Basic Information | |
---|---|
Family ID | F050193 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 145 |
Average Sequence Length | 44 residues |
Representative Sequence | MKVAVVTPTIASEHLAQCIDSVDKQTYKDLTHYIFIDGCQYE |
Number of Associated Samples | 116 |
Number of Associated Scaffolds | 145 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 60.43 % |
% of genes near scaffold ends (potentially truncated) | 94.48 % |
% of genes from short scaffolds (< 2000 bps) | 82.07 % |
Associated GOLD sequencing projects | 107 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (65.517 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (22.069 % of family members) |
Environment Ontology (ENVO) | Unclassified (71.724 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (73.793 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 15.71% β-sheet: 0.00% Coil/Unstructured: 84.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 145 Family Scaffolds |
---|---|---|
PF09293 | RNaseH_C | 27.59 |
PF01467 | CTP_transf_like | 21.38 |
PF02739 | 5_3_exonuc_N | 6.21 |
PF01050 | MannoseP_isomer | 4.83 |
PF03692 | CxxCxxCC | 1.38 |
PF04308 | RNaseH_like | 0.69 |
PF00535 | Glycos_transf_2 | 0.69 |
PF00908 | dTDP_sugar_isom | 0.69 |
PF01261 | AP_endonuc_2 | 0.69 |
PF13580 | SIS_2 | 0.69 |
COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
---|---|---|---|
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 6.21 |
COG1898 | dTDP-4-dehydrorhamnose 3,5-epimerase or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 65.52 % |
All Organisms | root | All Organisms | 34.48 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001838|RCM33_1029623 | Not Available | 530 | Open in IMG/M |
3300001849|RCM26_1094666 | Not Available | 858 | Open in IMG/M |
3300001850|RCM37_1135595 | Not Available | 731 | Open in IMG/M |
3300001851|RCM31_10120111 | Not Available | 1247 | Open in IMG/M |
3300002476|metazooDRAFT_10804984 | Not Available | 602 | Open in IMG/M |
3300003277|JGI25908J49247_10101195 | Not Available | 694 | Open in IMG/M |
3300003388|JGI25910J50241_10112427 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 738 | Open in IMG/M |
3300003393|JGI25909J50240_1022762 | All Organisms → Viruses → Predicted Viral | 1429 | Open in IMG/M |
3300004240|Ga0007787_10400546 | Not Available | 683 | Open in IMG/M |
3300004774|Ga0007794_10191630 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300005527|Ga0068876_10738357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 524 | Open in IMG/M |
3300005528|Ga0068872_10542752 | Not Available | 621 | Open in IMG/M |
3300005580|Ga0049083_10281055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 558 | Open in IMG/M |
3300005580|Ga0049083_10315893 | Not Available | 522 | Open in IMG/M |
3300005582|Ga0049080_10006922 | All Organisms → Viruses → Predicted Viral | 3936 | Open in IMG/M |
3300005582|Ga0049080_10018296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2444 | Open in IMG/M |
3300005582|Ga0049080_10207709 | Not Available | 646 | Open in IMG/M |
3300005583|Ga0049085_10285297 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 538 | Open in IMG/M |
3300005585|Ga0049084_10258406 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300006875|Ga0075473_10191530 | Not Available | 825 | Open in IMG/M |
3300007542|Ga0099846_1223882 | Not Available | 658 | Open in IMG/M |
3300007960|Ga0099850_1120756 | All Organisms → Viruses → Predicted Viral | 1070 | Open in IMG/M |
3300007960|Ga0099850_1247017 | Not Available | 689 | Open in IMG/M |
3300008107|Ga0114340_1032669 | All Organisms → Viruses → Predicted Viral | 2375 | Open in IMG/M |
3300008113|Ga0114346_1098448 | Not Available | 1345 | Open in IMG/M |
3300008258|Ga0114840_1005332 | Not Available | 3035 | Open in IMG/M |
3300008259|Ga0114841_1059353 | Not Available | 1819 | Open in IMG/M |
3300008267|Ga0114364_1116369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
3300008448|Ga0114876_1088450 | Not Available | 1265 | Open in IMG/M |
3300009151|Ga0114962_10190114 | All Organisms → Viruses → Predicted Viral | 1207 | Open in IMG/M |
3300009155|Ga0114968_10022827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 4285 | Open in IMG/M |
3300009158|Ga0114977_10341997 | Not Available | 844 | Open in IMG/M |
3300009160|Ga0114981_10422909 | Not Available | 716 | Open in IMG/M |
3300009163|Ga0114970_10393622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 771 | Open in IMG/M |
3300009183|Ga0114974_10081878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2101 | Open in IMG/M |
3300009185|Ga0114971_10535516 | Not Available | 652 | Open in IMG/M |
3300009432|Ga0115005_10595432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 885 | Open in IMG/M |
3300010158|Ga0114960_10312341 | Not Available | 786 | Open in IMG/M |
3300010160|Ga0114967_10244050 | Not Available | 944 | Open in IMG/M |
3300010316|Ga0136655_1106558 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 845 | Open in IMG/M |
3300010334|Ga0136644_10056859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2508 | Open in IMG/M |
3300010354|Ga0129333_10831606 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → Coraliomargarita → unclassified Coraliomargarita → Coraliomargarita sp. TMED73 | 785 | Open in IMG/M |
3300011011|Ga0139556_1025093 | Not Available | 868 | Open in IMG/M |
3300011011|Ga0139556_1057750 | Not Available | 579 | Open in IMG/M |
3300013006|Ga0164294_10510136 | Not Available | 819 | Open in IMG/M |
3300013014|Ga0164295_10018258 | Not Available | 5414 | Open in IMG/M |
3300013014|Ga0164295_10244288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 1345 | Open in IMG/M |
3300013014|Ga0164295_11219954 | Not Available | 584 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10422787 | Not Available | 826 | Open in IMG/M |
3300013295|Ga0170791_12277730 | Not Available | 506 | Open in IMG/M |
3300013372|Ga0177922_10353608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 717 | Open in IMG/M |
3300013372|Ga0177922_11234368 | Not Available | 520 | Open in IMG/M |
3300017736|Ga0181365_1102475 | Not Available | 692 | Open in IMG/M |
3300017761|Ga0181356_1020866 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2408 | Open in IMG/M |
3300017761|Ga0181356_1148749 | Not Available | 727 | Open in IMG/M |
3300017761|Ga0181356_1151838 | Not Available | 717 | Open in IMG/M |
3300017766|Ga0181343_1154825 | Not Available | 638 | Open in IMG/M |
3300017774|Ga0181358_1133892 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
3300017777|Ga0181357_1112286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 1027 | Open in IMG/M |
3300017777|Ga0181357_1207706 | Not Available | 696 | Open in IMG/M |
3300017780|Ga0181346_1143272 | Not Available | 900 | Open in IMG/M |
3300017780|Ga0181346_1306558 | Not Available | 537 | Open in IMG/M |
3300017784|Ga0181348_1033402 | All Organisms → Viruses → Predicted Viral | 2156 | Open in IMG/M |
3300017784|Ga0181348_1163022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300017785|Ga0181355_1022132 | Not Available | 2768 | Open in IMG/M |
3300018416|Ga0181553_10735798 | Not Available | 514 | Open in IMG/M |
3300019784|Ga0181359_1006315 | All Organisms → Viruses → Predicted Viral | 3945 | Open in IMG/M |
3300019784|Ga0181359_1073412 | Not Available | 1292 | Open in IMG/M |
3300019784|Ga0181359_1136794 | Not Available | 857 | Open in IMG/M |
3300020084|Ga0194110_10924649 | Not Available | 517 | Open in IMG/M |
3300020141|Ga0211732_1371927 | Not Available | 2328 | Open in IMG/M |
3300020151|Ga0211736_10749853 | All Organisms → cellular organisms → Bacteria | 1014 | Open in IMG/M |
3300020159|Ga0211734_10253639 | Not Available | 1000 | Open in IMG/M |
3300020159|Ga0211734_11328707 | Not Available | 1582 | Open in IMG/M |
3300020162|Ga0211735_11548669 | Not Available | 530 | Open in IMG/M |
3300020527|Ga0208232_1029630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
3300021091|Ga0194133_10369310 | Not Available | 817 | Open in IMG/M |
3300021124|Ga0214199_1022024 | Not Available | 683 | Open in IMG/M |
3300021961|Ga0222714_10024085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4675 | Open in IMG/M |
3300021962|Ga0222713_10079256 | Not Available | 2404 | Open in IMG/M |
3300021963|Ga0222712_10408122 | Not Available | 824 | Open in IMG/M |
3300021963|Ga0222712_10777970 | Not Available | 530 | Open in IMG/M |
3300022190|Ga0181354_1112105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 882 | Open in IMG/M |
3300022190|Ga0181354_1123498 | Not Available | 830 | Open in IMG/M |
3300022190|Ga0181354_1130848 | Not Available | 799 | Open in IMG/M |
3300022190|Ga0181354_1189685 | Not Available | 619 | Open in IMG/M |
3300022407|Ga0181351_1051276 | All Organisms → Viruses → Predicted Viral | 1722 | Open in IMG/M |
3300022752|Ga0214917_10388554 | Not Available | 580 | Open in IMG/M |
3300023116|Ga0255751_10467911 | Not Available | 605 | Open in IMG/M |
3300024289|Ga0255147_1094467 | Not Available | 552 | Open in IMG/M |
3300024358|Ga0255173_1062885 | Not Available | 622 | Open in IMG/M |
3300025635|Ga0208147_1117832 | Not Available | 635 | Open in IMG/M |
3300025647|Ga0208160_1117712 | Not Available | 673 | Open in IMG/M |
3300025687|Ga0208019_1124622 | Not Available | 758 | Open in IMG/M |
3300026187|Ga0209929_1025501 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. 63ED37-2 | 1810 | Open in IMG/M |
3300026569|Ga0255277_1026677 | Not Available | 1518 | Open in IMG/M |
3300027586|Ga0208966_1106769 | Not Available | 765 | Open in IMG/M |
3300027608|Ga0208974_1016761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Limnohabitans → unclassified Limnohabitans → Limnohabitans sp. 63ED37-2 | 2309 | Open in IMG/M |
3300027608|Ga0208974_1150502 | Not Available | 590 | Open in IMG/M |
3300027608|Ga0208974_1182204 | Not Available | 516 | Open in IMG/M |
3300027621|Ga0208951_1020039 | All Organisms → Viruses → Predicted Viral | 2127 | Open in IMG/M |
3300027649|Ga0208960_1174518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300027659|Ga0208975_1201440 | Not Available | 531 | Open in IMG/M |
3300027734|Ga0209087_1239123 | Not Available | 676 | Open in IMG/M |
3300027759|Ga0209296_1118797 | All Organisms → Viruses → Predicted Viral | 1234 | Open in IMG/M |
3300027759|Ga0209296_1135164 | All Organisms → Viruses → Predicted Viral | 1128 | Open in IMG/M |
3300027763|Ga0209088_10150814 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1027 | Open in IMG/M |
3300027763|Ga0209088_10168951 | Not Available | 954 | Open in IMG/M |
3300027770|Ga0209086_10326694 | Not Available | 644 | Open in IMG/M |
3300027772|Ga0209768_10396157 | Not Available | 550 | Open in IMG/M |
3300027782|Ga0209500_10125536 | Not Available | 1238 | Open in IMG/M |
3300027785|Ga0209246_10035270 | All Organisms → Viruses → Predicted Viral | 1910 | Open in IMG/M |
3300027785|Ga0209246_10345165 | Not Available | 566 | Open in IMG/M |
3300027793|Ga0209972_10347369 | Not Available | 642 | Open in IMG/M |
3300027798|Ga0209353_10152056 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
3300027963|Ga0209400_1105423 | Not Available | 1303 | Open in IMG/M |
3300028025|Ga0247723_1115932 | Not Available | 659 | Open in IMG/M |
(restricted) 3300028559|Ga0247831_1086239 | Not Available | 1419 | Open in IMG/M |
3300031758|Ga0315907_10975770 | Not Available | 614 | Open in IMG/M |
3300031784|Ga0315899_11078041 | Not Available | 707 | Open in IMG/M |
3300031787|Ga0315900_10291763 | Not Available | 1358 | Open in IMG/M |
3300031857|Ga0315909_10200938 | Not Available | 1579 | Open in IMG/M |
3300031857|Ga0315909_10393919 | All Organisms → Viruses | 995 | Open in IMG/M |
3300031951|Ga0315904_10019118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8288 | Open in IMG/M |
3300031963|Ga0315901_10096631 | All Organisms → Viruses → Predicted Viral | 2740 | Open in IMG/M |
3300032117|Ga0316218_1146187 | Not Available | 885 | Open in IMG/M |
3300033993|Ga0334994_0196019 | Not Available | 1097 | Open in IMG/M |
3300033994|Ga0334996_0085814 | All Organisms → Viruses → Predicted Viral | 1864 | Open in IMG/M |
3300034018|Ga0334985_0615835 | Not Available | 602 | Open in IMG/M |
3300034060|Ga0334983_0404031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
3300034060|Ga0334983_0411609 | Not Available | 777 | Open in IMG/M |
3300034062|Ga0334995_0266250 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
3300034062|Ga0334995_0551836 | Not Available | 680 | Open in IMG/M |
3300034093|Ga0335012_0588150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300034110|Ga0335055_0363465 | Not Available | 605 | Open in IMG/M |
3300034117|Ga0335033_0562675 | Not Available | 536 | Open in IMG/M |
3300034122|Ga0335060_0290744 | Not Available | 897 | Open in IMG/M |
3300034272|Ga0335049_0542790 | Not Available | 732 | Open in IMG/M |
3300034284|Ga0335013_0052572 | All Organisms → Viruses → Predicted Viral | 2952 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 22.07% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 13.79% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 13.10% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 9.66% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 6.90% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.83% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.83% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 4.83% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.76% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 2.76% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.76% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.07% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.38% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 1.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.38% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 1.38% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.38% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.69% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.69% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.69% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.69% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300001851 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM31, ROCA_DNA206_0.2um_MCP-S_C_3b | Environmental | Open in IMG/M |
3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004774 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA5M | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009432 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011011 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Top - Depth 1m | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020193 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120m | Environmental | Open in IMG/M |
3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021124 | Freshwater microbial communities from Trout Bog Lake, WI - 04OCT2008 epilimnion | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300026569 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027649 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028559 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_1m | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032117 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
RCM33_10296231 | 3300001838 | Marine Plankton | MKVAVVTPTIGSDYLSQCIYSVDKQTYPDVTHYIFADGVDNFD |
RCM26_10946662 | 3300001849 | Marine Plankton | MKVAVVTPTIGNPKLVDALASVDRQTYTDLTHYIFIDGKEYVKKVE* |
RCM37_11355953 | 3300001850 | Marine Plankton | MKVAVVTPTIGNPKLTDCLASVDKQTYKDIVHYIFIDGK |
RCM31_101201111 | 3300001851 | Marine Plankton | MKVAVVTPTIGNPKLVDCLASVDKQTYKDLVHYIFID |
metazooDRAFT_13555632 | 3300002212 | Lake | MKVAVVTPTIGNSKLADCLASVEKQTYKKLTHYIFIDGNQYKRAVDELIEWSGSTKVKTV |
B570J29032_1092177201 | 3300002408 | Freshwater | MKVAVVTPTIGNSKLADCLASVDKQTYKDLTHYIFIDGNQYKPAVDTMLEGATKVKVVEL |
metazooDRAFT_108049842 | 3300002476 | Lake | MKVAVVTPTIGNPKLIECLASVDNQTYKDIVHYIFIDGQE |
JGI25908J49247_101011952 | 3300003277 | Freshwater Lake | MKVAIVTPTIASEHLAKCIDSVDKQTYEDIVHYIFIDGCQYEPKAREILV |
JGI25910J50241_101124273 | 3300003388 | Freshwater Lake | MKVAVVTPTIASDLLEQCVSSVDNQTYKNLTHYIFIDGCQYEPKARKILVGS |
JGI25909J50240_10227621 | 3300003393 | Freshwater Lake | MKVAVVTPTIASDLLEQCVSSVDNQTYKNLTHYIFIDGCQYEPKARKILVGSSKTRMVEL |
Ga0007787_104005462 | 3300004240 | Freshwater Lake | MKVAVVTPTIGSEHLSKCLDSVDRQTYKDLTHYVFVDGLEHTYN |
Ga0007794_101916302 | 3300004774 | Freshwater | MKVAVVTPTIASKTLQTCIDSVKNQTYSDIIHYVFIDGSQ |
Ga0068876_107383571 | 3300005527 | Freshwater Lake | MKVAVVTPTIGAETLAKCVDSVQKQTYENLTHYIF |
Ga0068872_105427522 | 3300005528 | Freshwater Lake | MKVAVVTPTIGSDHLSQCLSSVDSQTYEDLTHYVFIDG |
Ga0049083_102810551 | 3300005580 | Freshwater Lentic | MKVAVVTPTIGNPKFRDCLKSVETQTYHDLIHYVFIDGYL |
Ga0049083_103158932 | 3300005580 | Freshwater Lentic | MKVAVVTPTIASEHLAKCIDSVDKQTYEDIVHYVFIDGCQYEPKAREILVGSSKTRMIELEENV |
Ga0049080_100069221 | 3300005582 | Freshwater Lentic | MKVAVVTPTIASDLLEQCVSSVDNQTYKDLTHYIF |
Ga0049080_100182966 | 3300005582 | Freshwater Lentic | MEKLKVAVVTPTINSEHLQQCLESVEKQTYKNLTHYIFIDGCQY |
Ga0049080_102077091 | 3300005582 | Freshwater Lentic | MKVAVVTPTIASEHLAKCIDSVDKQTYEDITHYIFIDGCQYEPKAR |
Ga0049085_102852972 | 3300005583 | Freshwater Lentic | MEIKVAVVTPTIASKHLDQCLQSVNNQTYKNLTHYIFIDGSQYEEQTKQILVR |
Ga0049084_102584061 | 3300005585 | Freshwater Lentic | MRVAVVTPTIGSEHLIRCVNSVDKQTHSDLTHYVFIDGEQSELSVV |
Ga0075473_101915301 | 3300006875 | Aqueous | MKVAVVTPTIASDHLQKCIDSVDKQTYQDITHYIFIDGCQYEPK |
Ga0099846_12238821 | 3300007542 | Aqueous | MKVAIVTPTIGADTLGQCLESVQNQKYENLTHYVFLDG |
Ga0099850_11207564 | 3300007960 | Aqueous | MKVAVVTPTIGAETLAQCIESVQNQTYEDLTHYVF |
Ga0099850_12470173 | 3300007960 | Aqueous | MKVAVVTPTIGADTLGQCLESVQNQKYENLTHYVFLDGEEHY |
Ga0114340_10326691 | 3300008107 | Freshwater, Plankton | MKVAVVTPTIGSEHLTQCVESVQNQTYENLTHYIFLDG |
Ga0114346_10984481 | 3300008113 | Freshwater, Plankton | MKVAVVTPTIASEHLAQCIDSVDKQTYKDLTHYIFIDGCQYE |
Ga0114346_12506892 | 3300008113 | Freshwater, Plankton | MKVAVVTPTIGNSKLADCLASVDKQTYKDLTHYIFIDGNQYKPAVDTMLEGATKVKVV |
Ga0114351_13639972 | 3300008117 | Freshwater, Plankton | MKVAVVTPTIGNSKLADCLASVDKQTYKDLTHYIFIDGNQYKPAVDTMLEGA |
Ga0114840_10053328 | 3300008258 | Freshwater, Plankton | MKVAVVTPTIASKHLKQCIDSVNKQTYKDITHYIFVDGCQYEPE |
Ga0114841_10593534 | 3300008259 | Freshwater, Plankton | MEIKVAVVTPTINSNHLKQCLESVNNQTYKNLTHYIFIDGCQYEPKVKEL |
Ga0114364_11163693 | 3300008267 | Freshwater, Plankton | MKIAVVTPTIASEHLTKCIDSVDKQTYEDIVHYIFIDGCQYEPKAREILVGSSKTRMIELEENV |
Ga0114876_10884504 | 3300008448 | Freshwater Lake | MEMKVAVVTPTIGSEHLKQCLESVEKQTYKNLTHYVFIDGCQYEPKIKEL |
Ga0114962_101901143 | 3300009151 | Freshwater Lake | MKVAVVTPTIASEHLAKCIASVDKQTYEDIVHYIFIDGCQYEPKA |
Ga0114980_107292092 | 3300009152 | Freshwater Lake | MKVAVITPTIGNPKLSDALKSVDKQTYKDLTHYIFIDGQEHKANVHKQIEGASKVKLIE |
Ga0114968_100228278 | 3300009155 | Freshwater Lake | MEIKVAVVTPTINSNHLKQCLESVNNQTYKNLTHYIFIDGC |
Ga0114977_103419973 | 3300009158 | Freshwater Lake | MKVAVVTPTIGSGYLSQCVNSVDKQTYSDLTHYIFMDGKE |
Ga0114981_104229091 | 3300009160 | Freshwater Lake | MKVAVVTPTIGSMHLQKCIESVDKQTYKDLTHYIFIDGYDHRKK |
Ga0114970_103936223 | 3300009163 | Freshwater Lake | MKIAVVTPTIASDHLTRCIDSVDKQTYEDIVHYIFIDGCQYEPKAR |
Ga0114974_100818781 | 3300009183 | Freshwater Lake | MKVAVVTPTIGNSKLADCLASVDKQTYKDLTHYIF |
Ga0114971_105355163 | 3300009185 | Freshwater Lake | MKVAVITPTIGNPKLSDALKSVDKQTYKDLTHYIFIDGKEHKQNVH |
Ga0115005_105954321 | 3300009432 | Marine | MRVAVVTPTIGSKHLEQNVESVKNQTYKDVLHYIFKDGGDVV |
Ga0114960_103123413 | 3300010158 | Freshwater Lake | MKVAVVTPTIASEHLAQCVDSVDKQTYKDLTHYIFIDGCQYEPK |
Ga0114967_102440501 | 3300010160 | Freshwater Lake | MKVAVVTPTIGGEYLKKCVASVDNQTYGDLTHYIFMD |
Ga0136655_11065583 | 3300010316 | Freshwater To Marine Saline Gradient | MKVAVVTPTIGSKHLKQCLDSVENQTYDNITHYVFVDG |
Ga0136644_100568591 | 3300010334 | Freshwater Lake | MKVAVITPTIGNPKLSDAIKSVDKQTYKDLTHYIFID |
Ga0129333_108316061 | 3300010354 | Freshwater To Marine Saline Gradient | MKVAVVTPTIGAKTLSKCLQSVDEQTYENLTHYIVLD |
Ga0139556_10250931 | 3300011011 | Freshwater | MKVAVVTPTIASEHLAQCIDSVDKQTYEDIVHYIFIDGCQ |
Ga0139556_10577501 | 3300011011 | Freshwater | MKVAVVTPTIASEYLTKCIDSVDKQTYENLTHYIFIDGCQYEPKAREILVGSSKTRMIELEEN |
Ga0164294_105101363 | 3300013006 | Freshwater | MKVAVVTPTIGNSKLADCLASVDKQTYKDLTHYIFIDGNQYKPAVDTMLE |
Ga0164295_100182581 | 3300013014 | Freshwater | MKVAVVTPTIGSKTLKECINSVDKQTYEDLVHYIYI |
Ga0164295_102442881 | 3300013014 | Freshwater | MKVAIVTPTIASEHLAKCIASVDKQTYEDIVHYIFIDGCQYE |
Ga0164295_112199542 | 3300013014 | Freshwater | MKVAVVTPTIASEHLAKCIDSVDKQTYEDITHYIFIDGCQYEPK |
(restricted) Ga0172373_104227871 | 3300013131 | Freshwater | VKVAVVTPTIGSYHLTECIKSIDKQTYKNLSHYIFIDGYDH |
Ga0170791_122777302 | 3300013295 | Freshwater | MKVAIVTPTIGKPELLDCLKSVDKQTYNDITHYIFIDG |
Ga0177922_103536082 | 3300013372 | Freshwater | MKVAVVTPTIASKHLGQCLQSVNNQTYKNLTHYIFI |
Ga0177922_112343681 | 3300013372 | Freshwater | MKVAVVTPTIASEHLKKCIDSVDKQTYEDIVHYIFIDGCQYEPK |
Ga0181365_11024751 | 3300017736 | Freshwater Lake | MKVAVVTPTIASKTLQTCIDSVKNQTYSDIIHYVFIDGSQYKTVANLALE |
Ga0181356_10208661 | 3300017761 | Freshwater Lake | MKVAIVTPTIASEHLAKCIASVDKQTYEDITHYIFIDGCQYEPKAREILVG |
Ga0181356_11487493 | 3300017761 | Freshwater Lake | MKVAVVTPTIASEHLAQCVDSVDKQTYKDLTHYIFIDGCQYEPKAREILVGSSKTRMIELEE |
Ga0181356_11518381 | 3300017761 | Freshwater Lake | MKVAVVTPTIASDLLEQCVSSVDNQTYKDLTHYIFIDGCQYEPKARKILVGSSK |
Ga0181343_11548251 | 3300017766 | Freshwater Lake | MKVAVVTPTIGSDHLAKCVESVDNQTYKDITHYIFI |
Ga0181358_11338923 | 3300017774 | Freshwater Lake | MKVAVVTPTIASKHLKQCIDSVNKQTYKDITHYIFIDGSQY |
Ga0181357_11122863 | 3300017777 | Freshwater Lake | MKVAVVTPTIASEYLTKCIDSVDKQTYENLTHYIFIDGCQYEP |
Ga0181357_12077063 | 3300017777 | Freshwater Lake | MKVAVVTPTIASEHLAKCIDSVDKQTYEDIVHYVFIDGCQYEPKAREILVGSSKTRMIE |
Ga0181346_11432721 | 3300017780 | Freshwater Lake | MKVAIVTPTIASEHLAKCIASVDKQTYEDIVHYIFIDGCQYEPKAREIL |
Ga0181346_13065581 | 3300017780 | Freshwater Lake | MKVAVVTPTIGSKTLKQCVDSVDKQTYEDLVHYVYIDGDQYSDSVY |
Ga0181348_10334021 | 3300017784 | Freshwater Lake | MRVAVVTPTIGSNYLTKCIDSVDKQTHLDLIHYIFVDGNVHYGEA |
Ga0181348_11630222 | 3300017784 | Freshwater Lake | MKVAVVTPTIASKHLDQCLQSVNNQTYKNLTHYIFIDGS |
Ga0181355_10221321 | 3300017785 | Freshwater Lake | MKVAVVTPTIGNPKLADCLASVNNQTYKNLTHYIFID |
Ga0181553_107357982 | 3300018416 | Salt Marsh | MKVAVVTPTIGSEHLEQCVESVSKQTYTDIVHYIV |
Ga0181359_10063157 | 3300019784 | Freshwater Lake | MKVAVVTPTIASEHLAKCIDSVDKQTYEDIVHYVFIDGCQYEPKAREILVGSS |
Ga0181359_10734123 | 3300019784 | Freshwater Lake | MEIKVAVVTPTINSNHLKQCLESVNNQTYKNLTHYIFIDGCQYEPKVKELIRD |
Ga0181359_11367941 | 3300019784 | Freshwater Lake | MKVAIVTPTIASEHLAKCIASVDKQTYEDIVHYIFIDGCQYEPKAREILVGS |
Ga0194110_109246491 | 3300020084 | Freshwater Lake | MEQLKVAVVTPTIASDHFTQCLESVQNQTYDNLIHYVFIDG |
Ga0211732_13719275 | 3300020141 | Freshwater | MKVAVVTPTIGKKELKDCLSSVNNQTYQNITHYVFVDGL |
Ga0211736_107498533 | 3300020151 | Freshwater | MKVAVVTPTIASEHLAQCIDSVDKQTYKDLTHYIFIDGCQYEPKA |
Ga0211734_102536393 | 3300020159 | Freshwater | MEIKVAVVTPTIASKHLDQCLQSVNNQTYKNLTHYIFIDGSQYEEQT |
Ga0211734_113287074 | 3300020159 | Freshwater | MKVAIVTPTIASEHLAKCIASVDKQTYEDIVHYIFIDGCQYEPKAREILVGSSKT |
Ga0211735_115486692 | 3300020162 | Freshwater | MKVAVVTPTIASEHLTKCIDSVDKQTYENITHYIFIDGCQYEPKAREI |
Ga0194131_103355732 | 3300020193 | Freshwater Lake | MKVAVVTPTIGSDHLSQCLKSVDSQTHEDLTHYIFVDGLQYNDAVDQK |
Ga0208232_10296303 | 3300020527 | Freshwater | MKVAVITPTIGTKYLSKCIESVDRQTYDDLTHYVFMD |
Ga0194133_103693101 | 3300021091 | Freshwater Lake | MKVAVITPTIASDHFAKCLETVQNQTYDNLVHYIFVDG |
Ga0214199_10220241 | 3300021124 | Freshwater | MKVAVVTPTIGSKYLQQCLSSVENQTYKNMTHYVFVDGDQYNSS |
Ga0222714_1002408510 | 3300021961 | Estuarine Water | MKVAVVTPTIASEHLSKCIDSVDKQTYQDITHYIFIDGCQYEPKARDVLVGSSKTRMIELEEN |
Ga0222713_100792565 | 3300021962 | Estuarine Water | MKVAVVTPTIASEHLSKCIDSVDKQTYQDITHYIFIDGCQYEPKARDVLV |
Ga0222712_104081221 | 3300021963 | Estuarine Water | MKVAVVTPTIGNSKLADCLVSVEKQTYKNLTHYIFIDGNQYILIAV |
Ga0222712_107779702 | 3300021963 | Estuarine Water | MKVAVVTPTIGSKTLNQCVTSVQNQTYEDVVHYIFVD |
Ga0181354_11121051 | 3300022190 | Freshwater Lake | MKVAVVTPTIGSKTLKQCVDSVDKQTYEDLVHYIYIDG |
Ga0181354_11234983 | 3300022190 | Freshwater Lake | MKVAIVTPTIASEHLAKCIDSVDKQTYEDIVHYIFIDGCQYEPKAREILVGSSKTR |
Ga0181354_11308483 | 3300022190 | Freshwater Lake | MKVAVVTPTIASEHLAKCIDSVDKQTYEDITHYIFIDGCQYEP |
Ga0181354_11896852 | 3300022190 | Freshwater Lake | MKVAVVTPTIASEHLAKCIDSVDKQTYEDLTHYIFIDGCQYEPKARD |
Ga0181351_10512761 | 3300022407 | Freshwater Lake | VVTPTVGAKQLEQCVQSVQNQTYKNLTHYVFVDGKQFNKSVDEL |
Ga0214917_103885542 | 3300022752 | Freshwater | MKVAVVTPTIASEHLSKCIDSVDKQTYQDITHYIFIDGCQYEPKARDVLVGSSKTRMIELEENVGKGWYGHRVYAA |
Ga0255751_104679111 | 3300023116 | Salt Marsh | MKVAVVTPTIGSEHLEQCVESVSKQTYTDIVHYIVKDGHDVR |
Ga0255147_10944671 | 3300024289 | Freshwater | MKVAVVTPTIGATTLAQCVDSVEKQTYDDLVHYVFIDGKENENK |
Ga0255173_10628851 | 3300024358 | Freshwater | MKVAVVTPTIGATTLAQCVGSVENQTYDDLTHYIFL |
Ga0208147_11178321 | 3300025635 | Aqueous | MKVAVVTPTVNAKQLIQCVQSVQNQTYKDLTHYVFIDGKQFREGVV |
Ga0208160_11177121 | 3300025647 | Aqueous | MKVAVVTPTIGADTLGQCLESVQNQKYENLTHYVFLDGEEHYD |
Ga0208019_11246221 | 3300025687 | Aqueous | MKVAIVTPTIGADTLGQCLESVQNQKYENLTHYVFLDGEE |
Ga0209929_10255014 | 3300026187 | Pond Water | MKVAVVTPTIGSEHLEQCVESVSKQTYTDIVHYIVKDG |
Ga0255277_10266771 | 3300026569 | Freshwater | MKVAVVTPTIGATTLGQCVDSVEKQTYDDVVHYVFIDGK |
Ga0208966_11067693 | 3300027586 | Freshwater Lentic | MKVAIVTPTIASEHLAKCIDSVDKQTYEDIVHYIFIDGCQYEPKAREILVGSSKTRM |
Ga0208974_10167611 | 3300027608 | Freshwater Lentic | MEKLKVAVVTPTINSEHLQQCLESVEKQTYKNLTHYIFIDGCQYE |
Ga0208974_11505021 | 3300027608 | Freshwater Lentic | MKVAVVTPTIASDLLEQCVSSVDNQTYKDLTHYIFIDG |
Ga0208974_11822042 | 3300027608 | Freshwater Lentic | MKVAIVTPTIASEHLAKCIDSVDKQTYEDIVHYIFIDGCQYEPKAREILVGSSKTRMI |
Ga0208951_10200394 | 3300027621 | Freshwater Lentic | MKVAIVTPTIASEHLAKCIASVDKQTYEDIVHYIFIDGCQYEP |
Ga0208960_11745181 | 3300027649 | Freshwater Lentic | MRVAVVTPTIGSEHLIRCVNSVDKQTHSDLTHYVFIDGEQS |
Ga0208975_12014402 | 3300027659 | Freshwater Lentic | MKIAVVTPTIASEHLTRCIDSVDKQTYEDIVHYIFIDGCQYEPKAREIL |
Ga0209087_12391233 | 3300027734 | Freshwater Lake | MKVAVVTPTIGSKTLKQCVDSVDKQTYEDLVHYIYIDGDQYSDSVYED |
Ga0209296_11187971 | 3300027759 | Freshwater Lake | MKVAVVTPTIGSEYLSQCINSVDKQTYRDFTHYVFMDGKEHW |
Ga0209296_11351641 | 3300027759 | Freshwater Lake | MKVAVVTPSIGSDTLRTCIESVDNQTYENLVHYIYIDGDQYSDNV |
Ga0209088_101508141 | 3300027763 | Freshwater Lake | MKVAVVTPSIGKHDLLDCLRSVDNQTYKDLTHYIFIDGYDYR |
Ga0209088_101689511 | 3300027763 | Freshwater Lake | MKVAVVTPTIASKTLQTCIDSVKNQTYSDIIHYVFIDGTQYKTV |
Ga0209086_103266941 | 3300027770 | Freshwater Lake | MKVAVVTPTIGNPKLADCLASVNNQTYKNLTHYIFIDGSQYEE |
Ga0209768_103961572 | 3300027772 | Freshwater Lake | MKVAVVTPTIASEHLAKCIDSVDKQTYEDLTHYIFIDGCQYEPKAR |
Ga0209500_101255361 | 3300027782 | Freshwater Lake | MKVAIVTPTIASEHLAKCVASVDKQTYEDIVHYIFIDGCQYEPKAREILVGSS |
Ga0209246_100352701 | 3300027785 | Freshwater Lake | MKVAIVTPTIASEHLAKCIDSVDKQTYEDIVHYIFIDGCQYEPKAREILVGSSKT |
Ga0209246_103451651 | 3300027785 | Freshwater Lake | MKVAVVTPTIASDLLEQCVSSVDNQTYKNLTHYIFIDGCQYE |
Ga0209972_103473693 | 3300027793 | Freshwater Lake | MEQLKVAVVTPTIASDHFAQCLESVQNQTYDNLIHYIFVDGNQ |
Ga0209353_101520563 | 3300027798 | Freshwater Lake | MKVAVVTPTIGNPKFRDCLKSVETQTYHDLIHYVF |
Ga0209400_11054231 | 3300027963 | Freshwater Lake | MKVAIVTPTIASEHLAKCIASVDKQTYEDIVHYIFIDGCQYEPKAREILVGSS |
Ga0247723_11159321 | 3300028025 | Deep Subsurface Sediment | MKVAVVTPTIGSKTLKQCVDSVDKQTYEDLVHYVYIDGNQYSDSVYEDI |
(restricted) Ga0247831_10862393 | 3300028559 | Freshwater | MKVAVVTPTIASEHLAKCIDSVDKQTYEDIVHYIFIDGCQ |
Ga0315907_109757702 | 3300031758 | Freshwater | MKVAVVTPTIGNPKLADCLASVEKQTYKDLTHYIFTDGKQ |
Ga0315899_110780413 | 3300031784 | Freshwater | MEQLKVAVITPTINSDTLAKCLVSVRDQTYQNLTHYIFIDGGGHED |
Ga0315900_102917631 | 3300031787 | Freshwater | MKVAVVTPTIGSIHLSQCLQSVDEQTYEDLTHYVFIDGE |
Ga0315909_102009384 | 3300031857 | Freshwater | MKVAVVTPTIGNSKLADCLASVDKQTYKDLTHYIFTDGK |
Ga0315909_103939193 | 3300031857 | Freshwater | MKVAVVTPTIASEHLAQCIDSVDKQTYEDLTHYIFIDGCQYEPKARE |
Ga0315904_1001911830 | 3300031951 | Freshwater | MKVAVITPTIGTKYLSKCIESVDRQTYDDLTHYVFM |
Ga0315901_100966311 | 3300031963 | Freshwater | MKVAVVTPTIGAKTLSKCIQSVENQTYDNLTHYVFL |
Ga0316218_11461871 | 3300032117 | Freshwater | MKVAVVTPTIGSKYLQQCLSSVENQTYKNMTHYVFVD |
Ga0334994_0196019_968_1096 | 3300033993 | Freshwater | MKVAVVTPTIASEHLTKCIDSVDKQTYENLTHYIFIDGCQYEP |
Ga0334996_0085814_1743_1862 | 3300033994 | Freshwater | MKVAIVTPTIGSEHLSDCLKSVQNQTYENITQYLFVDGKD |
Ga0334985_0615835_482_601 | 3300034018 | Freshwater | MKVAIVTPTIGSEYLNTCLESVRSQTYENITHNLFVDGKE |
Ga0334983_0404031_676_786 | 3300034060 | Freshwater | MKVAIVTPTIGSEHLVRCVDSVDKQTYSDLTHYVFID |
Ga0334983_0411609_640_777 | 3300034060 | Freshwater | MKVAIVTPTIGSEYLVDCLKSVQNQTYENITQYLFVDGKDHHIDVQ |
Ga0334995_0266250_1002_1142 | 3300034062 | Freshwater | MKVAVVTPTIASEHLAKCIDSVDKQTYEDITHYIFIDGCQYEPKARE |
Ga0334995_0551836_1_126 | 3300034062 | Freshwater | MKVAVVTPTIGNPKLADCLASVNNQTYKNLTHYIFIDGSQYE |
Ga0335012_0588150_376_516 | 3300034093 | Freshwater | MKVAVVTPTIGSEHLIRCVDSVDKQTYSDLTHYVFIDGEQSELSVID |
Ga0335055_0363465_486_605 | 3300034110 | Freshwater | MKVAVVTPTIGSDTLRKCIKSVDEQTYENLVHYIYIDGDQ |
Ga0335033_0562675_2_115 | 3300034117 | Freshwater | MEIKVAVVTPTIASKHLDQCLQSVNNQTYKNLTHYIFI |
Ga0335060_0290744_2_127 | 3300034122 | Freshwater | MEIKVAVVTPTIASKHLDQCLQSVNNQTYKNLTHYIFIDGSQ |
Ga0335049_0542790_2_124 | 3300034272 | Freshwater | MEIKVAVVTPTIASKHLDQCLQSVNNQTYKNLTHYIFIDGS |
Ga0335013_0052572_1_108 | 3300034284 | Freshwater | MKVAVVTPTIASKTLQTCIDSVKNQTYSDIIHYVFI |
⦗Top⦘ |