| Basic Information | |
|---|---|
| Family ID | F050260 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 48 residues |
| Representative Sequence | VRPTKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGA |
| Number of Associated Samples | 112 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 21.38 % |
| % of genes near scaffold ends (potentially truncated) | 95.17 % |
| % of genes from short scaffolds (< 2000 bps) | 77.24 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.621 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.655 % of family members) |
| Environment Ontology (ENVO) | Unclassified (46.207 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.724 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 38.16% β-sheet: 2.63% Coil/Unstructured: 59.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF00069 | Pkinase | 8.97 |
| PF00672 | HAMP | 5.52 |
| PF03807 | F420_oxidored | 3.45 |
| PF13437 | HlyD_3 | 2.76 |
| PF07676 | PD40 | 2.07 |
| PF13540 | RCC1_2 | 2.07 |
| PF00072 | Response_reg | 1.38 |
| PF13349 | DUF4097 | 1.38 |
| PF00415 | RCC1 | 1.38 |
| PF02518 | HATPase_c | 1.38 |
| PF01966 | HD | 0.69 |
| PF05193 | Peptidase_M16_C | 0.69 |
| PF07705 | CARDB | 0.69 |
| PF02153 | PDH_N | 0.69 |
| PF13683 | rve_3 | 0.69 |
| PF00512 | HisKA | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 35.86 |
| COG5184 | Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteins | Cell cycle control, cell division, chromosome partitioning [D] | 2.76 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.31 % |
| Unclassified | root | N/A | 0.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10028755 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 3746 | Open in IMG/M |
| 3300002561|JGI25384J37096_10067078 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300002561|JGI25384J37096_10116764 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300002911|JGI25390J43892_10104449 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300002912|JGI25386J43895_10172724 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_69_22 | 542 | Open in IMG/M |
| 3300005174|Ga0066680_10633445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 665 | Open in IMG/M |
| 3300005175|Ga0066673_10006076 | All Organisms → cellular organisms → Bacteria | 4891 | Open in IMG/M |
| 3300005175|Ga0066673_10380795 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_1_69_27 | 823 | Open in IMG/M |
| 3300005180|Ga0066685_10677130 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_69_22 | 709 | Open in IMG/M |
| 3300005184|Ga0066671_10953431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300005187|Ga0066675_10016522 | All Organisms → cellular organisms → Bacteria | 4064 | Open in IMG/M |
| 3300005187|Ga0066675_10579321 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300005440|Ga0070705_100105343 | All Organisms → cellular organisms → Bacteria | 1790 | Open in IMG/M |
| 3300005440|Ga0070705_101461056 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005445|Ga0070708_100144925 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300005451|Ga0066681_10729867 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300005467|Ga0070706_100164238 | All Organisms → cellular organisms → Bacteria | 2073 | Open in IMG/M |
| 3300005467|Ga0070706_101422716 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 634 | Open in IMG/M |
| 3300005468|Ga0070707_102307566 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → unclassified Gemmatimonas → Gemmatimonas sp. SG8_17 | 505 | Open in IMG/M |
| 3300005471|Ga0070698_100200880 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300005518|Ga0070699_101076375 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 737 | Open in IMG/M |
| 3300005536|Ga0070697_101191972 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 678 | Open in IMG/M |
| 3300005545|Ga0070695_101208482 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300005546|Ga0070696_100007591 | All Organisms → cellular organisms → Bacteria | 7249 | Open in IMG/M |
| 3300005547|Ga0070693_100485769 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 873 | Open in IMG/M |
| 3300005553|Ga0066695_10019347 | All Organisms → cellular organisms → Bacteria | 3771 | Open in IMG/M |
| 3300005556|Ga0066707_10004448 | All Organisms → cellular organisms → Bacteria | 6163 | Open in IMG/M |
| 3300005558|Ga0066698_11008749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
| 3300005559|Ga0066700_10293279 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300005568|Ga0066703_10310014 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
| 3300005574|Ga0066694_10047970 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300005576|Ga0066708_10957626 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005598|Ga0066706_10822418 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005937|Ga0081455_10216033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1425 | Open in IMG/M |
| 3300006032|Ga0066696_10774323 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 613 | Open in IMG/M |
| 3300006034|Ga0066656_10013811 | All Organisms → cellular organisms → Bacteria | 4156 | Open in IMG/M |
| 3300006034|Ga0066656_10344799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 962 | Open in IMG/M |
| 3300006796|Ga0066665_10117192 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
| 3300006796|Ga0066665_10718743 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300006800|Ga0066660_10009538 | All Organisms → cellular organisms → Bacteria | 5145 | Open in IMG/M |
| 3300006806|Ga0079220_11335702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 603 | Open in IMG/M |
| 3300006845|Ga0075421_100523096 | All Organisms → cellular organisms → Bacteria | 1406 | Open in IMG/M |
| 3300007255|Ga0099791_10041288 | All Organisms → cellular organisms → Bacteria | 2048 | Open in IMG/M |
| 3300009012|Ga0066710_101356027 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1103 | Open in IMG/M |
| 3300009012|Ga0066710_101535171 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1025 | Open in IMG/M |
| 3300009012|Ga0066710_103388919 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_69_22 | 606 | Open in IMG/M |
| 3300009012|Ga0066710_103846480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 563 | Open in IMG/M |
| 3300009088|Ga0099830_10281353 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1324 | Open in IMG/M |
| 3300009090|Ga0099827_10418416 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1146 | Open in IMG/M |
| 3300009137|Ga0066709_100163295 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2870 | Open in IMG/M |
| 3300009147|Ga0114129_12768540 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 583 | Open in IMG/M |
| 3300010303|Ga0134082_10310373 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 662 | Open in IMG/M |
| 3300010329|Ga0134111_10530324 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 520 | Open in IMG/M |
| 3300010336|Ga0134071_10639594 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
| 3300010337|Ga0134062_10399039 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 672 | Open in IMG/M |
| 3300010396|Ga0134126_12120720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 614 | Open in IMG/M |
| 3300010400|Ga0134122_10549689 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1056 | Open in IMG/M |
| 3300010403|Ga0134123_11265215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 771 | Open in IMG/M |
| 3300011269|Ga0137392_11489200 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 536 | Open in IMG/M |
| 3300012096|Ga0137389_10552026 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 989 | Open in IMG/M |
| 3300012096|Ga0137389_10999347 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300012189|Ga0137388_11952510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 516 | Open in IMG/M |
| 3300012198|Ga0137364_10343535 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_1_69_27 | 1113 | Open in IMG/M |
| 3300012199|Ga0137383_10779849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_1_69_27 | 698 | Open in IMG/M |
| 3300012200|Ga0137382_10024888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3500 | Open in IMG/M |
| 3300012200|Ga0137382_10232120 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1274 | Open in IMG/M |
| 3300012200|Ga0137382_10471456 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 890 | Open in IMG/M |
| 3300012201|Ga0137365_10102337 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2155 | Open in IMG/M |
| 3300012202|Ga0137363_10336461 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1246 | Open in IMG/M |
| 3300012203|Ga0137399_10623958 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 907 | Open in IMG/M |
| 3300012204|Ga0137374_10059709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3842 | Open in IMG/M |
| 3300012207|Ga0137381_10429406 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1153 | Open in IMG/M |
| 3300012208|Ga0137376_10157811 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1954 | Open in IMG/M |
| 3300012208|Ga0137376_10728353 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 855 | Open in IMG/M |
| 3300012208|Ga0137376_10920621 | All Organisms → cellular organisms → Bacteria → FCB group | 750 | Open in IMG/M |
| 3300012209|Ga0137379_11034326 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
| 3300012210|Ga0137378_10284305 | All Organisms → cellular organisms → Bacteria | 1539 | Open in IMG/M |
| 3300012211|Ga0137377_11105459 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 723 | Open in IMG/M |
| 3300012231|Ga0137465_1002217 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 5636 | Open in IMG/M |
| 3300012349|Ga0137387_10660301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 757 | Open in IMG/M |
| 3300012353|Ga0137367_10036329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 3778 | Open in IMG/M |
| 3300012356|Ga0137371_10280040 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 1300 | Open in IMG/M |
| 3300012356|Ga0137371_10509041 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 929 | Open in IMG/M |
| 3300012357|Ga0137384_10250942 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1476 | Open in IMG/M |
| 3300012357|Ga0137384_10271177 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300012357|Ga0137384_11551143 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 512 | Open in IMG/M |
| 3300012359|Ga0137385_10281844 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1433 | Open in IMG/M |
| 3300012361|Ga0137360_11481872 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 583 | Open in IMG/M |
| 3300012395|Ga0134044_1065280 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 884 | Open in IMG/M |
| 3300012918|Ga0137396_11137885 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 555 | Open in IMG/M |
| 3300012927|Ga0137416_10016102 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4649 | Open in IMG/M |
| 3300012927|Ga0137416_10828642 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 819 | Open in IMG/M |
| 3300012927|Ga0137416_12171305 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 510 | Open in IMG/M |
| 3300012972|Ga0134077_10118498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1037 | Open in IMG/M |
| 3300012975|Ga0134110_10001144 | All Organisms → cellular organisms → Bacteria | 9459 | Open in IMG/M |
| 3300012975|Ga0134110_10129437 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1034 | Open in IMG/M |
| 3300012977|Ga0134087_10640632 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_69_22 | 556 | Open in IMG/M |
| 3300014154|Ga0134075_10143335 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300014157|Ga0134078_10002877 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4551 | Open in IMG/M |
| 3300014157|Ga0134078_10091109 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_1_69_27 | 1126 | Open in IMG/M |
| 3300014880|Ga0180082_1110842 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 625 | Open in IMG/M |
| 3300015241|Ga0137418_10039066 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4381 | Open in IMG/M |
| 3300015241|Ga0137418_10097358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2650 | Open in IMG/M |
| 3300015241|Ga0137418_10822869 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 693 | Open in IMG/M |
| 3300015241|Ga0137418_11128731 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
| 3300017654|Ga0134069_1303463 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
| 3300017656|Ga0134112_10099953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1089 | Open in IMG/M |
| 3300017657|Ga0134074_1009493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3130 | Open in IMG/M |
| 3300017657|Ga0134074_1339048 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 553 | Open in IMG/M |
| 3300017933|Ga0187801_10523408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 500 | Open in IMG/M |
| 3300018074|Ga0184640_10426487 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 593 | Open in IMG/M |
| 3300018431|Ga0066655_10080454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1774 | Open in IMG/M |
| 3300018431|Ga0066655_11352489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 514 | Open in IMG/M |
| 3300018433|Ga0066667_10006232 | All Organisms → cellular organisms → Bacteria | 5292 | Open in IMG/M |
| 3300018482|Ga0066669_12145601 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
| 3300019279|Ga0184642_1104302 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2250 | Open in IMG/M |
| 3300020004|Ga0193755_1002174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 6119 | Open in IMG/M |
| 3300025910|Ga0207684_10011630 | All Organisms → cellular organisms → Bacteria | 7687 | Open in IMG/M |
| 3300025910|Ga0207684_10162122 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1926 | Open in IMG/M |
| 3300025910|Ga0207684_10280355 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1437 | Open in IMG/M |
| 3300026295|Ga0209234_1208165 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 657 | Open in IMG/M |
| 3300026298|Ga0209236_1321346 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 501 | Open in IMG/M |
| 3300026301|Ga0209238_1031731 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1962 | Open in IMG/M |
| 3300026306|Ga0209468_1026116 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
| 3300026310|Ga0209239_1030103 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2590 | Open in IMG/M |
| 3300026310|Ga0209239_1038388 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2220 | Open in IMG/M |
| 3300026310|Ga0209239_1050739 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 1872 | Open in IMG/M |
| 3300026313|Ga0209761_1319454 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_69_22 | 531 | Open in IMG/M |
| 3300026314|Ga0209268_1007831 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4481 | Open in IMG/M |
| 3300026315|Ga0209686_1153749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300026326|Ga0209801_1133573 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1057 | Open in IMG/M |
| 3300026330|Ga0209473_1107772 | Not Available | 1161 | Open in IMG/M |
| 3300026528|Ga0209378_1198275 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 670 | Open in IMG/M |
| 3300026530|Ga0209807_1346715 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 506 | Open in IMG/M |
| 3300026532|Ga0209160_1050866 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 2396 | Open in IMG/M |
| 3300026538|Ga0209056_10028572 | All Organisms → cellular organisms → Bacteria | 5300 | Open in IMG/M |
| 3300026538|Ga0209056_10156487 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1735 | Open in IMG/M |
| 3300026547|Ga0209156_10351332 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 637 | Open in IMG/M |
| 3300026550|Ga0209474_10283386 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 993 | Open in IMG/M |
| 3300027875|Ga0209283_10443010 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300027882|Ga0209590_10344003 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_2_20CM_2_69_23 | 961 | Open in IMG/M |
| 3300027882|Ga0209590_10639242 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 683 | Open in IMG/M |
| 3300027950|Ga0209885_1022525 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300032205|Ga0307472_101906790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 593 | Open in IMG/M |
| 3300034164|Ga0364940_0076629 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 924 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 21.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 13.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 11.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.34% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.07% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.38% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.69% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.69% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.69% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.69% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.69% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.69% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012231 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT828_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014880 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10D | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027950 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100287551 | 3300001356 | Peatlands Soil | VRPTTLGVIGLGAIGGSLARLAKQSKVSSVLGWSPDA |
| JGI25384J37096_100670782 | 3300002561 | Grasslands Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAER |
| JGI25384J37096_101167641 | 3300002561 | Grasslands Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPGERVAAVRQGAIDDAPSRA |
| JGI25390J43892_101044492 | 3300002911 | Grasslands Soil | VRPNTLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERV |
| JGI25386J43895_101727242 | 3300002912 | Grasslands Soil | VRPTKLGILGLGAIGGSLARQAKRAGVPTVLGWSPEPAERVSAAQ |
| Ga0066680_106334451 | 3300005174 | Soil | VRPTTLGILGLGAIGGSVALQAKRAGIATVLGWSPEPAER |
| Ga0066673_100060762 | 3300005175 | Soil | VRPSKLGIIGLGAIGGSLALQRRAGITTALGWSPQPAERVAAMRQGARRRPLAWGWGAV* |
| Ga0066673_103807951 | 3300005175 | Soil | VRPSSLGILGLGAIGGSLALEAKRAGIATVLGWSPDPAER |
| Ga0066685_106771302 | 3300005180 | Soil | VRPTKLGIIGLGAIGGSLALEAKRAGIERVLGWSPEPAERVAAAQQGALDD |
| Ga0066671_109534312 | 3300005184 | Soil | VRPSTLGILGLGAIGGSLALEAKRAGIATVLGWSPDPAERASAAQQRAIDDAPPRATDVARA |
| Ga0066675_100165221 | 3300005187 | Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDDA |
| Ga0066675_105793211 | 3300005187 | Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIPRVLGWSPEPAERVAAVQQGALDDAPARAM |
| Ga0070705_1001053432 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAV |
| Ga0070705_1014610562 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAER |
| Ga0070708_1001449251 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAA |
| Ga0066681_107298672 | 3300005451 | Soil | VCPSKLGIIGLGAIGGSLALQAKRAGITTLLGWSPQPAERVAAMGQGARRRPLAGGWGAV |
| Ga0070706_1001642382 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAAR |
| Ga0070706_1014227161 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAA |
| Ga0070707_1023075662 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPHTLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQG |
| Ga0070698_1002008802 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDDAPPRAAD |
| Ga0070699_1010763751 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAVRQGAIDD |
| Ga0070697_1011919722 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQG |
| Ga0070695_1012084821 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAPCSFQPVRPHTLGILGLGAIGGSLARQAKLAGVVTVVGWSPEPLERVAAVQQGALDDAPAHA |
| Ga0070696_10000759110 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MGAPCSFQPVRPHTLGILGLGAIGGSLARQAKLAGVVTVVGWSPEPLERVAAVQQGALDDAPAHAADV |
| Ga0070693_1004857692 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPTQLGIIGLGAIGGSVARQGKLAGIPKIVGWSPEPAERALAA |
| Ga0066695_100193471 | 3300005553 | Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDD |
| Ga0066707_100044481 | 3300005556 | Soil | VRPHTLGILGLGAIGGSVALQAKRAGIATVLGWCPDPAE |
| Ga0066698_110087492 | 3300005558 | Soil | VRPKTLGIIGLGAIGGSLALQAKRAGIATVLGWSPEP |
| Ga0066700_102932791 | 3300005559 | Soil | VRPHTLGILGLGAIGGSVALQAKRAGIPTVLGWCPDPAERAAAAQQGAIDDAPARA |
| Ga0066703_103100142 | 3300005568 | Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVA |
| Ga0066694_100479701 | 3300005574 | Soil | ARPAPLFPRVRPSKLGIIGLGAIGGSLALQRRAGITTALGWSPQPAERVAAMRQGARRRPLAWGWGAV* |
| Ga0066708_109576262 | 3300005576 | Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGA |
| Ga0066706_108224182 | 3300005598 | Soil | VRPTKLGVIGLGAIGGSLALQAKRAGITTVLGWSPQP |
| Ga0081455_102160332 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VKPTHLGIIGLGAIGGSLARQGKLAGVPTIIGWSPEPA |
| Ga0066696_107743231 | 3300006032 | Soil | VRPSTLGIIGLGAIGGSLALQAKRAGITTVLGWSPQPAERVAAMRQGAID |
| Ga0066656_100138111 | 3300006034 | Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDDA |
| Ga0066656_103447991 | 3300006034 | Soil | VRPSRLGIIGLGAIGGSLALQAKRAGIATVLGWSPERGERAAAAQQGAID |
| Ga0066665_101171922 | 3300006796 | Soil | VRPSRLGIIGLGAIGGSLALQAKRAGIATVLGWSPERGERAAAAQQGAIDDAPPLAADVARAV* |
| Ga0066665_107187432 | 3300006796 | Soil | VRPHTLGILGLGAIGGSVALQAKRAGIPTVLGWCPDPA |
| Ga0066660_100095384 | 3300006800 | Soil | VRPSSLGILGLGAIGGSLALEAKRAGIATVLGWSPDPAE |
| Ga0079220_113357022 | 3300006806 | Agricultural Soil | VRPDTLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPGERVAAARQGAIDDAPPRAGDVA |
| Ga0075421_1005230961 | 3300006845 | Populus Rhizosphere | VRPAALGILGIGAIGGSVARRPKQSGVPLVLGWSPDPAERVAAAREGVVDDA |
| Ga0099791_100412882 | 3300007255 | Vadose Zone Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGALDDA |
| Ga0066710_1013560272 | 3300009012 | Grasslands Soil | VRPHTLGILGLGAIGGSVALQAKRAGIATVLGWCPDPAER |
| Ga0066710_1015351712 | 3300009012 | Grasslands Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDDAP |
| Ga0066710_1033889191 | 3300009012 | Grasslands Soil | VRPTKLGILGLGAIGGSLARQAKRAGVPTVLGWSPEPAERVSAAQQGA |
| Ga0066710_1038464801 | 3300009012 | Grasslands Soil | VRPTTLGVIGLGAIGGSVARQAKQAGIGAVLGWSPDAA |
| Ga0099830_102813532 | 3300009088 | Vadose Zone Soil | VRPTTLGIIGLGAIGGSLARRAKLAGIATVIGWSLDGTDRVAAARQGALDDAPLHPQDVARKA |
| Ga0099827_104184161 | 3300009090 | Vadose Zone Soil | VRPTTLGILGLGAIGGSVALQAKRAGIASVLGWSPEPAER |
| Ga0066709_1001632952 | 3300009137 | Grasslands Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPGERVA |
| Ga0114129_127685402 | 3300009147 | Populus Rhizosphere | LGIIGLGAIGGSLARQAKLAGVARVIGWSPEPSERVAGVQQGALDDAPPKAADV |
| Ga0134082_103103732 | 3300010303 | Grasslands Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPGERV |
| Ga0134111_105303241 | 3300010329 | Grasslands Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVPGWSPEPAERVAAARQGAIDDAPPRAV |
| Ga0134071_106395941 | 3300010336 | Grasslands Soil | VRPTKLGILGLGAIGGSLARQAKRAGVPTVLGWSPE |
| Ga0134062_103990391 | 3300010337 | Grasslands Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDDAPPRAVDVA |
| Ga0134126_121207201 | 3300010396 | Terrestrial Soil | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAVRQGAIDDAPPRAADVARA |
| Ga0134122_105496892 | 3300010400 | Terrestrial Soil | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAVRQGAIDDAPPRAADVA |
| Ga0134123_112652152 | 3300010403 | Terrestrial Soil | MGAPCSFQPVRPHTLGILGLGAIGGSLARQAKLAGVVTVVGWSPEPLERVAAVQQGALDDAPAHAADVAGVAD |
| Ga0137392_114892001 | 3300011269 | Vadose Zone Soil | MAAASFNLVRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPSERVAA |
| Ga0137389_105520261 | 3300012096 | Vadose Zone Soil | MAAASFNLVRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPSERVAAVRQ |
| Ga0137389_109993471 | 3300012096 | Vadose Zone Soil | LRPTRLGIIGLGAIGGSLGRQAKRAGIPVVLGRSPEPAERVRAVQEGALDDAPS |
| Ga0137388_119525101 | 3300012189 | Vadose Zone Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAA |
| Ga0137364_103435351 | 3300012198 | Vadose Zone Soil | VRPSSLGILGLGAIGGSLALEAKRAGITTVLGWSPDPAERATAAQRGAIDDAPARATDV |
| Ga0137383_107798491 | 3300012199 | Vadose Zone Soil | VRPSTLGILGLGAIGGSLALEAKRAGIATVLGWSPDPAER |
| Ga0137382_100248882 | 3300012200 | Vadose Zone Soil | VCPSKLGIIGLGAIGGSLALQAKRAGITTVLGWSPQPAERVAAMRQGARRRPLAGGWGAV |
| Ga0137382_102321202 | 3300012200 | Vadose Zone Soil | VKPTHLGIIGLGAIGGSLARQGKLAGVPTISGWSP |
| Ga0137382_104714561 | 3300012200 | Vadose Zone Soil | VRPTKLGVVGLGAIGGSLALPAKRAGIQRVLGWSPEPAERVAAVQQGALDDAPPRAIDVARA |
| Ga0137365_101023373 | 3300012201 | Vadose Zone Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIATVLGWSPQPAERVAAVRGGAIDDAPPRA |
| Ga0137363_103364611 | 3300012202 | Vadose Zone Soil | VKPTQLGIIGLGAIGGSLARQAKLAGVETVVGWSPAPAERALAAQHGALDDS |
| Ga0137399_106239582 | 3300012203 | Vadose Zone Soil | VRPTTLGILGLGAIGGSVALQAKRAGIATVLGWSPEP |
| Ga0137374_100597093 | 3300012204 | Vadose Zone Soil | VRPHTLGILGLGAIGGSVALQAKRAGIATVLGWSPE |
| Ga0137381_104294061 | 3300012207 | Vadose Zone Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQ |
| Ga0137376_101578111 | 3300012208 | Vadose Zone Soil | LRPTRLGIIGLGAIGGSLGRQAKRAGIPTVLGWSPE |
| Ga0137376_107283531 | 3300012208 | Vadose Zone Soil | VRPSKLGIIGLGAIGGSLALQAKRAGITTVLGWSPQPAERVAAMQQGAVDDAPPRAAD |
| Ga0137376_109206211 | 3300012208 | Vadose Zone Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIPTVLGWSPQPAERV |
| Ga0137379_110343263 | 3300012209 | Vadose Zone Soil | LRPTRLGIIGLGAIGGSLGRQAKRAGIPTVLGWSPEPAERVRAVQEG |
| Ga0137378_102843051 | 3300012210 | Vadose Zone Soil | LRPTRLGIIGLGAIGGSLGRQAKRAGIPTVLGWSPEPAERVRAVQ |
| Ga0137377_111054591 | 3300012211 | Vadose Zone Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGA |
| Ga0137465_10022177 | 3300012231 | Soil | VRPTHLGIIGLGAIGGSLARQGKLAGVPTIIGWSPEPT |
| Ga0137387_106603011 | 3300012349 | Vadose Zone Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPAERVA |
| Ga0137367_100363293 | 3300012353 | Vadose Zone Soil | VRPHTLGILGLGAIGGSVALQAKRAGIATVLGWSPEPAERVAAVRQG |
| Ga0137371_102800401 | 3300012356 | Vadose Zone Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQ |
| Ga0137371_105090411 | 3300012356 | Vadose Zone Soil | VRPHTLGILGLGAIGGSVALQAKRAGIATVLGWCPDPAERAAAAQQGAIDDAPPRAAD |
| Ga0137384_102509422 | 3300012357 | Vadose Zone Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDDAPP |
| Ga0137384_102711771 | 3300012357 | Vadose Zone Soil | VRPTKLGILGLGAIGGSLARQAKRAGVPTVLGWSPEPAERVSAAQQG |
| Ga0137384_115511432 | 3300012357 | Vadose Zone Soil | VIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDDAPPRAVDVARAVELLV |
| Ga0137385_102818442 | 3300012359 | Vadose Zone Soil | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAE |
| Ga0137360_114818721 | 3300012361 | Vadose Zone Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAVRQGAIDDA |
| Ga0134044_10652802 | 3300012395 | Grasslands Soil | VRPSKLGIIGLGAIGGSLALQAKRAGITTLLGWSPQPAERVAAMGQGARRR |
| Ga0137396_111378851 | 3300012918 | Vadose Zone Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIRTVLGWSPEPGERVAAMR |
| Ga0137416_100161021 | 3300012927 | Vadose Zone Soil | VRPSNLGIIGLGAIGGSLALQAKRAGIATVLGWSPQPAERVAAMQQGA |
| Ga0137416_108286421 | 3300012927 | Vadose Zone Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPQPAERVAAMQQGA |
| Ga0137416_121713052 | 3300012927 | Vadose Zone Soil | VRPSKLGIIGLGAIGGSLALQAKRAGVATVLGWSPEPAERVAALRQGALDDAPPRA |
| Ga0134077_101184982 | 3300012972 | Grasslands Soil | VKPTHLGIIGLGAIGGSLARQGKLAGVPTISGWSPEPAERAL |
| Ga0134110_100011441 | 3300012975 | Grasslands Soil | VRPTKLGILGLGAIGGSLARQAKRAGVPTVLGWSPEPAERV |
| Ga0134110_101294372 | 3300012975 | Grasslands Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPA |
| Ga0134087_106406321 | 3300012977 | Grasslands Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIQRVLGWSPEPAERVAAVQQGALDDAPARAI |
| Ga0134075_101433352 | 3300014154 | Grasslands Soil | VRPTKLGIIGLGAIGGSLALAAKRGGVATVLGWTPEPAER |
| Ga0134078_100028771 | 3300014157 | Grasslands Soil | VRPSKLGIIGLGAIGGSLALQAKRAGITTLLGWSPQPAERVAAMRQGARRRPLAGGWGAV |
| Ga0134078_100911091 | 3300014157 | Grasslands Soil | VRPSSLGILGLGAIGGSLALEAKHAGIATVLGWSPDPAERATAAQRGA |
| Ga0180082_11108421 | 3300014880 | Soil | VRPTHLGIIGLGAIGGSLARQGKLAGVPTIIGWSPEPTERALAAPQ |
| Ga0137418_100390663 | 3300015241 | Vadose Zone Soil | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAVRQGAI |
| Ga0137418_100973583 | 3300015241 | Vadose Zone Soil | LAFQRYFPLVRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAVRQGAI |
| Ga0137418_108228691 | 3300015241 | Vadose Zone Soil | VRPTKLGIIGLGAIGGSLALQAKRAGVATVLGWSPEPAERVAAVRQGALDDAPPRAA |
| Ga0137418_111287312 | 3300015241 | Vadose Zone Soil | VRPTSLGVIGLGAIGGSLALQAKRAGIATVLGWSP |
| Ga0134069_13034632 | 3300017654 | Grasslands Soil | VKPTHLGIIGLGAIGVSLARQGKLAGVPTISGWSPEPAERARAAQQGA |
| Ga0134112_100999531 | 3300017656 | Grasslands Soil | VRPSRLGIIGLGAIGGSLALQAKRAGIATVLGWSPERGERAAAAQQGA |
| Ga0134074_10094933 | 3300017657 | Grasslands Soil | VRPKTLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPA |
| Ga0134074_13390481 | 3300017657 | Grasslands Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPGERVAAV |
| Ga0187801_105234081 | 3300017933 | Freshwater Sediment | VIGLGAIGGSLARQARRARLASVLGWSPDALERRAALEA |
| Ga0184640_104264872 | 3300018074 | Groundwater Sediment | VRPSQLGIIGLGAIGGSLARQAKLAGVGTVVGWSPEPAERVAAVKQGALDDAP |
| Ga0066655_100804542 | 3300018431 | Grasslands Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDDAPPRAVDVARAVELL |
| Ga0066655_113524892 | 3300018431 | Grasslands Soil | VRPTTLGVIGLGAIGGSVARQAKQAGIGVVLGWSP |
| Ga0066667_100062321 | 3300018433 | Grasslands Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAI |
| Ga0066669_121456012 | 3300018482 | Grasslands Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIPRVLGWSPEPA |
| Ga0184642_11043021 | 3300019279 | Groundwater Sediment | VRPSKLGIIGLGAIGGSVALQAKRAGIATVIGWSPEP |
| Ga0193755_10021741 | 3300020004 | Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPE |
| Ga0207684_100116301 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPHTLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDDAPP |
| Ga0207684_101621221 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAVRQGA |
| Ga0207684_102803551 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAIDDAPP |
| Ga0209234_12081652 | 3300026295 | Grasslands Soil | VRPSTLGILGLGAIGGSLALQAKRAGIATVLGWSPDPAERATAAQHRAIDDAPPRAADVARAVEL |
| Ga0209236_13213461 | 3300026298 | Grasslands Soil | VIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQG |
| Ga0209238_10317311 | 3300026301 | Grasslands Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPQPAERVAAVRRG |
| Ga0209468_10261162 | 3300026306 | Soil | VRPSKLGIIGLGAIGGSLALQAKRAGITTLLGWSPQPAERVAAMGQGARRRPLAGGWGAV |
| Ga0209239_10301031 | 3300026310 | Grasslands Soil | VRPQTLGILGLGAIGGSLALQAKRAGIATVLGWSP |
| Ga0209239_10383881 | 3300026310 | Grasslands Soil | VRPNTLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAA |
| Ga0209239_10507392 | 3300026310 | Grasslands Soil | VRPTKLGIIGLGAIGGSLALEAKRAGIERVLGWSPEPAER |
| Ga0209761_13194541 | 3300026313 | Grasslands Soil | VRPTKLGIIGLGAIGGSLALEAKRAGIERVLGWSP |
| Ga0209268_10078313 | 3300026314 | Soil | VRPSKLGIIGLGAIGGSLALQAKRAGITTVLDWSPQPAERVAAMRQGARRRPLAGGWGAV |
| Ga0209686_11537492 | 3300026315 | Soil | VRPSTLGILGLGAIGGSLALEAKRAGIATVLGWSPDPAERASAAQQRAIDDAPPR |
| Ga0209801_11335731 | 3300026326 | Soil | VRPTTLGILGLGAIGGSVALQAKRAGIATVLGWSPEPA |
| Ga0209473_11077721 | 3300026330 | Soil | VRPSSLGILGLGAIGGSLALEAKRAGIATVLGWSPDPAERAT |
| Ga0209378_11982752 | 3300026528 | Soil | VRPQTLGILGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAGRGG |
| Ga0209807_13467152 | 3300026530 | Soil | VRPTKLGIIGLGAIGGSLALQAKRAGIPRVLGWSPEPAERVAAVQQGALDDAPA |
| Ga0209160_10508663 | 3300026532 | Soil | VRPTKLGIIGLGAIGGSLALQAKRAGISRVLGWSPEPAERVAAAQRGALDDA |
| Ga0209056_100285721 | 3300026538 | Soil | VRPHTLGVVGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAID |
| Ga0209056_101564872 | 3300026538 | Soil | VRPHTLGILGLGAIGGSVALQAKRAGIPTVLGWCPDPAERA |
| Ga0209156_103513322 | 3300026547 | Soil | VRPSTLGIIGLGAIGGSLALEAKRAGIATVLGWSPDPAERATAAQQRAIDDA |
| Ga0209474_102833862 | 3300026550 | Soil | VRPTKLGIIGLGAIGGSLALQAKRAGITTVLGWSPEPGE |
| Ga0209283_104430102 | 3300027875 | Vadose Zone Soil | VRPTTLGIIGLGAIGGSLARRAKLAGISAVIGWSLDGTDRVA |
| Ga0209590_103440031 | 3300027882 | Vadose Zone Soil | VRPSKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAE |
| Ga0209590_106392421 | 3300027882 | Vadose Zone Soil | VRSPRASFQAVRPTTLGILGLGAIGGSVALQAKRAGIASVLGWSAEADDL |
| Ga0209885_10225252 | 3300027950 | Groundwater Sand | VRPSKLGIIGLGAIGGSLALAAKRAGVTTVLGWSPQPAERVAAV |
| Ga0307472_1019067901 | 3300032205 | Hardwood Forest Soil | VRPAKLGIIGLGAIGGSLALQAKRAGIATVLGWSPEPAERVAAARQGAI |
| Ga0364940_0076629_1_165 | 3300034164 | Sediment | MGAPCSFQPVRPHTLGLIGLGAIGGSLARQAKLAGVDTVIGWSPEPAERVAAVQH |
| ⦗Top⦘ |