NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F050190

Metagenome / Metatranscriptome Family F050190

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F050190
Family Type Metagenome / Metatranscriptome
Number of Sequences 145
Average Sequence Length 38 residues
Representative Sequence MFNFSANHLFLLSRTEYRSCAVLLMQDRDTQRVYRL
Number of Associated Samples 131
Number of Associated Scaffolds 145

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.34 %
% of genes near scaffold ends (potentially truncated) 93.79 %
% of genes from short scaffolds (< 2000 bps) 85.52 %
Associated GOLD sequencing projects 129
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.862 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(8.966 % of family members)
Environment Ontology (ENVO) Unclassified
(26.207 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 28.12%    Coil/Unstructured: 71.88%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 145 Family Scaffolds
PF01695IstB_IS21 73.10
PF00665rve 4.14
PF00589Phage_integrase 2.07
PF13495Phage_int_SAM_4 0.69
PF14319Zn_Tnp_IS91 0.69
PF00027cNMP_binding 0.69
PF00364Biotin_lipoyl 0.69
PF02371Transposase_20 0.69
PF02899Phage_int_SAM_1 0.69
PF00474SSF 0.69
PF13542HTH_Tnp_ISL3 0.69
PF05147LANC_like 0.69
PF07366SnoaL 0.69
PF00903Glyoxalase 0.69
PF13683rve_3 0.69
PF01850PIN 0.69

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 145 Family Scaffolds
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 73.10
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 4.14
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 4.14
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 4.14
COG4584TransposaseMobilome: prophages, transposons [X] 4.14
COG3547TransposaseMobilome: prophages, transposons [X] 0.69
COG4403Lantibiotic modifying enzymeDefense mechanisms [V] 0.69
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.69
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.69

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms95.86 %
UnclassifiedrootN/A4.14 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459004|F62QY1Z02GX6KPAll Organisms → cellular organisms → Bacteria531Open in IMG/M
3300005186|Ga0066676_10448640All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300005833|Ga0074472_11243794All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300006028|Ga0070717_11664736All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300006880|Ga0075429_101624107All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300006893|Ga0073928_10003689All Organisms → cellular organisms → Bacteria23738Open in IMG/M
3300009081|Ga0105098_10426997All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300009089|Ga0099828_10053436All Organisms → cellular organisms → Bacteria3362Open in IMG/M
3300009131|Ga0115027_10007964All Organisms → cellular organisms → Bacteria → Proteobacteria3800Open in IMG/M
3300009137|Ga0066709_104350624All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300009168|Ga0105104_10370104All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300009174|Ga0105241_10944839All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300009176|Ga0105242_10420011All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1253Open in IMG/M
3300009525|Ga0116220_10386250All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300009628|Ga0116125_1109618All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300009636|Ga0116112_1120256All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300009646|Ga0116132_1260708All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300009665|Ga0116135_1074762All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini1200Open in IMG/M
3300009698|Ga0116216_10305262All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300009700|Ga0116217_10462563All Organisms → cellular organisms → Bacteria → Acidobacteria800Open in IMG/M
3300009762|Ga0116130_1067996All Organisms → cellular organisms → Bacteria1120Open in IMG/M
3300009824|Ga0116219_10416806All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300010046|Ga0126384_10919084All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium791Open in IMG/M
3300010046|Ga0126384_11106560All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300010046|Ga0126384_11269857All Organisms → cellular organisms → Bacteria682Open in IMG/M
3300010339|Ga0074046_10114379All Organisms → cellular organisms → Bacteria → Proteobacteria1735Open in IMG/M
3300010361|Ga0126378_12231747All Organisms → cellular organisms → Bacteria625Open in IMG/M
3300010379|Ga0136449_101376161All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300010379|Ga0136449_103601043Not Available588Open in IMG/M
3300011432|Ga0137428_1210186All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300012210|Ga0137378_11841720All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012285|Ga0137370_10631001All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300012356|Ga0137371_10682818All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300012363|Ga0137390_10200626All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300012927|Ga0137416_11161768All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300012930|Ga0137407_10319102All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1424Open in IMG/M
3300012971|Ga0126369_11970392All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300013297|Ga0157378_10716670All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300014151|Ga0181539_1226051All Organisms → cellular organisms → Bacteria709Open in IMG/M
3300014153|Ga0181527_1146239All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1040Open in IMG/M
3300014169|Ga0181531_10880774All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300014311|Ga0075322_1190368All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300014488|Ga0182001_10524938All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300014494|Ga0182017_10173825All Organisms → cellular organisms → Bacteria → Acidobacteria1386Open in IMG/M
3300014496|Ga0182011_10249830All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1191Open in IMG/M
3300014501|Ga0182024_10220208All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2573Open in IMG/M
3300014745|Ga0157377_10638375All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300015242|Ga0137412_10184512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Rhizocola → Rhizocola hellebori1672Open in IMG/M
3300015372|Ga0132256_103288039All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300017941|Ga0187850_10060321All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini1924Open in IMG/M
3300017961|Ga0187778_10463318All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300017972|Ga0187781_10038577All Organisms → cellular organisms → Bacteria → Proteobacteria3292Open in IMG/M
3300017995|Ga0187816_10539581All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300018004|Ga0187865_1064579All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1420Open in IMG/M
3300018009|Ga0187884_10057952All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1784Open in IMG/M
3300018012|Ga0187810_10087992All Organisms → cellular organisms → Bacteria → Proteobacteria1209Open in IMG/M
3300018013|Ga0187873_1221355All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300018013|Ga0187873_1339645All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300018019|Ga0187874_10080415All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1447Open in IMG/M
3300018034|Ga0187863_10537714All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300018040|Ga0187862_10029558All Organisms → cellular organisms → Bacteria4158Open in IMG/M
3300018043|Ga0187887_10612888All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300018088|Ga0187771_10370226All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium1206Open in IMG/M
3300018433|Ga0066667_11325483All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300018468|Ga0066662_12459586All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300018482|Ga0066669_10925706All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300019458|Ga0187892_10029053All Organisms → cellular organisms → Bacteria4618Open in IMG/M
3300019788|Ga0182028_1214467All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300019789|Ga0137408_1139947All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300020199|Ga0179592_10080057All Organisms → cellular organisms → Bacteria → Acidobacteria1498Open in IMG/M
3300020200|Ga0194121_10408714All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300020221|Ga0194127_10303397All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300021404|Ga0210389_11061927All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300021432|Ga0210384_10450306All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300021474|Ga0210390_11383902All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300021560|Ga0126371_10070832All Organisms → cellular organisms → Bacteria3391Open in IMG/M
3300023090|Ga0224558_1039014All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2062Open in IMG/M
3300025496|Ga0208191_1016577All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1864Open in IMG/M
3300025915|Ga0207693_10988373All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300025927|Ga0207687_10780166All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300025941|Ga0207711_11315053All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300026142|Ga0207698_12588046Not Available517Open in IMG/M
3300026328|Ga0209802_1081597All Organisms → cellular organisms → Bacteria1499Open in IMG/M
3300026497|Ga0257164_1076243All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300027003|Ga0207722_1028452All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300027313|Ga0207780_1075573All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300027643|Ga0209076_1219900All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300027650|Ga0256866_1036033All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae1293Open in IMG/M
3300027768|Ga0209772_10101580All Organisms → cellular organisms → Bacteria → Proteobacteria884Open in IMG/M
3300027773|Ga0209810_1022072All Organisms → cellular organisms → Bacteria4098Open in IMG/M
3300027829|Ga0209773_10238985All Organisms → cellular organisms → Bacteria759Open in IMG/M
3300027860|Ga0209611_10607080All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300027867|Ga0209167_10349938All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300027905|Ga0209415_10991488All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300028037|Ga0265349_1027846All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300028745|Ga0302267_10318383All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300028789|Ga0302232_10627298All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300028906|Ga0308309_10032903All Organisms → cellular organisms → Bacteria → Proteobacteria3576Open in IMG/M
3300028906|Ga0308309_11896176All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300029636|Ga0222749_10647138All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300029636|Ga0222749_10685304All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300029883|Ga0311327_10645113All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300029889|Ga0246001_1073188All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300029939|Ga0311328_10046809All Organisms → cellular organisms → Bacteria3888Open in IMG/M
3300029999|Ga0311339_11119312All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300029999|Ga0311339_11460017All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300030618|Ga0311354_11293031All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300031234|Ga0302325_10128361All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae4628Open in IMG/M
3300031234|Ga0302325_11013036All Organisms → cellular organisms → Bacteria → Proteobacteria1133Open in IMG/M
3300031236|Ga0302324_101179903All Organisms → cellular organisms → Bacteria1022Open in IMG/M
3300031469|Ga0170819_12211979All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031524|Ga0302320_10720836All Organisms → cellular organisms → Bacteria1126Open in IMG/M
3300031573|Ga0310915_10266472All Organisms → cellular organisms → Bacteria → Acidobacteria1207Open in IMG/M
3300031573|Ga0310915_10305775All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300031616|Ga0307508_10491384All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300031679|Ga0318561_10501383All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300031708|Ga0310686_100613823All Organisms → cellular organisms → Bacteria907Open in IMG/M
3300031708|Ga0310686_107489325All Organisms → cellular organisms → Bacteria → Acidobacteria3450Open in IMG/M
3300031708|Ga0310686_108301083All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini1179Open in IMG/M
3300031744|Ga0306918_11131113All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300031796|Ga0318576_10101676All Organisms → cellular organisms → Bacteria → Acidobacteria1312Open in IMG/M
3300031833|Ga0310917_10023278All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3585Open in IMG/M
3300031912|Ga0306921_11731215All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300031938|Ga0308175_102239628All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300031947|Ga0310909_11459799All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031997|Ga0315278_11423801All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300032001|Ga0306922_10283603All Organisms → cellular organisms → Bacteria1779Open in IMG/M
3300032068|Ga0318553_10315300All Organisms → cellular organisms → Bacteria818Open in IMG/M
3300032160|Ga0311301_12840419All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300032782|Ga0335082_11417328All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300032783|Ga0335079_10766062All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300032828|Ga0335080_10954972All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300033402|Ga0326728_10567165Not Available897Open in IMG/M
3300033405|Ga0326727_10111274All Organisms → cellular organisms → Bacteria3511Open in IMG/M
3300033405|Ga0326727_11054698All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300033513|Ga0316628_100259206All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae2135Open in IMG/M
3300033828|Ga0334850_108964All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300033891|Ga0334811_088261All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300033977|Ga0314861_0002016All Organisms → cellular organisms → Bacteria → Acidobacteria23280Open in IMG/M
3300033977|Ga0314861_0191992All Organisms → cellular organisms → Bacteria971Open in IMG/M
3300034091|Ga0326724_0297500All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300034091|Ga0326724_0520964All Organisms → cellular organisms → Bacteria605Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.97%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.59%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.21%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.52%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.14%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.45%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.45%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.45%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.76%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.76%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.76%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.07%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.07%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen2.07%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.07%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.38%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.38%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.38%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.38%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.38%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.38%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.38%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.69%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.69%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.69%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.69%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.69%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.69%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.69%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.69%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.69%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.69%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.69%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.69%
PeatEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat0.69%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.69%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.69%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.69%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.69%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.69%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.69%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.69%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.69%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459004Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009131Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014311Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D1EnvironmentalOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018013Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020200Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015020 Mahale Deep Cast 50mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300027003Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027650Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeqEnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027829Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028037Soil microbial communities from Maridalen valley, Oslo, Norway - NSE1EnvironmentalOpen in IMG/M
3300028745Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029889Peat microbial communities from Marcell Experimental Forest bog in Minnesota, USA - MG_T3F_30cmEnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031469Fir Spring Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031616Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EMHost-AssociatedOpen in IMG/M
3300031670Soil microbial communities from Risofladan, Vaasa, Finland - OX-3EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033828Peat soil microbial communities from Stordalen Mire, Sweden - 715 P1 1-5EnvironmentalOpen in IMG/M
3300033891Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-1-DEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E4B_011011602170459004Grass SoilMFNFRANHLFLLSRTEYRKCAVFLLRDLDTQRVYRLYDFTKALL
Ga0066676_1044864023300005186SoilMFNFSANHLTLLSRTEYRSCAVFMVLDHSTHRVYRLHDFT
Ga0074472_1124379413300005833Sediment (Intertidal)MFNFSANHLFLISRTEYPSYAVFLMQDRDTQRVYR
Ga0070717_1166473613300006028Corn, Switchgrass And Miscanthus RhizosphereMFNFSANHLFLLSRTEYSSCALLLMFDRDTRRVYRLFDF
Ga0075429_10162410723300006880Populus RhizosphereMFNFSANHLFLLSRTERLTCAVFLLRDLDTQRVYRL
Ga0073928_1000368913300006893Iron-Sulfur Acid SpringMFNFSANHLFLISRTEYASCAVLLMLDHDTRCVYRLLDFTKRLNLRSVD*
Ga0105098_1042699723300009081Freshwater SedimentMFNFSANNLTLLSRTECASCFVFVMKDHHTKRVYRLY
Ga0099828_1005343613300009089Vadose Zone SoilMFNFSANHLILLSRTECERCAVFVMKDDSTRRVYR
Ga0115027_1000796453300009131WetlandMFCFSASNLILLSKTEGRSCFVFVMKDRHTNRTYRL
Ga0066709_10435062423300009137Grasslands SoilMFNFSANHLLLLSRMEYRSCVVFVMKDDSTRRVYRV*
Ga0105104_1037010413300009168Freshwater SedimentMFNFGANNLSLLSRTECRSCVVFLMKDLDTKRVYRLYD
Ga0105241_1094483923300009174Corn RhizosphereMFNFTANHLLLLSRMEYRTYVVLLMRDDSTRRVYRLHDFTKLQMP
Ga0105242_1042001113300009176Miscanthus RhizosphereMFNFSANHLLLLSRMEYRTCAVLLMRDDSTRRVYRL
Ga0116220_1038625013300009525Peatlands SoilMFNFSANHLFLLSRTEYPSCAVFLFKDLDTQHVYRLHDFTKAQ
Ga0116125_110961823300009628PeatlandMFNFSANHLFLLSRTEYRSCAVFALLDRDTQRVYRLL
Ga0116112_112025613300009636PeatlandMFNFSANHLFLLSRTEYRKCAVFLLRDLDTQRVYRLYD
Ga0116132_126070813300009646PeatlandMFNFSANHLFLLSRKEYRSCAVLWMLDRDTQRVYRLHDFTKSHHL
Ga0116135_107476233300009665PeatlandMFNFSANHLFLLSRTEYSSCAVFLLRDLDTQRVDRLHDFTKAKLI
Ga0116216_1030526223300009698Peatlands SoilMFNFSANHLILLSRTECRSCVVFVMKDDSTRRVYRLY
Ga0116217_1046256323300009700Peatlands SoilMFNFSANHLFLLKRTEHRSCAVFLMQDDFTRRVYRL
Ga0116130_106799623300009762PeatlandMFNFSANHLLLLSRMEYRTCAVLLMRDDSTRRVYRLH
Ga0116219_1041680613300009824Peatlands SoilMFNFSANHLLLLSRTEYRTCAVFLMQDDSTHRVYRL
Ga0126384_1091908433300010046Tropical Forest SoilMFNFSANHLVLLSRTECRRCVVFVMKDDSTRRVYRLYDF
Ga0126384_1110656013300010046Tropical Forest SoilMFNFSANHLHLLSRMEYRSCVVFLMQDHSTRRVYR
Ga0126384_1126985723300010046Tropical Forest SoilMFNFSANHLLLLSRKEYRTCAVLLMRDDSTRRVYRLHDFTKSHAP
Ga0074046_1011437913300010339Bog Forest SoilMFNFSANHLFLLSRTEYRSCAVLLLVDRDTQRVYRLHD
Ga0126378_1223174723300010361Tropical Forest SoilMFNFSANHLLLLSRMEYRRCVVFLMQDHSTRRVYRL
Ga0136449_10137616123300010379Peatlands SoilMFNFSANHLLLLSRMEYRSCVVFLMQDHSTRRVYR
Ga0136449_10360104323300010379Peatlands SoilMFNFSTNHLTLLSRTDLRFCAVFMVLDHSTHRVYRRHDLTKAHAMDPPNR*
Ga0137428_121018623300011432SoilMFNFSANHLALISRTEYRSCAVFLMKDDSTHRVYR
Ga0137378_1184172013300012210Vadose Zone SoilMFNFSANHLFLLSRTEYRSYVVFVMQDHSTRRVYR
Ga0137370_1063100113300012285Vadose Zone SoilMFNFSANHLLLLSRMEYRSCVVFLMKDDSTRRVYRL
Ga0137371_1068281823300012356Vadose Zone SoilMFNFSANHLALISRTESRSCAVFLMRDDSTHRVYR
Ga0137390_1020062613300012363Vadose Zone SoilMFNFSANHLFLISRTEYASCAVLLMLDHDTRRVYRLLDFTKR
Ga0137416_1116176813300012927Vadose Zone SoilMFNFSANHLLLLSRMEYRTCVVFLMQDDSTRRVYRL
Ga0137407_1031910213300012930Vadose Zone SoilMFNVSANHLVLLSRTECRRCVVFVMKDDSTRRVYRLYDFTKSRIITPEKY
Ga0126369_1197039223300012971Tropical Forest SoilMFNFSANHLLLLSRTEYRSCVVFVMRDDTTRRVYRL
Ga0157378_1071667023300013297Miscanthus RhizosphereMFNFSANHLFLLSRTEYPACAVFLLKDHDTKRVYRLYDF
Ga0181539_122605113300014151BogMFNFSANHLLLLSRTEYRSCAVFLMQDYSTRRVYRLY
Ga0181527_114623933300014153BogMFNFSANHLLLLSRMEYRTCVVFLMQDHSTRRVYR
Ga0181531_1088077423300014169BogMFNFSANHLLLLSRTEYPSCAVFLLRDLDTQRVYRLHD
Ga0075322_119036823300014311Natural And Restored WetlandsMFNFSANHLLLLSRTEYRKCAVFLLRDLDTQRVYRLHDFT
Ga0182001_1052493813300014488SoilMFNFSANHLLLLSRTECRSCAVFVLRDDSTRRVYRLYG
Ga0182017_1017382533300014494FenMFNFSANHLLLLSRTEYPSYAVFLLRDLDTQRVYRLL*
Ga0182011_1024983033300014496FenMFNFSANHLFLLSRTEYRSCAVLLMQDRDTQRVYR
Ga0182024_1022020833300014501PermafrostMFNFSANHLFLLSRTEYPSCAVFLLRDLDTKRVYRL
Ga0157377_1063837523300014745Miscanthus RhizosphereMFNFSANHLFLLSRTEYRSCAVFLLRDGDTKRVYRL
Ga0137412_1018451213300015242Vadose Zone SoilMFNFSANHLFLISRTEHPSYAVLLMQDRDTKRVYRL
Ga0132256_10328803913300015372Arabidopsis RhizosphereMFNFSANHLFLISRTEYSSCAVLLMLDHDTRRVYRLFD
Ga0187850_1006032133300017941PeatlandMFNFSANHLTLLSRTEYRSCAVFMVLDHSTHRVYRLHDFTK
Ga0187778_1046331823300017961Tropical PeatlandMFNFSANHLRLLSRTEYRSCAVFLLQDDSTRRVYRL
Ga0187781_1003857713300017972Tropical PeatlandMFNFSANHLTLLSRTEYRSCAVFMVLDHSTHRVYRLHD
Ga0187782_1079605723300017975Tropical PeatlandMFNLSANHLFLLSRKEYRSCAVLMPVDGDTQRVYRLHDFTKTHHLVPGQAYCVAG
Ga0187816_1053958123300017995Freshwater SedimentMFNFSANHLFLLSRKEYRSCAVFLILDRDTQRVYRMHDF
Ga0187865_106457913300018004PeatlandMFNFSANHLLLLSRTEYQKCAVFLLQDLDTQRVYRLYD
Ga0187884_1005795233300018009PeatlandMFNFSANHLFLLSRKEYRSCAVLLMLDRDTQRVYRLHDFT
Ga0187810_1008799233300018012Freshwater SedimentMFNFSANHLFLISRTEYPSCAVLLMLDRDTQRVYRLLD
Ga0187873_122135523300018013PeatlandMFNFSANHLILLSRTEYASCAVFVMLDLDTRRVYRLFDF
Ga0187873_133964513300018013PeatlandMFNFSANHLFLLSRKEYRSCAVLLLLDRDTQRVYR
Ga0187874_1008041533300018019PeatlandMFNFSANHLLLLSRTEYQKCAVFLLRDLDTQRVYRL
Ga0187863_1053771423300018034PeatlandMVNFSANHLFLISRTEYRKWAVFLLQDLDTQRVYRLYDFT
Ga0187862_1002955883300018040PeatlandMFNFSANHLFLLSRKEPRSCPVLLLVDRDTQRVYRLHDFTKTHH
Ga0187887_1061288823300018043PeatlandMFNLSANHLFLLSRTEYRKCAVFLLRDLDTQRVYRLYDFTKALLLRPGVA
Ga0187771_1037022613300018088Tropical PeatlandMFNFSANHLCLLSRKEYRSCAVLLLIDRDTQRVYRL
Ga0066667_1132548323300018433Grasslands SoilMFNFSANHLFLLSRTEYRTCVVFIMQDHSTHRVYRL
Ga0066662_1245958623300018468Grasslands SoilMFNFSANHLLLFSRTEYRSCAVFLMQDHSTRRVYRL
Ga0066669_1092570613300018482Grasslands SoilMFNFSANHLFLLSRKEYRSCAVLLLLDHDTQRVYRL
Ga0187892_1002905353300019458Bio-OozeMFNFSANHLLLLSRMEYPSCVVFLMRDDSTGRVYR
Ga0182028_121446723300019788FenMFNFSANHLFLLSRTEYQKCAVFLLRDLDTQRVYR
Ga0137408_113994713300019789Vadose Zone SoilMFNFSANHLLLLSRTEYQKCAVFLLREDLDTQRVYR
Ga0179592_1008005713300020199Vadose Zone SoilMFNFSANHLLLLSRMEYRSCVVFLMKDDSTRQVYRLY
Ga0194121_1040871413300020200Freshwater LakeMFDFSANHLFLLQRTEYRTCAVFYVLDGDTKRVYR
Ga0194127_1030339723300020221Freshwater LakeMFNFSANHLLLISRTEYPSYAVLRMRDRDTQRVYRLYDP
Ga0210389_1106192713300021404SoilMFNFSANHLLLLSRKEYRTCAVLLMRDDSTRRVYRLHDFTK
Ga0210384_1045030623300021432SoilMFNFSANHLHLLSRTEYRSCVVFVMVDDSTRRCYRLYAFT
Ga0210390_1138390213300021474SoilMFNFSANHLFLLSRTEYPSCALFLLRDLDTQRVYRLH
Ga0126371_1007083213300021560Tropical Forest SoilMFNFSANHLLLLSRMEYRSCVVFLMQDHSTRRVYRL
Ga0224558_103901413300023090SoilMFNFSANHLLLLSRMEYRTCVVFLMKDDSTRRVYR
Ga0208191_101657713300025496PeatlandMFNFSANHLILLSRTEYASCAVFVMLDLDTRRVYRLLDF
Ga0207693_1098837323300025915Corn, Switchgrass And Miscanthus RhizosphereMFNFSANHLLLISRTEYPSYAVLLMQDRDTQRVYRLYD
Ga0207687_1078016633300025927Miscanthus RhizosphereMFNFSANHLFLLSRTEYRSCVVFVMKDDSTRRCYRLY
Ga0207711_1131505323300025941Switchgrass RhizosphereMFNFSANHLLLLSRMEYRTCAVLLMRDDSTHRVYRLHDF
Ga0207698_1258804623300026142Corn RhizosphereMFNFSANNLFLLTRTEYPKYAVFLLQDRDTQRVYRL
Ga0209802_108159733300026328SoilMFNFSANHLLLLSRTEYRTCVVFLMQDDSTRRVYRLYD
Ga0257164_107624323300026497SoilMFNFSANHLFLISRTAYASCAVLVMLDHDTRRVYRLFDFTKCL
Ga0207722_102845213300027003Tropical Forest SoilMFNFSANHLFLLLRTEYRSCAVFLMQDRDTQRVYRL
Ga0207780_107557313300027313Tropical Forest SoilMFNFSANHLLLLSPTEYRTCTVLLMRDDSTRRVYRL
Ga0209076_121990013300027643Vadose Zone SoilMFNFSANHLLLLSRTEYRTCVVFLMQDHSTRRVYRL
Ga0256866_103603313300027650SoilMFNFSANHLLLLSRTEYPSCAVFLLRDLDTQRVYRL
Ga0209772_1010158013300027768Bog Forest SoilMFNFSANHLFLLSRTEYRKCAVFLLRDLDTQRVYR
Ga0209810_102207223300027773Surface SoilMFNFSANHLFLLSRKEYRSWAVLLLLDRDTQRVYRLHDFAKTHHLGPG
Ga0209773_1023898513300027829Bog Forest SoilMFNFSANHLLLLSRTEYRSCVVFVMKDDSTHRVYRLHDF
Ga0209611_1060708013300027860Host-AssociatedMFNFSANHLFLISRTEYSSCALLLMLDHDTRRVYRLLDFTKRLRPLPG
Ga0209167_1034993823300027867Surface SoilMFNFSANHLVLLSRTECERCLVFVMKDDSTRRVYRLYDF
Ga0209415_1099148813300027905Peatlands SoilMFNFSANHLLLLSRTDYPSYAVFLLRDLDTQRVYRLYD
Ga0265349_102784613300028037SoilMFNFSASHLRLLSRMEYRTCVVFLMQDDFTHRVYRLY
Ga0302267_1031838323300028745BogMFNFSANHLLLLSRMECRSCVVFVMRDDSTRRVYRL
Ga0302232_1062729813300028789PalsaMFHCSANHLLLLSRMEYRTCAVLLMRDDSTRRVYRLHDFTKSQTPTPGQ
Ga0308309_1003290313300028906SoilMFNFSANHLFLLSRTEYSSCAVFLMLDHDTQRVYRPG
Ga0308309_1189617613300028906SoilMFNFSANHLLLLSRTEYPSCAVFLLRDLDTKRVYRLHDFTK
Ga0222749_1064713823300029636SoilMFNFSANHLLLLSRMEYRSCVVFLMKDDSTRRVYR
Ga0222749_1068530423300029636SoilMFNFSANHLFLISRTEYASCAVLVMLDHDTRRVYRLFDF
Ga0311327_1064511313300029883BogMFNFSANHLFLLSRTEYPSCAVFLLRDLDTQRVYR
Ga0246001_107318823300029889PeatMFNFSANHLFLLSRKEYRSCAVLLLLDRDTQRVYRL
Ga0311328_1004680963300029939BogMFNFSANHLLLLSRTEYPSCAVFLLRDLDTQRVYR
Ga0311339_1111931213300029999PalsaMFNFSANHLILLSRTECRRCVVFVMKDDSTRRVYRLYD
Ga0311339_1146001713300029999PalsaMFNFSANHLFLLSRTEYQKCAVFVLRDLDTQRVYRLY
Ga0311354_1129303113300030618PalsaMFHCSANHLLLLSRMEYRTCAVLLMRDDSTRRVYR
Ga0302325_1012836173300031234PalsaMFHCSANHLLLLSRMEYRTCAVLLMRDDSTRRVYRLHD
Ga0302325_1101303633300031234PalsaMFNFSANHLLLLSRTEYPSCAVFLLRDLDTQRVYRHH
Ga0302324_10117990313300031236PalsaMFNFSANHLLLLSRTEYQKCAVFLLRDLDTQRVYR
Ga0170819_1221197923300031469Forest SoilMFNFSANHLLLLSRMEYRTCVVFLMKDDSTRRVYRL
Ga0302320_1072083623300031524BogMFNFSANHLFLLSRTEYPSCAVFLLRDLDTQRVYRLHD
Ga0310915_1026647213300031573SoilMFNFSANHLLLLSRREYPSCVVFLMQDHSTRRVYRLYD
Ga0310915_1030577533300031573SoilMFNFSANHLLLLSRMEYRTCAVLLMRDDSTRRVYR
Ga0307508_1049138413300031616EctomycorrhizaMFNFSANHLLLLSRMEYRTCAVLLMRDDSTHRVYRL
Ga0307374_10003659243300031670SoilMFNFSAKHLFLLSRKEYRSCAVLLLLDRGTQRVYRLHDFTKTHRLGSTGGPVHA
Ga0318561_1050138313300031679SoilMFNFSANHLVLISRTEYPSYAVLLMQDHDTRRVYR
Ga0310686_10061382313300031708SoilMFNFSANHLFLLSRTEYRSCVVFVMKDDSTHRVYRLHD
Ga0310686_10748932513300031708SoilMFNFSANHLFLLSRTEYRSCAVLLLLDRDTQRVYR
Ga0310686_10830108313300031708SoilMFNFSANHLILLSRTECRRCVVFVMKDDSTRRVYRL
Ga0306918_1113111323300031744SoilMFNFSANHLLLLSRMEYRGCVVFLMQDHSTHRVYR
Ga0318576_1010167613300031796SoilMFNFSANHLVLISRTEYPSYAVLLMRDHDTRRVYRLYD
Ga0310917_1002327863300031833SoilMFNFSANHLLLLSRTEHRTCVVFLMQDDSTHRLYR
Ga0306921_1173121513300031912SoilMLMLRANPLLLLSPTEYPSCAVFLLRDLDTQRVYRLYDFT
Ga0308175_10223962813300031938SoilMFNFSANHLFLLSRTEYPSCAVFLLQDRDTKRVYRLY
Ga0310909_1145979913300031947SoilMFNFSANHLFLLSRTEYCSCALLLMLDRDTRRVYRLFDFTKR
Ga0315278_1142380113300031997SedimentMFNFSANNLILLSRTECKSCVIFVMKDLHTKRLYRLY
Ga0306922_1028360323300032001SoilMFNFSANHLFLHSRTEYPSCVVFLLRDLDTQRVYRLYDFTK
Ga0318553_1031530013300032068SoilMFNFSANHLFLLSRTEYASCAVLVMLDHDTRRVYR
Ga0311301_1284041913300032160Peatlands SoilMFNFSANHLLLLSRTEYPSCAVFLLRDIDPQRVYR
Ga0335082_1141732813300032782SoilMFNFSANHLFLLSRTEYPSCAVFLFKDLDTQRVYRLHDFTK
Ga0335079_1076606213300032783SoilVFNFSANHLILISRTEYPSHAVLLMRDRDTQRVYRL
Ga0335080_1095497233300032828SoilMFNFSANHLFLLSRTEYSSCAVLLMLDHDTQRVYRLFDF
Ga0335077_1022131713300033158SoilMFNFSANHPFLLSRTEYASCAVLVMLDHDTQRVYRLFDFTKRLRLFAHKPSS
Ga0326728_1056716513300033402Peat SoilMFNFCANHLTLLSRTEYRPCAVFMVLHHSTHRVYRLHDFT
Ga0326727_1011127413300033405Peat SoilMFNFSANHLLLLSRKEYRSCAVLLLLDRDTQHVYRLHDFTGLTTR
Ga0326727_1105469813300033405Peat SoilMFNFSANHLALLSRTEYRSCAVFMVLDHSTHRVYRL
Ga0316628_10025920613300033513SoilMFNFSANRLLLLSRMEYRTCAVLLMRDDSTRRVYR
Ga0334850_108964_1_1143300033828SoilMFNFSANHLLLLSRMEYRTCVVFLMKDDSTHRVYRLYD
Ga0334811_088261_3_1103300033891SoilMFNFSANHLFLLSRTEYRSCAVLLMQDRDTQRVYRL
Ga0314861_0002016_23168_232783300033977PeatlandMFNFSANHLFLLSRKEYRSCAVLLLVDRDTQRVYRLH
Ga0314861_0191992_3_1313300033977PeatlandMFNFSANHLFLLSRKEYRSCAVLLLLDRDTQRVYRLHDFTQSH
Ga0326724_0297500_2_1183300034091Peat SoilMFNFSANHLFLLSRKEYRSCAVLLLLDRDTQRVYRLHDF
Ga0326724_0520964_470_6043300034091Peat SoilMFNFSANHLLLISRTEYPSYAVLPMQDCDTKRVFRLYDFSKAQLI

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.