| Basic Information | |
|---|---|
| Family ID | F050194 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 43 residues |
| Representative Sequence | GVEDDLRDGENVDTATERVYKFVENKLIEKTREVEEELKRGK |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 0.70 % |
| % of genes near scaffold ends (potentially truncated) | 97.24 % |
| % of genes from short scaffolds (< 2000 bps) | 88.28 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (77.931 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (14.483 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.345 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (58.621 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.14% β-sheet: 0.00% Coil/Unstructured: 52.86% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF03796 | DnaB_C | 33.10 |
| PF13662 | Toprim_4 | 1.38 |
| PF07733 | DNA_pol3_alpha | 0.69 |
| PF01807 | zf-CHC2 | 0.69 |
| PF07235 | DUF1427 | 0.69 |
| PF00154 | RecA | 0.69 |
| PF02811 | PHP | 0.69 |
| PF03819 | MazG | 0.69 |
| PF00082 | Peptidase_S8 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 33.10 |
| COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 33.10 |
| COG0358 | DNA primase (bacterial type) | Replication, recombination and repair [L] | 0.69 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.69 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.69 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.69 |
| COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.62 % |
| Unclassified | root | N/A | 21.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001836|RCM27_1028510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300002161|JGI24766J26685_10134973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 519 | Open in IMG/M |
| 3300004128|Ga0066180_10312518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300004240|Ga0007787_10052871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1821 | Open in IMG/M |
| 3300005517|Ga0070374_10145292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
| 3300005517|Ga0070374_10159790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
| 3300005517|Ga0070374_10196798 | Not Available | 1038 | Open in IMG/M |
| 3300005525|Ga0068877_10699035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300005528|Ga0068872_10381420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
| 3300005581|Ga0049081_10075604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1265 | Open in IMG/M |
| 3300005581|Ga0049081_10100115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1081 | Open in IMG/M |
| 3300005581|Ga0049081_10111486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1016 | Open in IMG/M |
| 3300005662|Ga0078894_10144217 | Not Available | 2134 | Open in IMG/M |
| 3300005662|Ga0078894_10226065 | Not Available | 1695 | Open in IMG/M |
| 3300005662|Ga0078894_10565880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1015 | Open in IMG/M |
| 3300005662|Ga0078894_11119155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
| 3300005662|Ga0078894_11432927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300005941|Ga0070743_10265766 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300006875|Ga0075473_10016024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2887 | Open in IMG/M |
| 3300006875|Ga0075473_10335475 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300007559|Ga0102828_1014394 | Not Available | 1660 | Open in IMG/M |
| 3300007559|Ga0102828_1018068 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1510 | Open in IMG/M |
| 3300007590|Ga0102917_1067363 | Not Available | 1261 | Open in IMG/M |
| 3300007600|Ga0102920_1133547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 794 | Open in IMG/M |
| 3300007603|Ga0102921_1174202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300007603|Ga0102921_1323115 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 549 | Open in IMG/M |
| 3300007624|Ga0102878_1050391 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1271 | Open in IMG/M |
| 3300007651|Ga0102900_1148318 | Not Available | 517 | Open in IMG/M |
| 3300007658|Ga0102898_1140896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300007972|Ga0105745_1085514 | Not Available | 913 | Open in IMG/M |
| 3300007992|Ga0105748_10067342 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1401 | Open in IMG/M |
| 3300008052|Ga0102893_1213241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300008107|Ga0114340_1250362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300008108|Ga0114341_10138253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1431 | Open in IMG/M |
| 3300008108|Ga0114341_10311037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
| 3300008108|Ga0114341_10445927 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 607 | Open in IMG/M |
| 3300008110|Ga0114343_1224009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 524 | Open in IMG/M |
| 3300008111|Ga0114344_1100969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
| 3300008113|Ga0114346_1000863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58444 | Open in IMG/M |
| 3300008113|Ga0114346_1221381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 734 | Open in IMG/M |
| 3300008116|Ga0114350_1103868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
| 3300008120|Ga0114355_1258565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300008259|Ga0114841_1123848 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1075 | Open in IMG/M |
| 3300008262|Ga0114337_1258172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300008262|Ga0114337_1322844 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
| 3300008267|Ga0114364_1035759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1899 | Open in IMG/M |
| 3300009158|Ga0114977_10672499 | Not Available | 553 | Open in IMG/M |
| 3300009161|Ga0114966_10125353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1698 | Open in IMG/M |
| 3300009161|Ga0114966_10580756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
| 3300009164|Ga0114975_10302181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 886 | Open in IMG/M |
| 3300009164|Ga0114975_10560768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300009181|Ga0114969_10688642 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300009223|Ga0103850_1024655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
| 3300009419|Ga0114982_1098277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300010312|Ga0102883_1093625 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300010370|Ga0129336_10644178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300010388|Ga0136551_1055754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
| 3300011268|Ga0151620_1185438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300012000|Ga0119951_1056708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1088 | Open in IMG/M |
| 3300012667|Ga0157208_10022256 | Not Available | 850 | Open in IMG/M |
| 3300013004|Ga0164293_10037873 | Not Available | 3967 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10359107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
| (restricted) 3300013131|Ga0172373_10754119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
| 3300017788|Ga0169931_10080869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3231 | Open in IMG/M |
| 3300017788|Ga0169931_10935996 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300020083|Ga0194111_10131141 | Not Available | 1946 | Open in IMG/M |
| 3300020083|Ga0194111_10857824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300020084|Ga0194110_10303739 | Not Available | 1126 | Open in IMG/M |
| 3300020155|Ga0194050_1033503 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 1400 | Open in IMG/M |
| 3300020190|Ga0194118_10420555 | Not Available | 669 | Open in IMG/M |
| 3300020193|Ga0194131_10116562 | Not Available | 1400 | Open in IMG/M |
| 3300020493|Ga0208591_1019190 | Not Available | 877 | Open in IMG/M |
| 3300020519|Ga0208223_1000366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 11363 | Open in IMG/M |
| 3300020519|Ga0208223_1000681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 8038 | Open in IMG/M |
| 3300020528|Ga0208224_1012509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1277 | Open in IMG/M |
| 3300020603|Ga0194126_10080466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2765 | Open in IMG/M |
| 3300020603|Ga0194126_10354669 | Not Available | 954 | Open in IMG/M |
| 3300021424|Ga0194117_10350761 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300021519|Ga0194048_10290070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300021956|Ga0213922_1033201 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1223 | Open in IMG/M |
| 3300023174|Ga0214921_10040342 | Not Available | 4325 | Open in IMG/M |
| 3300024346|Ga0244775_10279709 | Not Available | 1386 | Open in IMG/M |
| 3300024346|Ga0244775_10765070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
| 3300024348|Ga0244776_10164032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1608 | Open in IMG/M |
| 3300024348|Ga0244776_10854484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
| 3300024357|Ga0255165_1031783 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300024503|Ga0255152_1000559 | Not Available | 9571 | Open in IMG/M |
| 3300024505|Ga0255150_1000718 | Not Available | 8703 | Open in IMG/M |
| 3300024865|Ga0256340_1166280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300025732|Ga0208784_1182701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300026455|Ga0255155_1055578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 664 | Open in IMG/M |
| 3300026457|Ga0255160_1020764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1176 | Open in IMG/M |
| 3300027139|Ga0255082_1046751 | Not Available | 680 | Open in IMG/M |
| 3300027144|Ga0255102_1046167 | Not Available | 707 | Open in IMG/M |
| 3300027155|Ga0255081_1008882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Trinavirus | 2422 | Open in IMG/M |
| 3300027242|Ga0208806_1039148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300027329|Ga0255109_1092028 | Not Available | 632 | Open in IMG/M |
| 3300027586|Ga0208966_1206564 | Not Available | 500 | Open in IMG/M |
| 3300027600|Ga0255117_1038612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1008 | Open in IMG/M |
| 3300027601|Ga0255079_1020620 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1523 | Open in IMG/M |
| 3300027621|Ga0208951_1107453 | Not Available | 756 | Open in IMG/M |
| 3300027697|Ga0209033_1173366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300027710|Ga0209599_10195529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300027732|Ga0209442_1184254 | Not Available | 783 | Open in IMG/M |
| 3300027744|Ga0209355_1305127 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300027754|Ga0209596_1121741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1199 | Open in IMG/M |
| 3300027770|Ga0209086_10395337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300027782|Ga0209500_10444882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300027816|Ga0209990_10155991 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
| 3300027892|Ga0209550_10374918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
| 3300027892|Ga0209550_10415801 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
| 3300028025|Ga0247723_1007445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Samistivirus → Streptomyces virus Jay2Jay → Streptomyces phage Jay2Jay | 4638 | Open in IMG/M |
| 3300028025|Ga0247723_1030997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1685 | Open in IMG/M |
| (restricted) 3300028571|Ga0247844_1082677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1570 | Open in IMG/M |
| 3300031758|Ga0315907_10242505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1497 | Open in IMG/M |
| 3300031758|Ga0315907_10266671 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1415 | Open in IMG/M |
| 3300031758|Ga0315907_10712848 | Not Available | 761 | Open in IMG/M |
| 3300031787|Ga0315900_10225465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1629 | Open in IMG/M |
| 3300031787|Ga0315900_10402181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1080 | Open in IMG/M |
| 3300031787|Ga0315900_10874219 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300031857|Ga0315909_10221648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1478 | Open in IMG/M |
| 3300031963|Ga0315901_10296014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1343 | Open in IMG/M |
| 3300032050|Ga0315906_10197064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1899 | Open in IMG/M |
| 3300032050|Ga0315906_10258368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1595 | Open in IMG/M |
| 3300032050|Ga0315906_10791143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300032050|Ga0315906_10847291 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
| 3300032116|Ga0315903_10946864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 609 | Open in IMG/M |
| 3300032116|Ga0315903_11146757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 529 | Open in IMG/M |
| 3300033557|Ga0316617_102598051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
| 3300033981|Ga0334982_0466032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300034013|Ga0334991_0132857 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1153 | Open in IMG/M |
| 3300034019|Ga0334998_0428211 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 753 | Open in IMG/M |
| 3300034051|Ga0335024_0418833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 666 | Open in IMG/M |
| 3300034063|Ga0335000_0403685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 812 | Open in IMG/M |
| 3300034066|Ga0335019_0027844 | Not Available | 3904 | Open in IMG/M |
| 3300034068|Ga0334990_0282052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
| 3300034071|Ga0335028_0408781 | Not Available | 773 | Open in IMG/M |
| 3300034082|Ga0335020_0366333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300034093|Ga0335012_0116866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1478 | Open in IMG/M |
| 3300034101|Ga0335027_0574755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 691 | Open in IMG/M |
| 3300034102|Ga0335029_0620082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300034120|Ga0335056_0631024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 550 | Open in IMG/M |
| 3300034166|Ga0335016_0027040 | All Organisms → Viruses → Predicted Viral | 4736 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 12.41% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.66% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 9.66% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 9.66% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 8.28% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.21% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.52% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.76% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.76% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.07% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.07% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 1.38% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.38% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.38% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.69% |
| Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.69% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.69% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.69% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.69% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001836 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300004128 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007590 | Estuarine microbial communities from the Columbia River estuary - metaG 1562A-02 | Environmental | Open in IMG/M |
| 3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
| 3300007603 | Estuarine microbial communities from the Columbia River estuary - metaG 1568-02 | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007651 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-3 | Environmental | Open in IMG/M |
| 3300007658 | Estuarine microbial communities from the Columbia River estuary - metaG 1555A-3 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009223 | Microbial communities of water from Amazon river, Brazil - RCM3 | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
| 3300020155 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L239-10m | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
| 3300020493 | Freshwater microbial communities from Lake Mendota, WI - 14NOV2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
| 3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300024503 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h | Environmental | Open in IMG/M |
| 3300024505 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300024865 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026455 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepC_8h | Environmental | Open in IMG/M |
| 3300026457 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027139 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300027144 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300027155 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h | Environmental | Open in IMG/M |
| 3300027242 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027329 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027601 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepB_8h | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028571 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| RCM27_10285102 | 3300001836 | Marine Plankton | YESIKIGIGVEDTVREGETVNTATERVYQFVEEKLIQKTTEVEEELKGGK* |
| JGI24766J26685_101349731 | 3300002161 | Freshwater And Sediment | IGVEDTVRQGENVDSATERVYKFVEXKLIEKTREVEEELKRGK* |
| Ga0066180_103125181 | 3300004128 | Freshwater Lake | VEDDLRLGENVELATERVYKFVEDKLIEKTREVEEELKRGK* |
| Ga0007787_100528711 | 3300004240 | Freshwater Lake | GNYESIRINIGVEDDVRNGENVDSATERVYTFVENKLIEKTREVEQELKNGK* |
| Ga0070374_101452921 | 3300005517 | Freshwater Lake | IKIGVGIEDDVRQGETVDAATERIYAFVENKLIQKTQEVEEELKRGK* |
| Ga0070374_101597903 | 3300005517 | Freshwater Lake | SGETVDSATERVYAFVERKLVQKTSEVEEELKSGKQ* |
| Ga0070374_101967981 | 3300005517 | Freshwater Lake | VEDNVRDGENVDTATERVYKFVEEKLIEKTSEIEKELKNGK* |
| Ga0068877_106990351 | 3300005525 | Freshwater Lake | GENVDSATERVYKFVEEKLIQKTREVEEELSGGKK* |
| Ga0068872_103814201 | 3300005528 | Freshwater Lake | SIRINVGVEDDVRKGENVETATERVYAFVENKLIQKTREVEKELNSGK* |
| Ga0049081_100756043 | 3300005581 | Freshwater Lentic | INVGVEDDVRKGENVETATERVYAFVENKLIQKTREVEKELNSGK* |
| Ga0049081_101001153 | 3300005581 | Freshwater Lentic | GENVDSATERVYAFVENKLIEKTREVEKELKSGK* |
| Ga0049081_101114861 | 3300005581 | Freshwater Lentic | GNYESIRINVGVEDDVRKGENVETATERVYAFVENKLIQKTREVEKELNSGK* |
| Ga0078894_101442171 | 3300005662 | Freshwater Lake | YESIRINIGVEDDVRNGENVDSATERVYTFVENKLIEKTREVEQELKNGK* |
| Ga0078894_102260651 | 3300005662 | Freshwater Lake | GVEDDLRDGENVDTATERVYKFVENKLIEKTREVEEELKRGK* |
| Ga0078894_105658803 | 3300005662 | Freshwater Lake | REGENADTATERVYQFVESKLIEKTREVEEELSSRGK* |
| Ga0078894_111191551 | 3300005662 | Freshwater Lake | SIRINVGVEDDVRKGENVETATERVYAFVENKLIEKTREVEKELKNGK* |
| Ga0078894_114329273 | 3300005662 | Freshwater Lake | ESIKIGVGIEDDVRQGETVDAATERIYAFVENKLIQKTQEVEEELKRGK* |
| Ga0070743_102657663 | 3300005941 | Estuarine | RIGLGVEDWVREGENADTATERVYQFVESKLIEKTREVEEELSSRGK* |
| Ga0075473_100160241 | 3300006875 | Aqueous | ENVDSATERIYKFVEDKLIQKTREVEEELSGGKK* |
| Ga0075473_103354753 | 3300006875 | Aqueous | DTVRQGENVDSATERVYKFVEDKLIEKTREVEEELKRGK* |
| Ga0099848_10147134 | 3300007541 | Aqueous | VEDFVREEENVDKAMERVYAFVEKKLVEKVATIDSELKK* |
| Ga0102828_10143944 | 3300007559 | Estuarine | GVGIEDDLRDGENVDTATERVYKFVEDKLIEKTREVEEELKRGK* |
| Ga0102828_10180681 | 3300007559 | Estuarine | KIGVGIEDDVRQGETVDAATERVYAFVENKLIQKTQEVEEELKRGKQ* |
| Ga0102917_10673633 | 3300007590 | Estuarine | ESIKIGVGVEDDLRDGENVDTATERVYKFVENKLIEKTREVEEELKRGK* |
| Ga0102920_11335473 | 3300007600 | Estuarine | YESIKVSVGVEDFVRSDENVDKATERVYAFVEGKLIEKMQEIETELKS* |
| Ga0102921_11742023 | 3300007603 | Estuarine | VRQGETVDAATERVYAFVESKLIEKTQEVEEELKRGK* |
| Ga0102921_13231153 | 3300007603 | Estuarine | RSGENVDTATERVYKFVEEKLIQKTQEVEEELKRGK* |
| Ga0102878_10503913 | 3300007624 | Estuarine | ESIKIGIGVEDDVRQGEHVDAATERVYKFVEEKLIQKTQEVEEELKRGK* |
| Ga0102900_11483183 | 3300007651 | Estuarine | SGENVDTATERVYKFVEDKLIQKTREVEEELKRGK* |
| Ga0102898_11408961 | 3300007658 | Estuarine | RQGENADSATDRVYKFVEEKLIEKTAEMEEELKGGK* |
| Ga0105745_10855141 | 3300007972 | Estuary Water | IEDDLRDGENVDAATERVYKFVEDKLIEKTREVEEELKRGK* |
| Ga0105748_100673423 | 3300007992 | Estuary Water | DDLRSGENVDTATERVYKFVEDKLIQKTREGEEELKRGK* |
| Ga0105748_101487931 | 3300007992 | Estuary Water | SIGVEDFLRSEENVDKATERVYAFVEGKLIEKMQEIEKELKS* |
| Ga0102893_12132413 | 3300008052 | Estuarine | GETVDAATERVYAFVESKLVQKTSEVEEELKSGK* |
| Ga0114340_12503621 | 3300008107 | Freshwater, Plankton | IRINVGVEDDVRKGENVETATERVYAFVENKLIEKTREVEKELKNGK* |
| Ga0114341_101382531 | 3300008108 | Freshwater, Plankton | IKIGIGVDDFVRDGETVDDATERVYKFVESKLIAKTQEVEEELNGSK* |
| Ga0114341_103110373 | 3300008108 | Freshwater, Plankton | GETATTATERVYKFVEEKLIEKTREVEKELSGGK* |
| Ga0114341_104459271 | 3300008108 | Freshwater, Plankton | NVGVEDDVRKGENVETATERVYAFVENKLIEKTREVEKELKNGK* |
| Ga0114343_12240091 | 3300008110 | Freshwater, Plankton | VEDDVRKGENVETATERVYAFVENKLIEKTREVEKELKNGK* |
| Ga0114344_11009693 | 3300008111 | Freshwater, Plankton | GENVETATERVYAFVENKLIQKTREVEKELNSGK* |
| Ga0114346_100086324 | 3300008113 | Freshwater, Plankton | VTTRVKVDTATERVYKFVEDKLIEKTREVEEELKSGK* |
| Ga0114346_12213813 | 3300008113 | Freshwater, Plankton | FVRDGENVDSATERVYEFVESKLIEKTREVEEELRGK* |
| Ga0114350_11038683 | 3300008116 | Freshwater, Plankton | LGNYESIRINVGVEDDVRKGENVETATERVYAFVENKLIQKTREVEKELNSGK* |
| Ga0114355_12585652 | 3300008120 | Freshwater, Plankton | IRINVGVEDDVRKGENVETATERVYAFVENKLIQKTREVEKELNSGK* |
| Ga0114841_11238481 | 3300008259 | Freshwater, Plankton | IGVEDDVRSGENVNSATERVYKFVEEKLIEKTREVEKELNNGK* |
| Ga0114337_12581721 | 3300008262 | Freshwater, Plankton | SIKIGIGVEDNVRSGENVDTATERVYAFVENKLIEKTREVEEELKRGK* |
| Ga0114337_13228441 | 3300008262 | Freshwater, Plankton | NYESIRINIGVEDDVRKGENVDAATERVYAFVENKLIEKTREVEKELNSGK* |
| Ga0114364_10357591 | 3300008267 | Freshwater, Plankton | IEDNVRSGENVDTATERVYAFVENKLIEKTREVEEELKRAK* |
| Ga0114977_106724991 | 3300009158 | Freshwater Lake | IGVGIEDDLRDGENVDAATERVYKFVEDKLIEKTREVEEELKRGK* |
| Ga0114966_101253533 | 3300009161 | Freshwater Lake | VGIEDDLRDGENVDAATERVYKFVEEKLIEKTREVEEELKRGK* |
| Ga0114966_105807561 | 3300009161 | Freshwater Lake | FVREGETVDAAADRVYKFVEDKLIQKTQEVEEELRGSK* |
| Ga0114975_103021813 | 3300009164 | Freshwater Lake | EDDLRSGENVDTATERVYKFVEDKLIQKTREVEEELKRGK* |
| Ga0114975_105607683 | 3300009164 | Freshwater Lake | SIKIGIGIEDIVRHGETVETATERVYKFVEEKLIQKTTEVEEELKSGK* |
| Ga0114969_106886423 | 3300009181 | Freshwater Lake | GNYESIKIGVGIEDDVRQGETVDAATERVYAFVESKLIEKTQEVEEELKRGK* |
| Ga0103850_10246553 | 3300009223 | River Water | LGNYESIKIGIGIEDFVRSGETVESATERVYAFVENKLIEKTQEIEKELKNNG* |
| Ga0114982_10982771 | 3300009419 | Deep Subsurface | SVGVEDDVRNGETVDAATERVYAFVENKLIQKTSEVEKELSNGK* |
| Ga0102883_10936253 | 3300010312 | Estuarine | IGVGIEDDLRSGENVDTATERVYKFVEDKLIQKTREVEEELKRGK* |
| Ga0129336_106441781 | 3300010370 | Freshwater To Marine Saline Gradient | GENADTATERVYKFVEEKLIQKTREVEEELKSGK* |
| Ga0136551_10557543 | 3300010388 | Pond Fresh Water | SIKIGIGIEDDIRQGETVDSATERVYEFVENKLIEKTREVEEELKRGK* |
| Ga0151620_11854381 | 3300011268 | Freshwater | EDDVRQGETVEAATERVYTFVENKLIQKTEEVEEELKRGK* |
| Ga0119951_10567083 | 3300012000 | Freshwater | GVGVEDDLREGENVDAATERVYKFVEDKLIEKTREVEEELKNGK* |
| Ga0157208_100222561 | 3300012667 | Freshwater | YESIKIGIGVEDIVRQGENVDTATERVYEFVESKLIEKTREVEEELKRGK* |
| Ga0164293_100378736 | 3300013004 | Freshwater | YESIRINVGVEDDVRKGENVETATERVYAFVENKLIEKTREVEKELNSGK* |
| (restricted) Ga0172373_103591073 | 3300013131 | Freshwater | VGVEDDVRKGENVETATERVYAFVENKLIQKTREVEKELNNGK* |
| (restricted) Ga0172373_107541193 | 3300013131 | Freshwater | VGVEDDVRKGENVETATERVYAFVENKLIQKTREVEKELNSGK* |
| Ga0169931_100808695 | 3300017788 | Freshwater | IGVGIEDWVRDGETADSATERVYKFVENKLIEKTREIEQELKSGK |
| Ga0169931_109359961 | 3300017788 | Freshwater | IGLGVEDIVRSGENVTSATERVYKFVEEKIIEKTREVEEELRGSKK |
| Ga0194111_101311411 | 3300020083 | Freshwater Lake | VEDDVRKGENVDSATERVYAFVESKLIEKTREVEKELNSGKT |
| Ga0194111_108578241 | 3300020083 | Freshwater Lake | GIGVEDDVRKGENVDSATERVYAFVESKLIEKTREVEKELNSGK |
| Ga0194110_103037391 | 3300020084 | Freshwater Lake | NYESVRIGIGVEDDVRKGENVDSATERVYAFVESKLIEKTREVEKELNSGKT |
| Ga0194050_10335031 | 3300020155 | Anoxic Zone Freshwater | LGVQDYVRDGENVNAAMDRVYAFVEDKLITKMEEIEKELKG |
| Ga0194118_104205551 | 3300020190 | Freshwater Lake | ENIKINIGVEDDVRKGENVDLATERVYAFVENKLIQKTREVEEELKSGK |
| Ga0194131_101165621 | 3300020193 | Freshwater Lake | EDDVRKGENVDSATERVYAFVESKLIEKTREVEKELNSGKT |
| Ga0208591_10191903 | 3300020493 | Freshwater | NVRNGENVDTATERVYKFVEEKLIEKTQEIEKELKDGKXSSHFPGXKK |
| Ga0208223_100036618 | 3300020519 | Freshwater | GVEDDVRKGENVETATERVYAFVENKLIEKTREVEKELKNGK |
| Ga0208223_10006819 | 3300020519 | Freshwater | GVEDDVRKGENVETATERVYAFVENKLIEKTREVEKELNSGK |
| Ga0208224_10125093 | 3300020528 | Freshwater | KIGVGVEDSVRDGETVNDATERVYKFVEDKLIEKTQDIEKELKSGK |
| Ga0194126_100804664 | 3300020603 | Freshwater Lake | DVRKGENVDSATERVYAFVESKLIEKTREVEKELNSGKT |
| Ga0194126_103546693 | 3300020603 | Freshwater Lake | GIGVEDSVRSGETVSAATERVYKFVEDKLIEKTREIEEELKGGKTGH |
| Ga0194117_103507611 | 3300021424 | Freshwater Lake | IGVEDDVRKGENVDSATERVYAFVESKLIEKTREVEKELNSGK |
| Ga0194048_102900701 | 3300021519 | Anoxic Zone Freshwater | DLRDGENVDTATERVYKFVEDKLIEKTREVEEELKRGK |
| Ga0213922_10332013 | 3300021956 | Freshwater | IGIGIEDIVRQGETVDTATERVYKFVEEKLIQKTIEVEEELKSGK |
| Ga0214921_100403421 | 3300023174 | Freshwater | NYESIKIGIGIEDDVRQGETVDAATERVYAFVENKLIEKTQEVEEELKRGK |
| Ga0244775_102797091 | 3300024346 | Estuarine | RSGENVDTATERVYKFVEEKLIQKTREVEEELKRGK |
| Ga0244775_107650703 | 3300024346 | Estuarine | EDDLRSGENVDTATERVYKFVEDKLIQKTREVEEELKRGK |
| Ga0244776_101640323 | 3300024348 | Estuarine | DLRSGENVDTATERVYKFVEDKLIQKTREVEEELKRGK |
| Ga0244776_108544843 | 3300024348 | Estuarine | HGETVSVATERVYKFVEEKLIEKTREIEKELSVSDKQ |
| Ga0255165_10317833 | 3300024357 | Freshwater | IKIGIGIEDWVRDGENVDSATERVYKFVEDKLVEKTREVEEELKRGK |
| Ga0255152_10005591 | 3300024503 | Freshwater | EDDVRQGETVDAATERVYGFVENKLIEKTQEVEEELKRGK |
| Ga0255150_10007181 | 3300024505 | Freshwater | VRSGENVDSATERIYKFVEDKLIQKTREVEEELSGGKK |
| Ga0256340_11662801 | 3300024865 | Freshwater | GIGVEDWVRDGENADSATERVYKFVEDKLIQKTREIEEELKSGK |
| Ga0208784_11827011 | 3300025732 | Aqueous | DTVRQGENVDSATERVYKFVEDKLIEKTREVEEELKRGK |
| Ga0255155_10555781 | 3300026455 | Freshwater | VRQGETVDAATERVYGFVENKLIEKTQEVEEELKRGK |
| Ga0255160_10207643 | 3300026457 | Freshwater | IGVEDWVRDGENADSATERVYKFVEDKLIQKTREIEEELKSGK |
| Ga0255082_10467511 | 3300027139 | Freshwater | VGVEDDLRSGESVDAATERVYKFVEDKLIQKTREVEEELKSGK |
| Ga0255102_10461673 | 3300027144 | Freshwater | KRDEENIDQAFERVYKFVENKLIEKSNEAKEFKSE |
| Ga0255081_10088821 | 3300027155 | Freshwater | GVGVEDDLRSGESVDAATERVYKFVEDKLIQKTREVEEELKSGK |
| Ga0208806_10391483 | 3300027242 | Estuarine | NIGVEDIVRSGENVDTATERVYKFVEEKLIQKTQEVEEELKRGK |
| Ga0255109_10920283 | 3300027329 | Freshwater | IEDDLRDGENVDAATERVYKFVEDKLIEKTREVEEELKRGK |
| Ga0208966_12065641 | 3300027586 | Freshwater Lentic | IGVEDDVRSGENVDSATERVYKFVEEKLIKKTQEIEEELNSGK |
| Ga0255117_10386121 | 3300027600 | Freshwater | KIGIGIEDDVRQGENVDTATERVYAFVENKLIEKTREVEEELKRGK |
| Ga0255079_10206203 | 3300027601 | Freshwater | GVEDDLRSGETVNVATERVYKFVEEKLIEKTREVEEELKRGK |
| Ga0208951_11074531 | 3300027621 | Freshwater Lentic | VRSGENVDSATERVYKFVEEKLIKKTQEIEEELNSGK |
| Ga0209033_11733663 | 3300027697 | Freshwater Lake | KIGIGVDDFVREGETVDTAADRVYKFVEDKLIQKTQEVEEELRGSK |
| Ga0209599_101955291 | 3300027710 | Deep Subsurface | SVGVEDDVRNGETVDAATERVYAFVENKLIQKTSEVEKELSNGK |
| Ga0209442_11842541 | 3300027732 | Freshwater Lake | ISIGVEDDVRSGENVDSATERVYKFVEEKLIKKTQEIEEELNSGK |
| Ga0209355_13051273 | 3300027744 | Freshwater Lake | IEDDLRSGENVDTATERVYKFVEEKLIQKTREVEEELKRGK |
| Ga0209596_11217413 | 3300027754 | Freshwater Lake | RINIGVEDDVRSGENVDSATERVYAFVENKLIEKTREVEKELKSGK |
| Ga0209086_103953372 | 3300027770 | Freshwater Lake | MKEDDVRSGETVDSATERVYAFVENKLVQKTSEVEEELKSGKQ |
| Ga0209500_104448821 | 3300027782 | Freshwater Lake | YESIRINIGVEDDVRSGENVDSATERVYAFVENKLIEKTREVEKELKSGK |
| Ga0209990_101559911 | 3300027816 | Freshwater Lake | QGETVDAATERVYAFVEGKLIAKTAEVEEELKNGK |
| Ga0209550_103749183 | 3300027892 | Freshwater Lake | KINVGVEDDVRSGETVDAATERVYAFVENKLIQKTAEVEEELKSGK |
| Ga0209550_104158013 | 3300027892 | Freshwater Lake | DLRAGENVDTATERVYKFVEDKLIEKTREVEEELKRGK |
| Ga0247723_10074451 | 3300028025 | Deep Subsurface Sediment | GVEDSVRDGETVNDATERVYKFVENKLIEKTQDIEKELKSGK |
| Ga0247723_10309971 | 3300028025 | Deep Subsurface Sediment | GIEDNVRQGENVDTATERVYKFVEDKLIEKTREVEEELSSRGK |
| (restricted) Ga0247844_10826771 | 3300028571 | Freshwater | RINVGVEDDVRKGENVETATERVYAFVENKLIQKTREVEKELNSGK |
| Ga0315907_102425051 | 3300031758 | Freshwater | VRDGENADSATERVYQFVENKLIEKTREVEEELKRGKQ |
| Ga0315907_102666713 | 3300031758 | Freshwater | DFVRSGETADSATERVYKFVEDKLIEKTREIEEELKSGK |
| Ga0315907_107128481 | 3300031758 | Freshwater | IGIEDIVRSGETVNAATERVYKFVEEKLIEKTREVEEELKGGKTKS |
| Ga0315900_102254653 | 3300031787 | Freshwater | GVEDFVRDGENADSATERVYKFVEDKLIQKTREIEEELKSGK |
| Ga0315900_104021811 | 3300031787 | Freshwater | VEDDVRQGENVDTATERVYKFVEEKLIQKTREVEEELKSGK |
| Ga0315900_108742191 | 3300031787 | Freshwater | YESIRINVGVEDDVRKGENVETATERVYAFVENKLIEKTREVEKELKNGK |
| Ga0315909_102216483 | 3300031857 | Freshwater | DVRKGENVDAATERVYAFVENKLIEKTREVEKELNSGK |
| Ga0315901_102960141 | 3300031963 | Freshwater | NYESIRINVGVEDDVRKGENVETATERVYAFVENKLIEKTREVEKELKNGK |
| Ga0315906_101970644 | 3300032050 | Freshwater | RKGENVETATERVYAFVENKLIEKTREVEKELNSGK |
| Ga0315906_102583683 | 3300032050 | Freshwater | DIVRSGENVDSATERVYKFVEEKLIQKTREVEEELSGGKK |
| Ga0315906_107911433 | 3300032050 | Freshwater | DVRSGETATTATERVYKFVEEKLIEKTREVEKELSGGK |
| Ga0315906_108472913 | 3300032050 | Freshwater | INIGVEDDVRNGENVDSATERVYTFVENKLIEKTREVEQELKNGK |
| Ga0315903_109468643 | 3300032116 | Freshwater | IRINIGVEDDVRKGENVDAATERVYAFVENKLIEKTREVEKELNSGK |
| Ga0315903_111467571 | 3300032116 | Freshwater | DNVRSGENVDTATERVYAFVENKLIEKTREVEEELKRGK |
| Ga0316617_1025980511 | 3300033557 | Soil | IKIGIGIEDWVRDGENADTATERVYKFVEDKLIEKTREVEEELKHGK |
| Ga0334982_0466032_410_562 | 3300033981 | Freshwater | YESIKIGIGVEDDVRQGETVDAATERVYTFVENKLIEKTQEVEEELKRGK |
| Ga0334991_0132857_1043_1153 | 3300034013 | Freshwater | RQGETVDAATERVYAFVESKLIEKTQEVEEELKSGK |
| Ga0334998_0428211_613_753 | 3300034019 | Freshwater | IGIGVEDIVRSGENVDSATERVYKFVEDKLIQKTREVEEELSGGKK |
| Ga0335024_0418833_1_111 | 3300034051 | Freshwater | REGETVDAAADRVYKFVEDKLIQKTQEVEEELRGSK |
| Ga0335000_0403685_1_123 | 3300034063 | Freshwater | EDDVRKGENVETATERVYAFVENKLIEKTREVEKELNSGK |
| Ga0335019_0027844_1_117 | 3300034066 | Freshwater | FVRDGETVDAAADRVYKFVEDKLIQKTQEVEEELRGSK |
| Ga0334990_0282052_2_151 | 3300034068 | Freshwater | ESIKIGIGVEDDLRLGENVESATERVYKFVEDKLIEKTREVEEELKRGK |
| Ga0335028_0408781_1_108 | 3300034071 | Freshwater | KRDDENIDQAFERVYKFVENKLIEKSNEAKEFKSE |
| Ga0335020_0366333_1_132 | 3300034082 | Freshwater | VGIEDDVRSGENVDAATERVYKFVENKLIEKTTEIEKELKDGK |
| Ga0335012_0116866_1_141 | 3300034093 | Freshwater | KIGIGVEDDLRLGENVESATERVYKFVEDKLIEKTREVEEELKRGK |
| Ga0335027_0574755_3_161 | 3300034101 | Freshwater | GNYESIRINVGVEDDVRKGENVETATERVYAFVENKLIEKTREVEKELNSGK |
| Ga0335029_0620082_3_113 | 3300034102 | Freshwater | RDGETVNDATERVYKFVENKLIEKTQDIEKELKSGK |
| Ga0335056_0631024_1_117 | 3300034120 | Freshwater | DLRLGETVDFATERVYKFVEDKLIQKTREVEEELKSAK |
| Ga0335016_0027040_3_128 | 3300034166 | Freshwater | VEDDVRKGENVETATERVYAFVENKLIEKTREVEKELKNGK |
| ⦗Top⦘ |