPTAHTRLILSDE |
| Ga0126371_109257791 | 3300021560 | Tropical Forest Soil | EDELPAMREEWVSWFGIPTQFSPHWAAGMAIAEPTAQTRLIVSDE |
| Ga0207642_103416992 | 3300025899 | Miscanthus Rhizosphere | PAMREDWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE |
| Ga0207646_109634452 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ENWVSWFGISTQFSPHWEVGMAIAEPTAETRLILSDE |
| Ga0207646_118489451 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | AMREDWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE |
| Ga0207701_116971042 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | DEPTAMREDWVSWFGIATQFSPHWEGPPVDEPTYHTRLVGE |
| Ga0207644_116579391 | 3300025931 | Switchgrass Rhizosphere | MREHWVSWFGIPTQFSPHWEAGMAVAEPTAQTPLILSDE |
| Ga0207709_111884992 | 3300025935 | Miscanthus Rhizosphere | EHWVSWFGIPTQFSPHWEAGMAVAEPTAQTPLILSDE |
| Ga0207711_100527203 | 3300025941 | Switchgrass Rhizosphere | NVLWPADEPPAMREEWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDSDPAGY |
| Ga0207676_123889961 | 3300026095 | Switchgrass Rhizosphere | ELPAMREEWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE |
| Ga0209055_10611041 | 3300026309 | Soil | AAMREDWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE |
| Ga0209686_10069367 | 3300026315 | Soil | DEPAAMREDWVSWFGIPTQFSPHWTAGMAVDEPTAHARLILSEE |
| Ga0209472_12669582 | 3300026323 | Soil | PAAMREDWVSWFGIPTQFSPHWTAGMAVDEPTAHARLILSEE |
| Ga0209470_13340672 | 3300026324 | Soil | EEWVGWFGIPTQFSPHWTAGMAIDEPTAHARLIMSDE |
| Ga0209803_10713562 | 3300026332 | Soil | PLSVLWPGDEPPAMRGDWVSWFGIPTQFSPHWEAGMAMDEPTAHGRLIMSDE |
| Ga0209377_12371552 | 3300026334 | Soil | DWVSWFGIPTQFSPHWEAGMAIAEPTAQSRLILSDE |
| Ga0209057_11950152 | 3300026342 | Soil | VLWPADEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIVSE |
| Ga0209806_10314731 | 3300026529 | Soil | DEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLILSDE |
| Ga0209807_12452692 | 3300026530 | Soil | PAAMREDWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE |
| Ga0209161_104087292 | 3300026548 | Soil | MREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIMSDE |
| Ga0209577_106329181 | 3300026552 | Soil | LLWLGDEPTAVREDWVSWFGIPTQFSPHWDGAPLDEPTAHTRLVGE |
| Ga0209799_10597173 | 3300027654 | Tropical Forest Soil | AAMREEWVSWFGIPAQFSPHWTAGMAIDEPTAHTRLIMSDE |
| Ga0209388_10613041 | 3300027655 | Vadose Zone Soil | SVLWPADEPPAMRGDWVSWFGIPTQFSPHWEAGMAIDEPTAHGRLILSDE |
| Ga0209689_12485432 | 3300027748 | Soil | PAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLILSDE |
| Ga0209689_13453422 | 3300027748 | Soil | PAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIMSDE |
| Ga0209701_100256346 | 3300027862 | Vadose Zone Soil | TAMREDWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE |
| Ga0209814_100198533 | 3300027873 | Populus Rhizosphere | DWVSWFGIPTQFSPHWEPGMVLDEPTAHTRLIVSDE |
| Ga0307293_102309882 | 3300028711 | Soil | ADEPAAMREEWVSWFGIPTQFSPHWEAGMAIDEPTAHARLIVSDE |
| Ga0307290_103853922 | 3300028791 | Soil | REEWVSWFGIPTQFSPHWEAGMAIDEPTAHARLIVSDE |
| Ga0307305_104094581 | 3300028807 | Soil | MREEWVSWFGIPTQFSPHWEAGMAIDEPTAHARLIVSDE |
| Ga0318534_106759551 | 3300031544 | Soil | MREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIGE |
| Ga0318528_100443513 | 3300031561 | Soil | WPADEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIGE |
| Ga0318572_105729061 | 3300031681 | Soil | REEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIGE |
| Ga0307469_105285552 | 3300031720 | Hardwood Forest Soil | PADEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHTRLIE |
| Ga0318500_106950752 | 3300031724 | Soil | GDEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIGE |
| Ga0318494_105365391 | 3300031751 | Soil | PYDELPAMREEWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLIVSDE |
| Ga0318546_102277621 | 3300031771 | Soil | LNVLWPADEPPAMREQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE |
| Ga0318548_103231772 | 3300031793 | Soil | VLWPADEPPAMREQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE |
| Ga0318568_106555682 | 3300031819 | Soil | PAMREEWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLIVSDE |
| Ga0318564_100688611 | 3300031831 | Soil | AAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIGE |
| Ga0318517_101352012 | 3300031835 | Soil | PLNVLWPADEPPAMREQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE |
| Ga0318495_100061946 | 3300031860 | Soil | PAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIGE |
| Ga0310913_102595002 | 3300031945 | Soil | DEPPAMREQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE |
| Ga0318558_101335732 | 3300032044 | Soil | AMREQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE |
| Ga0318524_101258002 | 3300032067 | Soil | MREQWVSWFGIPTQFSPHWEAGMAIAEPTAQTPLILSDE |
| Ga0318553_101652702 | 3300032068 | Soil | ADEPAAMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIGE |
| Ga0318577_100747733 | 3300032091 | Soil | AMREEWVSWFGIPTQFSPHWTAGMAIDEPTAHARLIGE |
| Ga0307470_107739322 | 3300032174 | Hardwood Forest Soil | PTDEPPAMREHWVSWFGIPTQFSPHWEAGMAVAEPTAQTPLILSDE |
| Ga0307471_1036968181 | 3300032180 | Hardwood Forest Soil | DEPPAMREEWVSWFGIPTQFSPHWEAGMAIAEPTAQTRLILSDE |
| Ga0307471_1039639861 | 3300032180 | Hardwood Forest Soil | AMREVWVSWFGIPTQFSPLWEAGMAIAEPTAETRLIMSDE |
| ⦗Top⦘ |