| Basic Information | |
|---|---|
| Family ID | F050257 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MRTRLEGTQASGAGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR |
| Number of Associated Samples | 117 |
| Number of Associated Scaffolds | 143 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 50.37 % |
| % of genes near scaffold ends (potentially truncated) | 50.34 % |
| % of genes from short scaffolds (< 2000 bps) | 88.97 % |
| Associated GOLD sequencing projects | 111 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.15 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (78.621 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (16.552 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.379 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.897 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.15 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 143 Family Scaffolds |
|---|---|---|
| PF08388 | GIIM | 2.10 |
| PF14104 | DUF4277 | 1.40 |
| PF06685 | DUF1186 | 0.70 |
| PF12760 | Zn_Tnp_IS1595 | 0.70 |
| PF09517 | RE_Eco29kI | 0.70 |
| PF00355 | Rieske | 0.70 |
| PF13602 | ADH_zinc_N_2 | 0.70 |
| PF13358 | DDE_3 | 0.70 |
| PF00012 | HSP70 | 0.70 |
| PF02586 | SRAP | 0.70 |
| PF14690 | zf-ISL3 | 0.70 |
| PF13613 | HTH_Tnp_4 | 0.70 |
| PF13565 | HTH_32 | 0.70 |
| PF07130 | YebG | 0.70 |
| PF13191 | AAA_16 | 0.70 |
| PF13614 | AAA_31 | 0.70 |
| PF07883 | Cupin_2 | 0.70 |
| PF01656 | CbiA | 0.70 |
| COG ID | Name | Functional Category | % Frequency in 143 Family Scaffolds |
|---|---|---|---|
| COG0443 | Molecular chaperone DnaK (HSP70) | Posttranslational modification, protein turnover, chaperones [O] | 0.70 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 0.70 |
| COG3141 | dsDNA-binding SOS-regulon protein YebG, induction by DNA damage requires cAMP | Replication, recombination and repair [L] | 0.70 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 78.62 % |
| All Organisms | root | All Organisms | 21.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 16.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.79% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.41% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 11.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.28% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.21% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.45% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.07% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.07% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.07% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.38% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.69% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.69% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.69% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.69% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006939 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A10 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010123 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010139 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012375 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025157 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030574 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Db1 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030683 | Metatranscriptome of soil fungal communities from truffle orchard in Rollainville, France - Anb10 (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031093 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031094 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_203 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034666 | Metatranscriptome of lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034672 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KansclcFeb2_11019790 | 2124908045 | Soil | MRTRLEGTQASGAGESHTQEANVAEVNYGKPVIVEPEYPDKSWTTRR |
| JGI10213J12805_100069892 | 3300000858 | Soil | MGMRTRLGGTQASGAGESHTQEANVAEVSYGKTVIVEPEYPDKPSTIRR* |
| JGI1027J12803_1065554931 | 3300000955 | Soil | MRTRLEGTQASGEDELHIQEANVAEVSYGKPVSGEPECPVSS* |
| JGI25382J43887_101841251 | 3300002908 | Grasslands Soil | MRTRLEGTQASGAGESHTQEANVAEASYGEPVIGESEYPRCHSSTTRR* |
| JGI25404J52841_100117511 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MRTRLEGTQASGAGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0066397_100560101 | 3300004281 | Tropical Forest Soil | TQASGAGESHAQDANVAEVSYGETVIVESEYPDNPSTTRRSS*ASGVMTH* |
| Ga0063356_1029649942 | 3300004463 | Arabidopsis Thaliana Rhizosphere | VGMRTRLEGTQASGAGESHAQEANVAEVSYGKPVMGEPEYPDNQPTTRR* |
| Ga0066395_102766391 | 3300004633 | Tropical Forest Soil | MRPSSEGTQASGAGESHIQEANVAEVSYGEPVNGEPEYPDNHGTTRR* |
| Ga0066679_101227402 | 3300005176 | Soil | MRTRLEGTQASGEDELHIQEANVAEVSYGKPVSGEPECPV* |
| Ga0066679_103778372 | 3300005176 | Soil | LEGTQASGAGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0066688_104936351 | 3300005178 | Soil | GMRTRLEGTQASGAGESHTQEANVAEVSYGKPVNVKPEYPDNPSTTRR* |
| Ga0066676_105840231 | 3300005186 | Soil | MGTSSEGTQASGEGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0065705_101922062 | 3300005294 | Switchgrass Rhizosphere | MGMRTSLEGTQARGAGESHAQEANVAEVSYGEPVIGKPEYPDNPSPTRRWS* |
| Ga0065705_108861392 | 3300005294 | Switchgrass Rhizosphere | QVGMRTRLEGTQASGAGESHTQDANVAEVNYGKPVSGEPEYPDKPWTTRR* |
| Ga0065705_110300752 | 3300005294 | Switchgrass Rhizosphere | GMRTRLEGTQASGAGESHTQEANVAEVSYGKPVNVEPENPDNP* |
| Ga0065707_102530781 | 3300005295 | Switchgrass Rhizosphere | MGMRTSLEGTQASGAGESHAQEANVAEVSEGKPVSGEPEYPDNQPTTRR* |
| Ga0066388_1066676961 | 3300005332 | Tropical Forest Soil | GMRTRLEGTQASGAGESHAQDANVAEVSEGRPVIGEPEYPDNQSTTRR* |
| Ga0070668_1009415282 | 3300005347 | Switchgrass Rhizosphere | GAGESHAQEANVAEVSYGEPVIGKPEYPDNPSPTRRWS*AHWGDAL* |
| Ga0070708_1002921292 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPSLEGTQARGAGESHIQEATVAEVSSGEPVNGEPEYPENHGTT |
| Ga0066686_103370332 | 3300005446 | Soil | AQVGMRTRLEGTQASGAGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0066687_101098901 | 3300005454 | Soil | VGMRTRLEGTQASGEDELHIQEANVAEVSYGKPVSGEPECPV* |
| Ga0070706_1011081752 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MGMRTRLEGTQASGAGESHTQEANVAEVSYGKAVIVEPEYPDNPSTIRR* |
| Ga0066697_105637362 | 3300005540 | Soil | GMRTRLRGTQASGASESHAQEANVAEISYGEPVSGEPEYPV* |
| Ga0066661_103575081 | 3300005554 | Soil | MGMRTRLEGTQASGAGESHTQEANVAEVSYGKPVNVKPEYPDNPSTTRR* |
| Ga0066700_103666832 | 3300005559 | Soil | GMRTRLEGTQASGEDELHIQEANVAEVSYGKPVSGEPECPV* |
| Ga0066700_106915431 | 3300005559 | Soil | MRPSLEGTQASGAGESHIQEANVAEVSYGEPVTGEPEYPDNHGTTRR* |
| Ga0066699_106962623 | 3300005561 | Soil | EGMRTRLEGTQASGEDELHIQEANVAEVSYGKPVSGEPECPV* |
| Ga0066703_102065422 | 3300005568 | Soil | MRTRLEGTQARGAGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0066705_108532821 | 3300005569 | Soil | VGMRPSLEGTQASGAGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0066905_1003763683 | 3300005713 | Tropical Forest Soil | MRTRLEGTQASGAGESHTQDANVAEINYGEPVIVKPEFPV* |
| Ga0066905_1007976021 | 3300005713 | Tropical Forest Soil | MGMRTSLEGTQASGAGESHAQEANVAEVSYGKPVMGEPEYPDNQPTTRR* |
| Ga0066905_1022079611 | 3300005713 | Tropical Forest Soil | MRTRLEGTQASGAGESHTQDANVAEVNYGKPVSGEPEYPDKPWTTRR* |
| Ga0068861_1012357161 | 3300005719 | Switchgrass Rhizosphere | ARGAGESHAQEANVAEVSYGEPVIGKPEYPDNPSPTRRWS* |
| Ga0066903_1047563052 | 3300005764 | Tropical Forest Soil | MRTRLEGTQARGAGASHTQDANVAEVNYGKPVSGEPEYPDKPWTIRRST* |
| Ga0066903_1047925091 | 3300005764 | Tropical Forest Soil | QVGMRTRLEGTQARGAGASHTQDANVAEVNYGKPVIGEPAYPDKPWTTRR* |
| Ga0066903_1058984311 | 3300005764 | Tropical Forest Soil | MRTSLEGTQASGEGESHAQDANVAEVNYGKPVIGAPEIPDKP* |
| Ga0066903_1066698062 | 3300005764 | Tropical Forest Soil | GTQARREDASHIQEAHVAEVSHGEPVSGKPEHPDKPLTTRRWS* |
| Ga0066903_1067528151 | 3300005764 | Tropical Forest Soil | GMRPSLEGTQASGAGESHAQDASVAEVSYGETVTVEPEIPDNPLTTRRLL* |
| Ga0081455_102323232 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRPSSEGTQASGAGESHIQEANVAEVSYGEPVNGEPEYPENHGTTRR* |
| Ga0081455_103987093 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRTRSEGTQASGAGESHTQEANVAEVSYGKPVMVEPEYPDNEGT |
| Ga0075023_1001292102 | 3300006041 | Watersheds | MGMRTSLEGTQASGEGESHAQEANVAEVSYGRPVSGEPAYPDNQPTTRR* |
| Ga0075417_100497853 | 3300006049 | Populus Rhizosphere | MRPSLEGTQASGEGESHAQEANVAEVSYGKPVIGESENPV* |
| Ga0075417_102225982 | 3300006049 | Populus Rhizosphere | MGMRTRLEGTQASGASESHTQEANVAEVSYGKAVIVEPEYPDNPSTIRR* |
| Ga0075432_102080722 | 3300006058 | Populus Rhizosphere | MRPSSEGTQASGAGESHIQEANVAEVSYGEPVNGEPEYPENHGTTQR* |
| Ga0066665_102183932 | 3300006796 | Soil | MRTRLEGTQASGAGESHTQDANVAEVNYGKPVIGEHEYPDKPWTTRR* |
| Ga0066659_109841302 | 3300006797 | Soil | GAGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0075428_1001350342 | 3300006844 | Populus Rhizosphere | MRTRLEGTQARGAGESHIQDANVAEVNYGKPVIGEPESLNF* |
| Ga0075428_1008832562 | 3300006844 | Populus Rhizosphere | MGMRPRLEGTQASGAGESHTQEANVAEVSYGKPVTVEPQHPV* |
| Ga0075428_1009411551 | 3300006844 | Populus Rhizosphere | QAGMRPSLEGTQVRREAESHRQDAPIAEVSYGKPVIGEPEDPDKSLTTRRLS* |
| Ga0075428_1014323911 | 3300006844 | Populus Rhizosphere | AQVGMRTRLEGTQASGAGESHTQDANVAEVNYGKPVSGEPEDPDKPWTTRR* |
| Ga0075421_1003650352 | 3300006845 | Populus Rhizosphere | MRISLEGTQASGEGESHTQDANVAEVSYGEPVTGEPEYPDKPSTTRR* |
| Ga0075421_1018934731 | 3300006845 | Populus Rhizosphere | VGMRTRLEGTQASGAGESHTQDANVAEVNYGKPVSGEPEDPDKPWTTRR* |
| Ga0075430_1005792294 | 3300006846 | Populus Rhizosphere | MRPSLEGTQTSGAGESHTQEANVAEVSYGEDGFVEPEYPD |
| Ga0075431_1017947591 | 3300006847 | Populus Rhizosphere | GAGESHIQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0075433_107096762 | 3300006852 | Populus Rhizosphere | GMRTSLEGTQASGEGESHTQDANVAEVSYGEPVTGEPEYPDKPSTTRR* |
| Ga0075420_1006673042 | 3300006853 | Populus Rhizosphere | MRTRLEGTQASGAGESHTQEANVAEVSYGKPVNVEPENPDNP* |
| Ga0075434_1004047223 | 3300006871 | Populus Rhizosphere | GTQASGAGESHTQEANVAEVSYGKPVMVEPQYPDNEGTTRGERSGSSPV* |
| Ga0075429_1001167901 | 3300006880 | Populus Rhizosphere | LEGTQASGAGESHAQEANVAEVSYGKPVMGEPEYPDNQPTTRR* |
| Ga0075424_1017927082 | 3300006904 | Populus Rhizosphere | SLEGTQASGEGESHTQDANVAEVSYGEPVTGEPEYPDKPSTTRR* |
| Ga0081244_15348121 | 3300006939 | Tropical Rainforest Soil | MRTSLEGTQASGAGELPAQEANVADSSYGEPVIGETENPV* |
| Ga0075419_101963242 | 3300006969 | Populus Rhizosphere | VGMRTRLEGTQASGAGESHIQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0075435_1002073622 | 3300007076 | Populus Rhizosphere | MRTRLEGTQASGASESHTQEANVAEVSYGKAVIVEPEYPDNPSTIRR* |
| Ga0099830_111407241 | 3300009088 | Vadose Zone Soil | LRGTQASGASESHAQEANVAEISYGEPVSGEPEYPV* |
| Ga0114129_123824771 | 3300009147 | Populus Rhizosphere | MRTRLRGTQASGASESHAQEANVAEMSYGEPISGEPEYPV* |
| Ga0075423_113653301 | 3300009162 | Populus Rhizosphere | AQVGMRTRLEGTQASRAGESHTQEANVAEIGHGKPVIGKPEHPDKPSTARR* |
| Ga0126374_103450892 | 3300009792 | Tropical Forest Soil | MRPSSEGTQASGAGESPIQEANVAEVSYGEPVNGEPEYPENHGTTRR* |
| Ga0126384_111778182 | 3300010046 | Tropical Forest Soil | VGMRTRLEGTQASGAGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0126382_101704573 | 3300010047 | Tropical Forest Soil | MRTRLEGTQASGEDESHVQEANVAEASYGKPVTGEPEIPDKTSTTRRLL* |
| Ga0127479_10321951 | 3300010123 | Grasslands Soil | RLEGTQASGAGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0127479_10321953 | 3300010123 | Grasslands Soil | MRTRLEGTQASGAGESHTQDANVAEVNYGKPVIGEPEYPDKPWT |
| Ga0127443_11342842 | 3300010125 | Grasslands Soil | MGMRTRLGGTQASGEGESHTQEANVAEVSYGKTVIVEPEYPDKPSTIRR* |
| Ga0127464_10192041 | 3300010139 | Grasslands Soil | EQRSAQEGMRTRLEGTQASGEDELHIQEANVAEVSYGKPVSGEPECPV* |
| Ga0127503_103480311 | 3300010154 | Soil | MRTRLEGTQARGAGESHIQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0126370_110740191 | 3300010358 | Tropical Forest Soil | MGMRSSSEGKQASGAGETPTQEANVAEVSYGKPVIGEPEYPDKPSTTRWRAIWG |
| Ga0126376_116057931 | 3300010359 | Tropical Forest Soil | TQASRAGASHTQEANVAEIGQGKPVSGKPEHPDKPSTARR* |
| Ga0126372_119925062 | 3300010360 | Tropical Forest Soil | MRTRLEGTQARGAGASHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR |
| Ga0126377_115245822 | 3300010362 | Tropical Forest Soil | MRTRLRGTQARCEDASHIQEAHVAEVSHGEPVIGKPEHP |
| Ga0126377_116045081 | 3300010362 | Tropical Forest Soil | GTQASGAGESHAQEANVAEVSYGKPVMGEPEYPDNQPTTRR* |
| Ga0126379_114271912 | 3300010366 | Tropical Forest Soil | MRTRLEGTQARGAGESHTQDANVAEVNYGKPVSGEPE |
| Ga0126379_114663671 | 3300010366 | Tropical Forest Soil | SAQVGMRTRLEGTQASGAGESHTQDANVAEVNYGKPVSGKPEYPDKPWTTRR* |
| Ga0126379_131202611 | 3300010366 | Tropical Forest Soil | LEGTQASGAGESHAQEANVAEVNYGEPVIVESEFPV* |
| Ga0126381_1017297152 | 3300010376 | Tropical Forest Soil | VGMRPSSEGTQASGAGESPIQEANVAEVSYGEPVNGEPEYPEHHGTTRR* |
| Ga0126383_106048721 | 3300010398 | Tropical Forest Soil | MRPSLEGTQASGEDESHVQEANVAEASYGKPVIGEPEIPGNPST |
| Ga0126383_122348471 | 3300010398 | Tropical Forest Soil | MRPSSEGTQASGAGESPIQEANVAEVSYGEPVNGEPEYPEHHGTTRR* |
| Ga0137391_111716111 | 3300011270 | Vadose Zone Soil | GESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR* |
| Ga0137393_109488401 | 3300011271 | Vadose Zone Soil | TGMRTSLRGTQASGAGESHAQDANVAEVSYGKPVIGEPECPDKS* |
| Ga0137389_107586542 | 3300012096 | Vadose Zone Soil | ALTGMRTSLRGTQASGAGESHAQDANVAEVSYGKPVIGEPECPDKS* |
| Ga0137378_115889341 | 3300012210 | Vadose Zone Soil | HAGMRTSLRETQASREGESHAQEANVAEVSYGKPVTGEPEYPSENIRTTRR* |
| Ga0137377_105910292 | 3300012211 | Vadose Zone Soil | MRLNSGGTQVRGEGESHAQEAYIAEVSYGEPVIGKPEYSR* |
| Ga0137360_101322763 | 3300012361 | Vadose Zone Soil | MGMRTRLRGTQASGASESHAQEANVAEISYGEPVSGEPEYPV* |
| Ga0137361_109846662 | 3300012362 | Vadose Zone Soil | MRPSLEGTQASGAGESHIQEATVAEVSYGEPVNGEPEYPDNHGTTRR* |
| Ga0137361_110703251 | 3300012362 | Vadose Zone Soil | MRTRLEGTQASGAGESHIQEANVAEVSYGKAVIVEPEYPDNPSTIRRSSRAYWGDAL* |
| Ga0134034_12398041 | 3300012375 | Grasslands Soil | MRTRLGGTQASGEGESHTQEANVAEVSYGKTVIVEPEYPDKPSTIRR* |
| Ga0137358_106558811 | 3300012582 | Vadose Zone Soil | RTRLEGTQASGAGESHIQEANVAEVSYGKPVIGEPEYPDNQPTTRR* |
| Ga0137395_104220531 | 3300012917 | Vadose Zone Soil | MRPSLEGTQASGAGESHTPEANVAEVSYGEPVNGEPEYPDNHGTTRR* |
| Ga0137396_109256111 | 3300012918 | Vadose Zone Soil | SLEGTQASGAGESHIQEATVAEVSYGEPVNGEPEYPDNHGTTRR* |
| Ga0137419_116192222 | 3300012925 | Vadose Zone Soil | RGTQASGAGESHTQEANVAEVNYGEPVDGEPEYPV* |
| Ga0137404_102063821 | 3300012929 | Vadose Zone Soil | MRTRLEGTQTSGAGESHAQEANVAEVSYGETVIVEPEYPDQSSATRR |
| Ga0137407_101377592 | 3300012930 | Vadose Zone Soil | MGMRTSLEGTQASGEGESHAQEANVAEVSYGKPVTGEPEYPDNQPTTRR* |
| Ga0164302_107827501 | 3300012961 | Soil | MRTRLEGTQARGAGESHIHDANVAEVNYGKPIIGEPEYPDKPWTTRR* |
| Ga0126369_129277501 | 3300012971 | Tropical Forest Soil | MRPSLEGTQASGAGESHTQEANVAEVSYGETVIVESEYPDNSSTTRRSS* |
| Ga0126369_132888081 | 3300012971 | Tropical Forest Soil | VGMRTRLEGTQASGAGESHTQDANVAEVNYGEPVIGKSEFPV* |
| Ga0182033_101589002 | 3300016319 | Soil | AGESHAQEANVAEVSYGEAVIGEVESPDNREATRW |
| Ga0182037_105286461 | 3300016404 | Soil | GMRPSLEGTQASGAGESHAQEANVAEVSYGETVIVESEYPDNPSTTRRSS |
| Ga0182038_111026351 | 3300016445 | Soil | STPGGMRTSSEGTQASGAGELPAQEANVADSSYGEPVIGETENPV |
| Ga0182038_119504951 | 3300016445 | Soil | GTQASGAGESHAQEANVAEVSYGKAVIGEVESPDNREATRW |
| Ga0182038_119858171 | 3300016445 | Soil | EGTQASGAGESHAQEANVAEVSYGKPVMGEPEYPDNQPTTRR |
| Ga0184638_12376421 | 3300018052 | Groundwater Sediment | MRSSLRGTRASREGESHTQDANVTEVSHGEPVIGEPEYP |
| Ga0184626_100261692 | 3300018053 | Groundwater Sediment | GMRMSLGGTQASGEGKSHTQQANVAEVSHGKPVTGKPENPDKVLTTRR |
| Ga0184609_100142733 | 3300018076 | Groundwater Sediment | MSLGGTQASGEGKSHTQQANVAEVSHGKPITGKPENPDKVLTTRR |
| Ga0066669_103761722 | 3300018482 | Grasslands Soil | MRTRLEGTQASGAGESHTQEANVAEVSYGKAVIVEPEYPDKPSTIRR |
| Ga0179596_102915422 | 3300021086 | Vadose Zone Soil | EGESHTQDANVTEVSHGEPVIGEPEYPDNPQTTRR |
| Ga0209399_100192632 | 3300025157 | Thermal Springs | MPGGLSRQAGMRLSLGGTQARGEAESHGQDAYVAEVSYGKPVIGEPEHP |
| Ga0207712_116220051 | 3300025961 | Switchgrass Rhizosphere | MDAVLRLHQASGEDELHIQEANVAEVSYGKPVSGEPEDPDKPWTTRR |
| Ga0207668_106718241 | 3300025972 | Switchgrass Rhizosphere | RSQLSGYVGMRTRLEGTQARGAGESHAQEANVAEVSYGEPVIGKPEYPDNPSPTRRWS |
| Ga0209377_11754851 | 3300026334 | Soil | KREPRSAHAGMRTSLRETQASREGESHAQEANVAEVSYGKPVIGEPEYPSENIRTTRR |
| Ga0257159_10521301 | 3300026494 | Soil | MRTRLEGTQARGAGESHTQDANVAEVNYGKPVIGEPEYPDKPWTTRR |
| Ga0209156_103987291 | 3300026547 | Soil | MRTRLEGTQASGEDELHIQEANVAEVSYGKPVSGEPECP |
| Ga0209814_100926681 | 3300027873 | Populus Rhizosphere | MGMRTSLEGTQASGAGESHAQEANVAEVSYGKPVMGEPEYPDNQPTTRR |
| Ga0209465_101580682 | 3300027874 | Tropical Forest Soil | MRPSSEGTQASGAGESHIQEANVAEVSYGEPVNGEPEYPDNHGTTRR |
| Ga0209283_101039253 | 3300027875 | Vadose Zone Soil | MRTRLRGTQAHGAGESHTQEANVAEVNYGEPIDGEPEYPV |
| Ga0209481_104378431 | 3300027880 | Populus Rhizosphere | MRPSSEGTQASGAGESHIQEANVAEVSYGEPVNGEPEYPENHGTTQR |
| Ga0209590_108477761 | 3300027882 | Vadose Zone Soil | GTQASGAGESHTQEANVAEVSYGEPVSGEPEYPDNHRTTRR |
| Ga0207428_112248591 | 3300027907 | Populus Rhizosphere | PQMGMRTSLEGTQASGAGESHAQEANVAEVSYGKPVMGEPEYPDNQPTTRR |
| Ga0209382_102443142 | 3300027909 | Populus Rhizosphere | MRISLEGTQASGEGESHTQDANVAEVSYGEPVTGEPEYPDKPSTTRR |
| Ga0247648_11865001 | 3300030574 | Soil | GMRTSLRGKQASREAESHSQEANVAEVSYGEPVIGKPECPVNHGTTRR |
| Ga0247621_11555811 | 3300030683 | Soil | MRTSLRGKQASREAESHSQEANVAEVSYGEPVIGKPECPVNHGTTRR |
| Ga0308197_101066472 | 3300031093 | Soil | MRTSLRETQASREGESHAQEANVAEVSYGKPVTGEPEYP |
| Ga0308199_10212101 | 3300031094 | Soil | MRPSLEGTQASGAGESHIQEANVAEVSYGEPVNGEPEYPENHGTTRR |
| Ga0310887_103067782 | 3300031547 | Soil | ALSPQTGMRPSLEGTQASGEGESHPQEANVAEVSYGKPVIVEPEYPV |
| Ga0318546_105529171 | 3300031771 | Soil | MRTRLEGTQASGAGESHTQEANVAAVHHGEPVNGKPEYPDKVMNHPAVV |
| Ga0318557_105667892 | 3300031795 | Soil | MGMRSSSEGKQASGAGETPTQEANVAEVSYGEPVNGEPEYPDNHGTTRR |
| Ga0318520_110073531 | 3300031897 | Soil | SREDESHTQDANVTEVSHGEPVSGEPEYPDNPQPTRR |
| Ga0310909_108358292 | 3300031947 | Soil | GMRTRSEGTQASGEGESHAQDANVAEVSYGEAVIGEVESPDNREATRW |
| Ga0310909_113115371 | 3300031947 | Soil | MRTRLEGTQASGAGESHTQDANVAEVNYGKPVIGEPEYPDK |
| Ga0306926_126576231 | 3300031954 | Soil | MPGQLSVQVGMRTSLEGTQARGESESHAQEANVAEVSYGETGIVEPETPDNPSTT |
| Ga0307414_113673312 | 3300032004 | Rhizosphere | AGESHAQEANVAEVSYGKPVTGEPEYPSANIHTTRR |
| Ga0306924_103998912 | 3300032076 | Soil | MRTRLEGTQASGAGESHAQEANVAEVSYGKAVIGEPEYPDNPLTIRW |
| Ga0306924_107966062 | 3300032076 | Soil | MPEQLSVQAGMRTRLEGTQASGESESHVQEANVAEVSYGETGIVEPEIPDNPSTTRR |
| Ga0307472_1018795761 | 3300032205 | Hardwood Forest Soil | MRPSSEGTQARGAGESHIQDANVAEVNYGKPVIGEPEYPDKPWTTRR |
| Ga0306920_1015877701 | 3300032261 | Soil | SSEGTQASGAGESHAQEANVAEVSYGKPVMGEPEYPDNQPTTRR |
| Ga0247830_115991192 | 3300033551 | Soil | MRPSSEGTQASGAGESHIQEANVAEVSYGEPVNGEPEYPENHGTTRR |
| Ga0314788_058378_2_139 | 3300034666 | Soil | PAELSPQVGMRTRSEGTQASGEDESHVQQANVAEVNYGKPVIVEP |
| Ga0314797_101726_1_150 | 3300034672 | Soil | MRPSSEGTQARREAESHRQEAHVAEVSYGKPVSGKPEGSREVINSPAGVV |
| Ga0314797_101726_450_590 | 3300034672 | Soil | LSTQVGMRPSSEGTQARREVESHRQEAHVAEVSYGKPVSGKPERSR |
| ⦗Top⦘ |