| Basic Information | |
|---|---|
| Family ID | F050181 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 43 residues |
| Representative Sequence | VSGDLLLVKGSRGVKMEQIVESLIARHAAPGEITSQEVRH |
| Number of Associated Samples | 123 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.83 % |
| % of genes near scaffold ends (potentially truncated) | 95.17 % |
| % of genes from short scaffolds (< 2000 bps) | 86.90 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.655 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.207 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.862 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.59% β-sheet: 0.00% Coil/Unstructured: 79.41% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF10555 | MraY_sig1 | 89.66 |
| PF08245 | Mur_ligase_M | 5.52 |
| PF01225 | Mur_ligase | 1.38 |
| PF08478 | POTRA_1 | 0.69 |
| PF03033 | Glyco_transf_28 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG0770 | UDP-N-acetylmuramyl pentapeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG0773 | UDP-N-acetylmuramate-alanine ligase MurC and related ligases, MurC/Mpl family | Cell wall/membrane/envelope biogenesis [M] | 1.38 |
| COG1589 | Cell division septal protein FtsQ | Cell cycle control, cell division, chromosome partitioning [D] | 0.69 |
| COG4775 | Outer membrane protein assembly factor BamA | Cell wall/membrane/envelope biogenesis [M] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002562|JGI25382J37095_10171350 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300002908|JGI25382J43887_10290813 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300002917|JGI25616J43925_10042501 | All Organisms → cellular organisms → Bacteria | 1987 | Open in IMG/M |
| 3300003224|JGI26344J46810_1004907 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300004082|Ga0062384_101064440 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300004092|Ga0062389_102755874 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300004635|Ga0062388_102160622 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005174|Ga0066680_10373765 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005176|Ga0066679_10844656 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005447|Ga0066689_10022423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3111 | Open in IMG/M |
| 3300005529|Ga0070741_11050125 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300005553|Ga0066695_10000145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16515 | Open in IMG/M |
| 3300005554|Ga0066661_10404625 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300005566|Ga0066693_10003459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3946 | Open in IMG/M |
| 3300005568|Ga0066703_10248052 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300005574|Ga0066694_10142774 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300005575|Ga0066702_10436075 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300005610|Ga0070763_10728392 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300006086|Ga0075019_10308595 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300006914|Ga0075436_100243998 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300007258|Ga0099793_10247626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 860 | Open in IMG/M |
| 3300007258|Ga0099793_10506221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300009088|Ga0099830_10035133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3425 | Open in IMG/M |
| 3300009143|Ga0099792_10289230 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
| 3300010043|Ga0126380_10951707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300010303|Ga0134082_10005670 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4458 | Open in IMG/M |
| 3300010321|Ga0134067_10338453 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300010322|Ga0134084_10024918 | All Organisms → cellular organisms → Bacteria | 1638 | Open in IMG/M |
| 3300010322|Ga0134084_10451219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300010336|Ga0134071_10020047 | All Organisms → cellular organisms → Bacteria | 2819 | Open in IMG/M |
| 3300010360|Ga0126372_11148784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300010361|Ga0126378_10981244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 949 | Open in IMG/M |
| 3300010366|Ga0126379_11103449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 899 | Open in IMG/M |
| 3300010937|Ga0137776_1461918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300011120|Ga0150983_15491081 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
| 3300011269|Ga0137392_10085873 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2451 | Open in IMG/M |
| 3300011271|Ga0137393_10180452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1775 | Open in IMG/M |
| 3300012189|Ga0137388_10887654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 825 | Open in IMG/M |
| 3300012189|Ga0137388_10903554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 817 | Open in IMG/M |
| 3300012198|Ga0137364_10017673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4300 | Open in IMG/M |
| 3300012199|Ga0137383_10662104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300012200|Ga0137382_10404232 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 963 | Open in IMG/M |
| 3300012202|Ga0137363_10705016 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300012202|Ga0137363_11349090 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300012203|Ga0137399_10998467 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 705 | Open in IMG/M |
| 3300012203|Ga0137399_11064044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300012205|Ga0137362_10531214 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1016 | Open in IMG/M |
| 3300012205|Ga0137362_11655444 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300012206|Ga0137380_10565877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 996 | Open in IMG/M |
| 3300012207|Ga0137381_10907811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 761 | Open in IMG/M |
| 3300012349|Ga0137387_10135718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1744 | Open in IMG/M |
| 3300012361|Ga0137360_10188982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1660 | Open in IMG/M |
| 3300012361|Ga0137360_10855035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300012363|Ga0137390_10123875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2560 | Open in IMG/M |
| 3300012917|Ga0137395_10936337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300012918|Ga0137396_10076165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2354 | Open in IMG/M |
| 3300012918|Ga0137396_10631217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300012923|Ga0137359_11393238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300012927|Ga0137416_10770046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300012927|Ga0137416_11696542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300012944|Ga0137410_11134038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300012976|Ga0134076_10530463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300012986|Ga0164304_10129656 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
| 3300012986|Ga0164304_10663267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300015053|Ga0137405_1389364 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300015241|Ga0137418_10365997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300015356|Ga0134073_10114741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
| 3300015358|Ga0134089_10478962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300017657|Ga0134074_1306082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300017939|Ga0187775_10387997 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300017943|Ga0187819_10349573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300017993|Ga0187823_10346565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300019789|Ga0137408_1015139 | All Organisms → cellular organisms → Bacteria | 2027 | Open in IMG/M |
| 3300020170|Ga0179594_10016317 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2179 | Open in IMG/M |
| 3300020579|Ga0210407_10506096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300020579|Ga0210407_11082771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300020580|Ga0210403_10823136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300020581|Ga0210399_10437136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300020581|Ga0210399_11058458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300020583|Ga0210401_10166191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2059 | Open in IMG/M |
| 3300020583|Ga0210401_10971366 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 708 | Open in IMG/M |
| 3300020583|Ga0210401_11293189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300021088|Ga0210404_10124166 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300021088|Ga0210404_10360248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
| 3300021168|Ga0210406_11239961 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300021170|Ga0210400_11297340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300021180|Ga0210396_11464211 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300021401|Ga0210393_10114940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2148 | Open in IMG/M |
| 3300021402|Ga0210385_11319157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300021407|Ga0210383_10407814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1172 | Open in IMG/M |
| 3300021474|Ga0210390_11002169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 682 | Open in IMG/M |
| 3300021475|Ga0210392_10281139 | All Organisms → cellular organisms → Bacteria | 1188 | Open in IMG/M |
| 3300021478|Ga0210402_10448522 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300021478|Ga0210402_11161397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 699 | Open in IMG/M |
| 3300021479|Ga0210410_10008167 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9046 | Open in IMG/M |
| 3300021479|Ga0210410_10426442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1187 | Open in IMG/M |
| 3300021479|Ga0210410_10588939 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 988 | Open in IMG/M |
| 3300021479|Ga0210410_11375708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300021559|Ga0210409_11618326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300021560|Ga0126371_11750917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300022522|Ga0242659_1081867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300024325|Ga0247678_1027732 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 882 | Open in IMG/M |
| 3300024330|Ga0137417_1452024 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1930 | Open in IMG/M |
| 3300025905|Ga0207685_10767980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300026296|Ga0209235_1083693 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300026304|Ga0209240_1170510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300026305|Ga0209688_1102119 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 534 | Open in IMG/M |
| 3300026309|Ga0209055_1144801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 837 | Open in IMG/M |
| 3300026343|Ga0209159_1005869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7759 | Open in IMG/M |
| 3300026355|Ga0257149_1046219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300026359|Ga0257163_1058922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300026371|Ga0257179_1007880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1059 | Open in IMG/M |
| 3300026499|Ga0257181_1089092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300026550|Ga0209474_10562708 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 580 | Open in IMG/M |
| 3300026552|Ga0209577_10654720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300026555|Ga0179593_1222253 | All Organisms → cellular organisms → Bacteria | 2610 | Open in IMG/M |
| 3300027034|Ga0209730_1035350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300027376|Ga0209004_1055039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300027535|Ga0209734_1097516 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300027587|Ga0209220_1014344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2111 | Open in IMG/M |
| 3300027643|Ga0209076_1038121 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300027643|Ga0209076_1148104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300027643|Ga0209076_1160411 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300027643|Ga0209076_1186176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
| 3300027671|Ga0209588_1118212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300027862|Ga0209701_10293941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300027903|Ga0209488_10377106 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1052 | Open in IMG/M |
| 3300028047|Ga0209526_10516330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 776 | Open in IMG/M |
| 3300028146|Ga0247682_1097251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300030991|Ga0073994_10064819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 989 | Open in IMG/M |
| 3300031474|Ga0170818_109372208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300031564|Ga0318573_10488792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300031718|Ga0307474_10214063 | All Organisms → cellular organisms → Bacteria | 1470 | Open in IMG/M |
| 3300031720|Ga0307469_11726684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300031747|Ga0318502_10783446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300031764|Ga0318535_10108157 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300031833|Ga0310917_10599515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
| 3300031893|Ga0318536_10049548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2025 | Open in IMG/M |
| 3300031962|Ga0307479_12165174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300032001|Ga0306922_11878853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300032091|Ga0318577_10190189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 981 | Open in IMG/M |
| 3300032174|Ga0307470_11809477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300032205|Ga0307472_101763046 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300033004|Ga0335084_12436277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300033158|Ga0335077_11010648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 828 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.66% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 9.66% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 6.21% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.14% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.45% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.38% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.69% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.69% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.69% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.69% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.69% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.69% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.69% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003224 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022522 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027034 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027535 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25382J37095_101713502 | 3300002562 | Grasslands Soil | TGDLLLVKGSRGVKMEQIVEKLIVRHAAPGEITGQEVKH* |
| JGI25382J43887_102908132 | 3300002908 | Grasslands Soil | VDSGDLVLVKGSRGVKMEQIVDALIARYAAPGEFSGQEVWH* |
| JGI25616J43925_100425011 | 3300002917 | Grasslands Soil | VSGDLLLVKGSRGVKMEQIVESLIARHAAPGEITSQEVRH* |
| JGI26344J46810_10049071 | 3300003224 | Bog Forest Soil | LEEIISPGDVLLVKGSRGVKMERIVEALLTRYAAPGELPLPEVRH* |
| Ga0062384_1010644401 | 3300004082 | Bog Forest Soil | TTGDLLLVKGSRGVKMERIVEALIARHTESGGATPRPEVRH* |
| Ga0062389_1027558741 | 3300004092 | Bog Forest Soil | GDLLLVKGSRGVKMERIVEALIARHTESGGAPGAAPRSEVRH* |
| Ga0062388_1021606221 | 3300004635 | Bog Forest Soil | LEEIIAPGDVLLVKGSRGVKMERIVELLLTRYAAPGEIPRQEVRH* |
| Ga0066680_103737651 | 3300005174 | Soil | IPGDLLLVKGSRGVKMEQIVESLIARHAAPGEFSAQQVRH* |
| Ga0066679_108446562 | 3300005176 | Soil | EFLAGFIVSGDLLLVKGSRGVKMEQIVESLIARHTAAGEITGQEVRH* |
| Ga0066689_100224234 | 3300005447 | Soil | TPLEAAEFLAGFIVSGDLLLVKGSRGVKMEQIVESLIARHTAAGEITGQEVRH* |
| Ga0070741_110501252 | 3300005529 | Surface Soil | SFFSPGDLLLVKGSRGVKMEKIVERLLAHHGAAREEVRH* |
| Ga0066695_1000014516 | 3300005553 | Soil | VAPGDLLLVKGSRGVKMEQIVDALIARHAAPGELSRQEVRH* |
| Ga0066661_104046252 | 3300005554 | Soil | LEAAEFLAGFIVSGDLLLVKGSRGVKMEQIVESLIARHTAAGEITGQEVRH* |
| Ga0066693_100034594 | 3300005566 | Soil | VSGDLLLVKGSRGVKMEQIVESLIARHTAAGEITGQEVRH* |
| Ga0066703_102480521 | 3300005568 | Soil | GDLLLVKGSRGVKMEQIVDALIARHAAPGELSRQEVRH* |
| Ga0066694_101427741 | 3300005574 | Soil | FLETLVAPGDLLLVKGSRGVKMEQIVEALIARNAAQGESSRQEVRH* |
| Ga0066702_104360752 | 3300005575 | Soil | EAAEFLAGFIVSGDLLLVKGSRGVKMEQIVESLIARHTAAGEITGQEVRH* |
| Ga0070763_107283921 | 3300005610 | Soil | AEYLKDLLVSGDLLLVKGSRGVKMERIVEVLIVRHAVPGEKSDQEVKH* |
| Ga0075019_103085951 | 3300006086 | Watersheds | SGDLLLVKGSRGVKMEQIVETLIARHAAPGEIKSQEVRH* |
| Ga0075436_1002439981 | 3300006914 | Populus Rhizosphere | KFFQPGDLLLVKGSRGVKMERIVEALIAVHASDAPREEVRH* |
| Ga0099793_102476262 | 3300007258 | Vadose Zone Soil | LVKGSRGVKMERIVESLIAQHAAPGEFSGEEVRH* |
| Ga0099793_105062211 | 3300007258 | Vadose Zone Soil | LVKGSRGVKMEQIVESLIARHAAPGEIMGQEVRH* |
| Ga0099830_100351334 | 3300009088 | Vadose Zone Soil | GDLLLVKGSRGVKMEQIVETLIARNAAPGEIMGQEARH* |
| Ga0099792_102892302 | 3300009143 | Vadose Zone Soil | TPQETAEFLAGFIVSGDLLLVKGSRGVKMEQIVETLIVRHAAPGEIAGQEVKH* |
| Ga0126380_109517071 | 3300010043 | Tropical Forest Soil | PGDLLLVKGSRGVKMERIVDALISAHADARVPREEVRH* |
| Ga0134082_100056705 | 3300010303 | Grasslands Soil | ADFIASGDLLLVKGSRGVKMEQIVEALIARHAAAGEITGQEVQH* |
| Ga0134067_103384532 | 3300010321 | Grasslands Soil | AGDLLLIKGSRGVKMEQIVDALIARYAAPGEFSRQEVRH* |
| Ga0134084_100249181 | 3300010322 | Grasslands Soil | EFLADFITTGDLLLVKGSRGFKMELIVEALVSRHVVAGEMTGVEVRY* |
| Ga0134084_104512192 | 3300010322 | Grasslands Soil | PQEAAEFLAGFIVSGDLLLVKGSRGVKMEQIVESLIARHTAAGEITGQEVRH* |
| Ga0134071_100200474 | 3300010336 | Grasslands Soil | AGFLADFIASGDLLLVKGSRGVKMEQIVEALIARHAAAGEITGQEVQH* |
| Ga0126372_111487842 | 3300010360 | Tropical Forest Soil | FQPGDLLLVKGSRGVKMERIVEALLAAHVSSDAPREEVRH* |
| Ga0126378_109812442 | 3300010361 | Tropical Forest Soil | AEFLGSLVSSGDLILVKGSRGVKMEQIVDALIARYAAPGEFSGQEVRH* |
| Ga0126379_111034491 | 3300010366 | Tropical Forest Soil | FLETLVAPGDLLLVKGSRGVKMEQIVDALIARHAAPGEFLRQEVRH* |
| Ga0137776_14619181 | 3300010937 | Sediment | QFFQPGDLLLVKGSRGVKMERIVDALISAHADTGVPREEVRH* |
| Ga0150983_154910812 | 3300011120 | Forest Soil | PTPLEAAQFLETLLVSGDLLLVKGSRGVKMEQIVEALIAKNASPGEFSNQEVRH* |
| Ga0137392_100858733 | 3300011269 | Vadose Zone Soil | VKGSRGVKMEQIVEALIARHAALAEIAGRQEVRH* |
| Ga0137393_101804522 | 3300011271 | Vadose Zone Soil | VSGDLLLVKGSRGVKMEQIVESLIAQHAAPGEIMGQEVRH* |
| Ga0137388_108876541 | 3300012189 | Vadose Zone Soil | MAGDLLLVKGSRGVKMEQIVEKLIVRHAAPGEITRQEVKH* |
| Ga0137388_109035542 | 3300012189 | Vadose Zone Soil | RSIVVSGDLLLVKGSRGVKMERIVESLIAQHAAPGEFSGQELRH* |
| Ga0137364_100176734 | 3300012198 | Vadose Zone Soil | LETLVAPDDLLLVKGSRGVKMEQIVEALIARNAAQGESSRQEVRH* |
| Ga0137383_106621041 | 3300012199 | Vadose Zone Soil | PQEAGEFLESFIVSGDLLLVKGSRGVKMEQIVESLIARHAAPGEIMGQEVPH* |
| Ga0137382_104042321 | 3300012200 | Vadose Zone Soil | ALLLVTGSRGVKMAQIVESLIAQHAAPGEILGQEVRH* |
| Ga0137363_107050162 | 3300012202 | Vadose Zone Soil | GDLLLVKGSRGVKMEQIVEALIARHAAAGEITGQEVRH* |
| Ga0137363_113490901 | 3300012202 | Vadose Zone Soil | FLSSFIMTGDLLLVKGSRGVKMEQIVETLIVRHAAPGEIAGQEVKH* |
| Ga0137399_109984672 | 3300012203 | Vadose Zone Soil | VLVSGDLLLVKGSRGVKMERIVESLIAQHAAPGKFSGQELRH* |
| Ga0137399_110640442 | 3300012203 | Vadose Zone Soil | PQEAAEFLESFMVSGDLLLVKGSRGVKMEQIVESLIARHSAPGEIMGQEVQH* |
| Ga0137362_105312142 | 3300012205 | Vadose Zone Soil | SFIVSGDLLLVKGSRGVKMEHIVESLIARHAAPGETLGQEVQH* |
| Ga0137362_116554441 | 3300012205 | Vadose Zone Soil | SLIVSGDLLLVKGSRGVKMEQIVEKLITRHAAPGEIAGQEVKH* |
| Ga0137380_105658772 | 3300012206 | Vadose Zone Soil | RAHTKFFPAPPKAAEFLETLVSHGDLLLKKGSRGVKMEQIVDALIARHAAPGEYSRQEVRH* |
| Ga0137381_109078112 | 3300012207 | Vadose Zone Soil | PLEAAEFLASLIVSGDLLLVKGSRGVKMEQIVEKLIVRHAAPGEITGQEVKH* |
| Ga0137387_101357183 | 3300012349 | Vadose Zone Soil | AEFLANFIVSGDLLLVKGSRGVKMEQIVESLIARHAAPGEITSQEVRH* |
| Ga0137360_101889821 | 3300012361 | Vadose Zone Soil | LVKGSRGVKMEQIVEALIARHAALAEIAGRQEVRH* |
| Ga0137360_108550351 | 3300012361 | Vadose Zone Soil | DAGTFVQKFFQPGDLLLVKGSRGVKMERIAEALIAAHASTDARREEVRH* |
| Ga0137390_101238751 | 3300012363 | Vadose Zone Soil | EAAEFLESFIVSGDLLLVKGSRGVKMEQIVESLIARHAAPGETMGEEVRH* |
| Ga0137395_109363372 | 3300012917 | Vadose Zone Soil | LLVKGSRGVKMERIVESLIAQHAAPGEFSGQELRH* |
| Ga0137396_100761651 | 3300012918 | Vadose Zone Soil | LLVKGSRGVKMERVVEALLTRYVSPGERSREEITN* |
| Ga0137396_106312171 | 3300012918 | Vadose Zone Soil | TPQEAAEFLAGFIVSGALLLVKGSRGVRMEQFVETLIARHAAPGETEGQEVWH* |
| Ga0137359_113932382 | 3300012923 | Vadose Zone Soil | PLEAAEFLASLIVSGDLLLVKGSRGVKMEQIVENLIARHAAPGEIAGQEVKH* |
| Ga0137416_107700461 | 3300012927 | Vadose Zone Soil | IVSGDLLLVKGSRGVKMEQIVETLIARHAAPGEFTGPEVRH* |
| Ga0137416_116965421 | 3300012927 | Vadose Zone Soil | LVKGSRGVKMEQIVESLIARHSAPGEIIGQEVQH* |
| Ga0137410_111340382 | 3300012944 | Vadose Zone Soil | DLLLVKGSRGVKMERIVESLIAQHAAPGEFSGQELRH* |
| Ga0134076_105304632 | 3300012976 | Grasslands Soil | EFLRSILVSGDLLLVKGSRGVKMERIVESLIAQHAAPGEFSGEGVRH* |
| Ga0164304_101296561 | 3300012986 | Soil | EAAKFLEELFTTGDVLLVKGSRGVKMERIVEALLARYAAPGEVPHHEVRH* |
| Ga0164304_106632672 | 3300012986 | Soil | AGAFVQQFFQPGDLLLVKGSRGVKMERIVEALIAAHAAVDVPREEVRP* |
| Ga0137405_13893642 | 3300015053 | Vadose Zone Soil | LLLVKGSRGVKMEQIVEALIARHAAAGEITGQEVRH* |
| Ga0137418_103659971 | 3300015241 | Vadose Zone Soil | DLLLVKGSRGVKMEQIVETLIVRHAATGEIMGQEVRH* |
| Ga0134073_101147411 | 3300015356 | Grasslands Soil | ATPLEAAQFLAGFIVSGDLLLVKGSRGVKMEQIVESLIARHTAAGEITGQEVRH* |
| Ga0134089_104789622 | 3300015358 | Grasslands Soil | GDLLLVKGSRGVKMEQIVEALIARHAVAGEITGQEVRY* |
| Ga0134074_13060821 | 3300017657 | Grasslands Soil | LLLVKGSRGVKMEQIVEALIARNAAQGEFSRQEVRH |
| Ga0187775_103879971 | 3300017939 | Tropical Peatland | PQEAAGFLGDLMTSGDLLLVKGSRGVKMEQIVETLIARHAAPGEFSREEVRH |
| Ga0187819_103495731 | 3300017943 | Freshwater Sediment | LLVKGSRGVKMEQIAEALITRHAAAGETPDWEVRH |
| Ga0187823_103465652 | 3300017993 | Freshwater Sediment | ARFLEDFLTAGDVLLVKGSRGVKMERIVEALLTRHSASGEAPRQEVRH |
| Ga0137408_10151391 | 3300019789 | Vadose Zone Soil | PKILPTGRSGDLLLVKGSRGVKMERIAEALIAAHASTDARREEVRH |
| Ga0179594_100163173 | 3300020170 | Vadose Zone Soil | LAGFIEAGDLLLVKGSRGVKMEQIVEALIARHAAAGEITGQEVRH |
| Ga0210407_105060962 | 3300020579 | Soil | GDLLLVKGSRGVKMERIVEALIVRHAVPGENSGQEVKH |
| Ga0210407_110827711 | 3300020579 | Soil | PTPEQAAEFLGTLVVAGDLLLVKGSRGVKMERIVESLITRHSTQGEFPEREPKH |
| Ga0210403_108231361 | 3300020580 | Soil | DLLLVKGSRGVKMEQIVEALIAKNASPGEFSNQEVRH |
| Ga0210399_104371362 | 3300020581 | Soil | VLLVKGSRGVQMERIVESLLIRYAAPGEIPRQEVRH |
| Ga0210399_110584582 | 3300020581 | Soil | FLMPGDLLLVKGSRGVKMERVVEALLTRHLAPGEESHEEVSH |
| Ga0210401_101661911 | 3300020583 | Soil | INPGDVLLVKGSRGVKMECIVEALLTRYAAPGEIPRQEVRH |
| Ga0210401_109713661 | 3300020583 | Soil | KSGDLLLVKGSRGVKMERIVESLIARHAAPGENSSQEVGH |
| Ga0210401_112931891 | 3300020583 | Soil | NFLQDFITAGDVLLVKGSRGVKMERIVESLIVRYAAPGEIPRQEVRH |
| Ga0210404_101241661 | 3300021088 | Soil | ASGDLLLVKGSRGVKMEQIVESLIARHAAPGEIMGQEARH |
| Ga0210404_103602482 | 3300021088 | Soil | SGDLLLVKGSRGVKMEQIVELLIARHAAPGEILGQEARH |
| Ga0210406_112399612 | 3300021168 | Soil | GDLLLVKGSRGVKMEQIVEALIARHAAAGEITDQEVGH |
| Ga0210400_112973401 | 3300021170 | Soil | RSVKGSRGVKMEQIVESLIARHAAPGEIMGQEARH |
| Ga0210396_114642111 | 3300021180 | Soil | AAEFLVSFFLSGDLLLVKGSRGVKMEQIVETLIVQHAATSEITGQETRH |
| Ga0210393_101149403 | 3300021401 | Soil | KFLEEFITAGDVLLVKGSRGVQMERIVESLLIRYAAPGEIPRQEVRH |
| Ga0210385_113191572 | 3300021402 | Soil | FFPTPEEAAEFLGNLVVAGDLLLIKGSRGVKMERIVESLITRHSTQGEFPERELKH |
| Ga0210383_104078141 | 3300021407 | Soil | EFITAGDVLLVKGSRGVKMECIVEALLTRYAAPGEIPRQEVRH |
| Ga0210390_110021692 | 3300021474 | Soil | PGDVLLVKGSRGVKMECIVEALLTRYAAPGEIPRQEVRH |
| Ga0210392_102811391 | 3300021475 | Soil | EEFITAGDVLLVKGSRGVKMERIVEALLMRHAAPAEVPPHEVRH |
| Ga0210402_104485222 | 3300021478 | Soil | VLLVKGSRGVKMERIVESLLIRYAAPGEIPRQEVRH |
| Ga0210402_111613972 | 3300021478 | Soil | ASFLVDFLTAGDVLLVKGSRGVQMERIVESLLARHAAPVEIPRQEVRH |
| Ga0210410_100081679 | 3300021479 | Soil | LEEFITAGDVLLVKGSRGVKMERIVESLLIRYAAPGEIPRQEVRH |
| Ga0210410_104264422 | 3300021479 | Soil | VSGDLLLVKGSRGVKMEQIVESLIARHAAPGEIMGQEARH |
| Ga0210410_105889392 | 3300021479 | Soil | DLLLVKGSRGVQMERIVEALIARHAANAEFSRKEVKH |
| Ga0210410_113757081 | 3300021479 | Soil | AGDVLLVKGSRGVQMERIVESLLARHAAPVEIPRQEVRH |
| Ga0210409_116183261 | 3300021559 | Soil | LLLVKGSRGVKMEQIVESLIARHAAPGEIMGQEARH |
| Ga0126371_117509172 | 3300021560 | Tropical Forest Soil | VAPGDLLLVKGSRGVKMEQIVDALIARHAAPGEYSRQEVRH |
| Ga0242659_10818672 | 3300022522 | Soil | GDVLLVKGSRGVKMECIVEALLTRYAAPGEIPRQEVRH |
| Ga0247678_10277321 | 3300024325 | Soil | FFQPGDLLLVKGSRGVKMERIVEALIAAHAAVDGSREEVRH |
| Ga0137417_14520243 | 3300024330 | Vadose Zone Soil | VSGDLLLVKGSRGVKMEQIVETLIARHAAPGESMGQEVQH |
| Ga0207685_107679801 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | LEELFAKGDVLLVKGSRGVKMERIVEALIARYAAPGEVPHHEVRH |
| Ga0209235_10836933 | 3300026296 | Grasslands Soil | LLVKGSRGVKMEQIVESLIARHAAPGEIMGQKVPH |
| Ga0209240_11705101 | 3300026304 | Grasslands Soil | LLVKGSRGVKMEQIVESLIARHAAPGEITSQEVRH |
| Ga0209688_11021192 | 3300026305 | Soil | VSGDLLLVKGSRGVKMEQIVESLIARHTAAGEITGQEVRH |
| Ga0209055_11448011 | 3300026309 | Soil | LEAAEFLAGFIVSGDLLLVKGSRGVKMEQIVESLIARHTAAGEITGQEVRH |
| Ga0209159_10058698 | 3300026343 | Soil | GDLLLVKGSRGVKMEQIVDALIARHAAPGELSRQEVRH |
| Ga0257149_10462192 | 3300026355 | Soil | SGDLLLVKGSRGVKMEQIVESLIARHAAPGEIMGQEVQH |
| Ga0257163_10589222 | 3300026359 | Soil | EAAEFLAGFIVSGDLLLVKGSRGVKMEQIVESLIARHAAPGEIMNLEAKH |
| Ga0257179_10078801 | 3300026371 | Soil | QEAAEFLAGFIVSGDLLLVKGSRGVKMEQIVETLIARHAAPGESMGQEVQH |
| Ga0257181_10890921 | 3300026499 | Soil | DLLLVKGSRGVKMEQIVETLIARHAAPGESMGQEVQH |
| Ga0209474_105627081 | 3300026550 | Soil | DLLLVKGSRGVKMEQIVESLIARHTAAGEITGQEVRH |
| Ga0209577_106547201 | 3300026552 | Soil | LVSPGDLLLVKGSRGVKMEQIVDALIARHAAPGEFSRQEVRH |
| Ga0179593_12222533 | 3300026555 | Vadose Zone Soil | LAGFIVSGDLLLVKGSRGVKMEQIVETLIARHAAPGESMGQEVQH |
| Ga0209730_10353501 | 3300027034 | Forest Soil | EAATFLESLVATGDLLLVKGSRSVKMEQIVEALIARHAAPGEFSRQEVRH |
| Ga0209004_10550392 | 3300027376 | Forest Soil | LLVKGSRSVKMEQIVEALIARHAAPGEFSRQEVRH |
| Ga0209734_10975161 | 3300027535 | Forest Soil | GFIVSGDLLLVKGSRGVKMEQIVESLIARHAAPGEIMGQEVRH |
| Ga0209220_10143443 | 3300027587 | Forest Soil | FIVSGDLLLVKGSRGVKMEQIVESLIARHAAPGEIMNLEAKH |
| Ga0209076_10381212 | 3300027643 | Vadose Zone Soil | PPEATEFLASLIVSGDLLLVKGSRGVKMEQIVEKLITRHAAPGEIAGQEVKH |
| Ga0209076_11481041 | 3300027643 | Vadose Zone Soil | SMVVSGDLLLVKGSRGVKMERIVESLIAQHAAPGEFSGEEVRH |
| Ga0209076_11604112 | 3300027643 | Vadose Zone Soil | IVSGDLLLVKGSRGVKMEQIVESLIARHSAPGEIMGQEVQH |
| Ga0209076_11861762 | 3300027643 | Vadose Zone Soil | EFLESFIVSGDLLLVKGSRGVKMEQIVESLIARHAAPGEIMGQEVRH |
| Ga0209588_11182122 | 3300027671 | Vadose Zone Soil | GFIVSDDLLLVKGSRGVKMEQIVESLIARHAAPGEILGQEARH |
| Ga0209701_102939412 | 3300027862 | Vadose Zone Soil | FLAGFISSGDLLLVKGSRGVKMEQIVETLIVRHAATGEIMGQEVRH |
| Ga0209488_103771061 | 3300027903 | Vadose Zone Soil | FLAGFIRSGDLLLVKGSRGVKMEQIVESLIAQHAAPGEIMGQEVRH |
| Ga0209526_105163301 | 3300028047 | Forest Soil | GSIVVSGDLLLVKGSRGVKMERIVESLITQHAAPGEFSGQELTH |
| Ga0247682_10972511 | 3300028146 | Soil | PGDLLLIKGSRGVKMERIVEALIAAHASDAPRKEVRH |
| Ga0073994_100648191 | 3300030991 | Soil | AEFLAGFIVSGDLLLVKGSRGVKMEQIVESLIARHAAPGEIMNLEAKH |
| Ga0170818_1093722081 | 3300031474 | Forest Soil | KFLEEFITTGDMLLVKGSRGVKMERIVEALLTRYAATGEAPRQEVRH |
| Ga0318573_104887922 | 3300031564 | Soil | FLETLVAPGDLLLVKGSRGVKMEQIVDTLIARHAAPGEFLRQEVRH |
| Ga0307474_102140631 | 3300031718 | Hardwood Forest Soil | LLVKGSRGVKMERIVETLLGRYAAPGEIPRQEVRH |
| Ga0307469_117266841 | 3300031720 | Hardwood Forest Soil | FQPGDLLLVKGSRGVKMERIVEALIAVHASDAPREEVRH |
| Ga0318502_107834461 | 3300031747 | Soil | LVEVGDLILVKGSRGVQMERIVDSLVAKHATPGELSRSEVPH |
| Ga0318535_101081572 | 3300031764 | Soil | AQFLETLVAPGDLLLVKGSRGVKMEQIVDTLIARHAAPGEFLRQEVRH |
| Ga0310917_105995151 | 3300031833 | Soil | LVAPGDLLLVKGSRGVKMEQIVDALIARHAVSRQEVRH |
| Ga0318536_100495483 | 3300031893 | Soil | PGDLLLVKGSRGVKMEQIVDTLIARHAAPGEFLRQEVRH |
| Ga0307479_121651742 | 3300031962 | Hardwood Forest Soil | DLLLVKGSRGVKMEQIVESLIARHAAPGEIMGQEARH |
| Ga0306922_118788532 | 3300032001 | Soil | PGDLLLVKGSRGVKMERIVEALIAAHAATSAPREEVRH |
| Ga0318577_101901892 | 3300032091 | Soil | TLVAPGDLLLVKGSRGVKMEQIVDTLIARHAAPGEFLRQEVRH |
| Ga0307470_118094772 | 3300032174 | Hardwood Forest Soil | AAEFLRTIVVSGDLLLVKGSRGVKMERIVESLIAQHAAPGEFSGQELKH |
| Ga0307472_1017630461 | 3300032205 | Hardwood Forest Soil | SIVVSGDLLLVKGSRGVKMERIVGSLIAQHAAPGEFSGQELKH |
| Ga0335084_124362771 | 3300033004 | Soil | QSGDLLLVKGSRGVKMERIVEALISTHADTSVPREEVRH |
| Ga0335077_110106481 | 3300033158 | Soil | FFRPGDLLLVKGSRGVKMERIVERLLAEEGAPQAPQSEVRH |
| ⦗Top⦘ |