| Basic Information | |
|---|---|
| Family ID | F050154 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 145 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNSSNERVY |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 145 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 55.17 % |
| % of genes near scaffold ends (potentially truncated) | 44.14 % |
| % of genes from short scaffolds (< 2000 bps) | 79.31 % |
| Associated GOLD sequencing projects | 103 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (60.000 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (22.759 % of family members) |
| Environment Ontology (ENVO) | Unclassified (57.241 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.56% β-sheet: 0.00% Coil/Unstructured: 47.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 145 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 4.83 |
| PF00255 | GSHPx | 0.69 |
| PF05257 | CHAP | 0.69 |
| PF02675 | AdoMet_dc | 0.69 |
| PF04973 | NMN_transporter | 0.69 |
| PF13385 | Laminin_G_3 | 0.69 |
| PF09834 | DUF2061 | 0.69 |
| PF00085 | Thioredoxin | 0.69 |
| PF13936 | HTH_38 | 0.69 |
| PF00685 | Sulfotransfer_1 | 0.69 |
| COG ID | Name | Functional Category | % Frequency in 145 Family Scaffolds |
|---|---|---|---|
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.69 |
| COG1586 | S-adenosylmethionine decarboxylase | Amino acid transport and metabolism [E] | 0.69 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 0.69 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.14 % |
| Unclassified | root | N/A | 15.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002303|B570J29644_1002280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1473 | Open in IMG/M |
| 3300002408|B570J29032_109302082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300002408|B570J29032_109311752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
| 3300002835|B570J40625_101703982 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300003413|JGI25922J50271_10141565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300003491|JGI25924J51412_1020887 | Not Available | 1142 | Open in IMG/M |
| 3300004448|Ga0065861_1018277 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
| 3300004836|Ga0007759_11599119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1021 | Open in IMG/M |
| 3300005069|Ga0071350_1013019 | All Organisms → Viruses → Predicted Viral | 1977 | Open in IMG/M |
| 3300005517|Ga0070374_10625847 | Not Available | 533 | Open in IMG/M |
| 3300005528|Ga0068872_10612598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300005581|Ga0049081_10156402 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300005581|Ga0049081_10298549 | Not Available | 555 | Open in IMG/M |
| 3300005582|Ga0049080_10234457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 601 | Open in IMG/M |
| 3300005662|Ga0078894_10527297 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
| 3300005662|Ga0078894_10650903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 934 | Open in IMG/M |
| 3300005662|Ga0078894_10991676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 723 | Open in IMG/M |
| 3300005662|Ga0078894_11143491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300005941|Ga0070743_10025381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2055 | Open in IMG/M |
| 3300007559|Ga0102828_1041940 | All Organisms → Viruses → Predicted Viral | 1049 | Open in IMG/M |
| 3300007606|Ga0102923_1104535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 889 | Open in IMG/M |
| 3300007625|Ga0102870_1088351 | Not Available | 907 | Open in IMG/M |
| 3300007627|Ga0102869_1021800 | All Organisms → Viruses → Predicted Viral | 1805 | Open in IMG/M |
| 3300007632|Ga0102894_1124851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 680 | Open in IMG/M |
| 3300008055|Ga0108970_11684483 | Not Available | 983 | Open in IMG/M |
| 3300008107|Ga0114340_1106716 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
| 3300008107|Ga0114340_1150901 | All Organisms → Viruses → Predicted Viral | 1304 | Open in IMG/M |
| 3300008107|Ga0114340_1169859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 777 | Open in IMG/M |
| 3300008107|Ga0114340_1195210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 687 | Open in IMG/M |
| 3300008107|Ga0114340_1257505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
| 3300008107|Ga0114340_1263510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
| 3300008108|Ga0114341_10337460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300008110|Ga0114343_1110914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
| 3300008110|Ga0114343_1124581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300008110|Ga0114343_1235257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300008111|Ga0114344_1025098 | All Organisms → Viruses → Predicted Viral | 2397 | Open in IMG/M |
| 3300008113|Ga0114346_1134385 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1080 | Open in IMG/M |
| 3300008113|Ga0114346_1291834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300008114|Ga0114347_1040218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2051 | Open in IMG/M |
| 3300008116|Ga0114350_1167434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300008116|Ga0114350_1195743 | Not Available | 504 | Open in IMG/M |
| 3300008117|Ga0114351_1131161 | All Organisms → Viruses → Predicted Viral | 1410 | Open in IMG/M |
| 3300008120|Ga0114355_1262249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 500 | Open in IMG/M |
| 3300008259|Ga0114841_1051552 | All Organisms → Viruses → Predicted Viral | 1998 | Open in IMG/M |
| 3300008262|Ga0114337_1079247 | All Organisms → Viruses → Predicted Viral | 1595 | Open in IMG/M |
| 3300008262|Ga0114337_1187702 | All Organisms → Viruses → Predicted Viral | 1472 | Open in IMG/M |
| 3300009003|Ga0102813_1243560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
| 3300009026|Ga0102829_1036878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1441 | Open in IMG/M |
| 3300009050|Ga0102909_1126533 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 617 | Open in IMG/M |
| 3300009152|Ga0114980_10122436 | All Organisms → Viruses → Predicted Viral | 1549 | Open in IMG/M |
| 3300009158|Ga0114977_10662189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300009158|Ga0114977_10667981 | Not Available | 555 | Open in IMG/M |
| 3300009159|Ga0114978_10646208 | Not Available | 608 | Open in IMG/M |
| 3300009159|Ga0114978_10804366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300009159|Ga0114978_10823818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300009180|Ga0114979_10405559 | Not Available | 797 | Open in IMG/M |
| 3300009184|Ga0114976_10477748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 645 | Open in IMG/M |
| 3300010157|Ga0114964_10299195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 763 | Open in IMG/M |
| 3300010354|Ga0129333_10060200 | All Organisms → Viruses → Predicted Viral | 3542 | Open in IMG/M |
| 3300012017|Ga0153801_1054823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300012721|Ga0157612_1209723 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300012759|Ga0157626_1054064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300013004|Ga0164293_10173798 | All Organisms → Viruses → Predicted Viral | 1579 | Open in IMG/M |
| 3300013004|Ga0164293_10634898 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 690 | Open in IMG/M |
| 3300013005|Ga0164292_10024635 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4885 | Open in IMG/M |
| 3300013005|Ga0164292_10318555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1059 | Open in IMG/M |
| 3300019784|Ga0181359_1051332 | Not Available | 1590 | Open in IMG/M |
| 3300019784|Ga0181359_1164547 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 748 | Open in IMG/M |
| 3300020048|Ga0207193_1016430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9703 | Open in IMG/M |
| 3300020141|Ga0211732_1324863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300020161|Ga0211726_10229466 | All Organisms → Viruses → Predicted Viral | 2086 | Open in IMG/M |
| 3300020172|Ga0211729_10079706 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300020172|Ga0211729_11186661 | Not Available | 518 | Open in IMG/M |
| 3300020498|Ga0208050_1001191 | All Organisms → Viruses → Predicted Viral | 3721 | Open in IMG/M |
| 3300020527|Ga0208232_1028026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 776 | Open in IMG/M |
| 3300020528|Ga0208224_1001220 | All Organisms → Viruses → Predicted Viral | 4669 | Open in IMG/M |
| 3300020529|Ga0208233_1000375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8421 | Open in IMG/M |
| 3300021962|Ga0222713_10045826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3383 | Open in IMG/M |
| 3300021963|Ga0222712_10002571 | Not Available | 20631 | Open in IMG/M |
| 3300021963|Ga0222712_10004481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14596 | Open in IMG/M |
| 3300021963|Ga0222712_10010133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8653 | Open in IMG/M |
| 3300023184|Ga0214919_10094253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2581 | Open in IMG/M |
| 3300023184|Ga0214919_10240137 | All Organisms → Viruses → Predicted Viral | 1310 | Open in IMG/M |
| 3300023184|Ga0214919_10694934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
| 3300024346|Ga0244775_10049652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3657 | Open in IMG/M |
| 3300024346|Ga0244775_10124369 | All Organisms → Viruses → Predicted Viral | 2184 | Open in IMG/M |
| 3300024346|Ga0244775_10208366 | All Organisms → Viruses → Predicted Viral | 1638 | Open in IMG/M |
| 3300024487|Ga0255222_1005328 | All Organisms → Viruses → Predicted Viral | 1674 | Open in IMG/M |
| 3300024863|Ga0255246_1017679 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1572 | Open in IMG/M |
| 3300027133|Ga0255070_1000647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7692 | Open in IMG/M |
| 3300027135|Ga0255073_1027069 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
| 3300027198|Ga0208163_1046751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300027239|Ga0208807_1025434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 871 | Open in IMG/M |
| 3300027293|Ga0255132_1005746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3774 | Open in IMG/M |
| 3300027305|Ga0208168_1090128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 614 | Open in IMG/M |
| 3300027488|Ga0255084_1041608 | Not Available | 844 | Open in IMG/M |
| 3300027518|Ga0208787_1000361 | Not Available | 22068 | Open in IMG/M |
| 3300027563|Ga0209552_1107517 | Not Available | 743 | Open in IMG/M |
| 3300027563|Ga0209552_1151453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 596 | Open in IMG/M |
| 3300027571|Ga0208897_1063834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 965 | Open in IMG/M |
| 3300027581|Ga0209651_1037326 | Not Available | 1481 | Open in IMG/M |
| 3300027586|Ga0208966_1000070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 30756 | Open in IMG/M |
| 3300027596|Ga0255119_1023745 | All Organisms → Viruses → Predicted Viral | 1276 | Open in IMG/M |
| 3300027600|Ga0255117_1027020 | All Organisms → Viruses → Predicted Viral | 1254 | Open in IMG/M |
| 3300027659|Ga0208975_1079249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 973 | Open in IMG/M |
| 3300027697|Ga0209033_1038989 | All Organisms → Viruses → Predicted Viral | 1771 | Open in IMG/M |
| 3300027720|Ga0209617_10075748 | All Organisms → Viruses → Predicted Viral | 1380 | Open in IMG/M |
| 3300027734|Ga0209087_1000442 | Not Available | 26383 | Open in IMG/M |
| 3300027734|Ga0209087_1000681 | Not Available | 20978 | Open in IMG/M |
| 3300027757|Ga0208671_10031129 | All Organisms → Viruses → Predicted Viral | 1998 | Open in IMG/M |
| 3300027759|Ga0209296_1126704 | All Organisms → Viruses → Predicted Viral | 1180 | Open in IMG/M |
| 3300027797|Ga0209107_10181700 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
| 3300027973|Ga0209298_10002279 | Not Available | 12026 | Open in IMG/M |
| 3300028025|Ga0247723_1082350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 844 | Open in IMG/M |
| 3300031784|Ga0315899_10491681 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1177 | Open in IMG/M |
| 3300031787|Ga0315900_10770166 | Not Available | 668 | Open in IMG/M |
| 3300031951|Ga0315904_11314601 | Not Available | 546 | Open in IMG/M |
| 3300031963|Ga0315901_10279259 | All Organisms → Viruses → Predicted Viral | 1395 | Open in IMG/M |
| 3300031963|Ga0315901_10861460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300031963|Ga0315901_11085651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300032093|Ga0315902_10703375 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
| 3300033996|Ga0334979_0000683 | Not Available | 25585 | Open in IMG/M |
| 3300034013|Ga0334991_0033178 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2854 | Open in IMG/M |
| 3300034019|Ga0334998_0297270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300034021|Ga0335004_0673274 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 537 | Open in IMG/M |
| 3300034060|Ga0334983_0257169 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300034066|Ga0335019_0000065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 60076 | Open in IMG/M |
| 3300034066|Ga0335019_0815740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300034068|Ga0334990_0049267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2258 | Open in IMG/M |
| 3300034071|Ga0335028_0246426 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
| 3300034071|Ga0335028_0269795 | All Organisms → Viruses → Predicted Viral | 1021 | Open in IMG/M |
| 3300034071|Ga0335028_0398065 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300034071|Ga0335028_0508591 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
| 3300034105|Ga0335035_0536656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
| 3300034109|Ga0335051_0594278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
| 3300034111|Ga0335063_0005767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7928 | Open in IMG/M |
| 3300034112|Ga0335066_0156933 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1384 | Open in IMG/M |
| 3300034116|Ga0335068_0400760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
| 3300034120|Ga0335056_0176665 | All Organisms → Viruses → Predicted Viral | 1248 | Open in IMG/M |
| 3300034121|Ga0335058_0245759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1043 | Open in IMG/M |
| 3300034122|Ga0335060_0008103 | Not Available | 7008 | Open in IMG/M |
| 3300034122|Ga0335060_0636823 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300034200|Ga0335065_0479862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 747 | Open in IMG/M |
| 3300034279|Ga0335052_0658512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300034284|Ga0335013_0127274 | All Organisms → Viruses → Predicted Viral | 1756 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 22.76% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 14.48% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 10.34% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.97% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 8.28% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 4.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.14% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 3.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.45% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.45% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.07% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.69% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.69% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.69% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.69% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.69% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.69% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.69% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.69% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002303 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004836 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005069 | Metagenomes from Harmful Algal Blooms in Lake Erie, HABS-E2014-0024 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007632 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-3 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009050 | Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020528 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024487 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024863 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027133 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8h | Environmental | Open in IMG/M |
| 3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027198 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.753 (SPAdes) | Environmental | Open in IMG/M |
| 3300027239 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027293 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027305 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027488 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_8d | Environmental | Open in IMG/M |
| 3300027518 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027596 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepC_8h | Environmental | Open in IMG/M |
| 3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
| 3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027757 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
| 3300034060 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16May2013-rr0016 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
| 3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
| 3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
| 3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29644_10022801 | 3300002303 | Freshwater | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNSSNERVY* |
| B570J29032_1093020823 | 3300002408 | Freshwater | MSKSSYFLEYMKIYLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMN |
| B570J29032_1093117522 | 3300002408 | Freshwater | MHKLLEYMSIHLISLNQDMEKNFNTETKINIQGQIMATEHLMSVAEDILV* |
| B570J40625_1017039822 | 3300002835 | Freshwater | LNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNSSNERVY* |
| JGI25922J50271_101415651 | 3300003413 | Freshwater Lake | MKLHLISLNQDMEKDLNVESKINIQGQIMATEHLLSVATDIMNNSNERYNND* |
| JGI25924J51412_10208871 | 3300003491 | Freshwater Lake | LISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDDLQGKGY* |
| Ga0065861_10182772 | 3300004448 | Marine | MKLHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVANDIMNETNERI* |
| Ga0007759_115991193 | 3300004836 | Freshwater Lake | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDNERI* |
| Ga0071350_10130193 | 3300005069 | Freshwater | MKLHLISLNQDMEKDLNVESKINIQGQIMATEHLLSVATDIMNSSNERVYG* |
| Ga0070374_106258471 | 3300005517 | Freshwater Lake | HLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNNERI* |
| Ga0068872_106125983 | 3300005528 | Freshwater Lake | FIEYMKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETREN* |
| Ga0049081_101564022 | 3300005581 | Freshwater Lentic | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERYE* |
| Ga0049081_102985493 | 3300005581 | Freshwater Lentic | EYMKLHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMISSNERYTK* |
| Ga0049080_102344571 | 3300005582 | Freshwater Lentic | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERY |
| Ga0078894_105272971 | 3300005662 | Freshwater Lake | EYMKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETKEN* |
| Ga0078894_106509031 | 3300005662 | Freshwater Lake | MKLHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYE* |
| Ga0078894_109916763 | 3300005662 | Freshwater Lake | MKIHLISLNQDMDKDLNVESKINIQGQIMATEHLLSVATDIMNDNLQGKGY* |
| Ga0078894_111434912 | 3300005662 | Freshwater Lake | MKIHLISLNQDLDKDLNVESKINIQGQIMATEHLLSVATDIMNDNLQGKGY* |
| Ga0070743_100253817 | 3300005941 | Estuarine | LNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNENERV* |
| Ga0102828_10419403 | 3300007559 | Estuarine | MKIHLISLNQDFEDKYNVQSKINIQGQIIATEHLLSVATDIMNDDLQGKGY* |
| Ga0102923_11045354 | 3300007606 | Estuarine | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDNLQGKGY* |
| Ga0102870_10883511 | 3300007625 | Estuarine | FIEYMKIHLISLNQDFEDKYNVQSKINIQGQIIATEHLLSVATDIMNDDLQGKGY* |
| Ga0102869_10218007 | 3300007627 | Estuarine | LISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNSSNERYE* |
| Ga0102894_11248513 | 3300007632 | Estuarine | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDDLQGKGY* |
| Ga0108970_116844834 | 3300008055 | Estuary | HLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERYNNDNI* |
| Ga0114340_11067162 | 3300008107 | Freshwater, Plankton | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNSSNERVYE* |
| Ga0114340_11509011 | 3300008107 | Freshwater, Plankton | MKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDTNERVYG* |
| Ga0114340_11698591 | 3300008107 | Freshwater, Plankton | LISLNQDMDKDLNVESKINIQGQIMATEHLLSVALDIMARSERI* |
| Ga0114340_11952101 | 3300008107 | Freshwater, Plankton | MKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG* |
| Ga0114340_12575051 | 3300008107 | Freshwater, Plankton | MKLHLISLNQDLEGDYNVESKINIQGQIMATEHLLSVATDIMNSYDERYDNDNI* |
| Ga0114340_12635102 | 3300008107 | Freshwater, Plankton | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNDNLQGKGY* |
| Ga0114341_103374604 | 3300008108 | Freshwater, Plankton | MKLHLISLNQDMDKDLNVESKINIQGQIMATEHLLSVALDIMARSERI* |
| Ga0114343_11109141 | 3300008110 | Freshwater, Plankton | NQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETREN* |
| Ga0114343_11245813 | 3300008110 | Freshwater, Plankton | MKLHLISLNQDMDKDLNVESKINIQGQIMATEHLLSVATDIMNNSNERHE* |
| Ga0114343_12352571 | 3300008110 | Freshwater, Plankton | NQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETKEN* |
| Ga0114344_10250984 | 3300008111 | Freshwater, Plankton | MKLHLISLNQDLDKDLNVESKINIQGQIMATEHLLSVATDIMNASNERIYV* |
| Ga0114346_11343853 | 3300008113 | Freshwater, Plankton | MKIHLISLNQDIDKDLNVESKINIQGQIMATEHLLSVATDIMNNSNERYNNDNI* |
| Ga0114346_12918341 | 3300008113 | Freshwater, Plankton | ISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYE* |
| Ga0114347_10402188 | 3300008114 | Freshwater, Plankton | MLSQLIEYMNIHLISLNQDLEGDYNVESKINIQGQIMATEHLMSVAQDIMGS* |
| Ga0114350_11674341 | 3300008116 | Freshwater, Plankton | ISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETREN* |
| Ga0114350_11957431 | 3300008116 | Freshwater, Plankton | SLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNESNERYINE* |
| Ga0114351_11311615 | 3300008117 | Freshwater, Plankton | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETKEN* |
| Ga0114355_12622493 | 3300008120 | Freshwater, Plankton | MKLHLISLNQDMDKDLNVESKINIQGQIMATEHLLSVALGIMAESERI* |
| Ga0114841_10515522 | 3300008259 | Freshwater, Plankton | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETREN* |
| Ga0114337_10792474 | 3300008262 | Freshwater, Plankton | MKLHLISLNQDLEGDYNVESKINIQGQIMATEHLLSVATDIMNNSNERVNE* |
| Ga0114337_11877021 | 3300008262 | Freshwater, Plankton | HLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDTNERVYG* |
| Ga0102813_12435601 | 3300009003 | Estuarine | MKIHLISLNQDLESDYNVQSKINIQGQIMATEHLLSVATDIMNDNLQGKG |
| Ga0102829_10368782 | 3300009026 | Estuarine | MKIHLISLNQDFDGKYNTETKIHIQGQIDATRHLLSVATDIMNDDIQGKGY* |
| Ga0102909_11265332 | 3300009050 | Estuarine | MKIHLISLNQDLEGDYNVQSKINIQGQIIATEHLLSVATDIMNDDLQGKGY* |
| Ga0114980_101224364 | 3300009152 | Freshwater Lake | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNDNIQGKGY* |
| Ga0114977_106621893 | 3300009158 | Freshwater Lake | ISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSTNERIYE* |
| Ga0114977_106679813 | 3300009158 | Freshwater Lake | ISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERIYE* |
| Ga0114978_106462083 | 3300009159 | Freshwater Lake | HLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG* |
| Ga0114978_108043663 | 3300009159 | Freshwater Lake | HLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNNERI* |
| Ga0114978_108238181 | 3300009159 | Freshwater Lake | HLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNSTNERIYE* |
| Ga0114979_104055593 | 3300009180 | Freshwater Lake | NQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNSTNERYE* |
| Ga0114976_104777481 | 3300009184 | Freshwater Lake | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNDDLQGKGY* |
| Ga0114964_102991954 | 3300010157 | Freshwater Lake | KIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNNERI* |
| Ga0129333_100602004 | 3300010354 | Freshwater To Marine Saline Gradient | MKLHLISLNQDMDKDLNVESKINIQGQIMATEHLLSVATDIMNNSNERVYQ* |
| Ga0153801_10548233 | 3300012017 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNETKEN* |
| Ga0157612_12097232 | 3300012721 | Freshwater | MKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDNLQGKGY* |
| Ga0157626_10540642 | 3300012759 | Freshwater | MKIHLISLNQDLDKDLNVQSKINIQGQIMATEHLLSVATDIMNDNLQGKGY* |
| Ga0164293_101737983 | 3300013004 | Freshwater | MKLHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNNERVYG* |
| Ga0164293_106348984 | 3300013004 | Freshwater | MHKLLEYMNIHLISLNQDMEKDLNVESKINIQGQIMATEHLLSVVEDIMGA* |
| Ga0164292_1002463518 | 3300013005 | Freshwater | LEYMKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG* |
| Ga0164292_103185554 | 3300013005 | Freshwater | MKIHLISLNQDFEEDYSTETKINIQGQIMATEHLLSVAGRIMRS* |
| Ga0181359_10513327 | 3300019784 | Freshwater Lake | ISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNNERI |
| Ga0181359_11645471 | 3300019784 | Freshwater Lake | ISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDNERI |
| Ga0207193_101643021 | 3300020048 | Freshwater Lake Sediment | MKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG |
| Ga0211732_13248633 | 3300020141 | Freshwater | ISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNSNERYNNDNI |
| Ga0211726_102294664 | 3300020161 | Freshwater | MKIYLISLNQDLEDNYNVQSKINIQGQIMATEHLLSVATDIMNKSNERVNV |
| Ga0211729_100797061 | 3300020172 | Freshwater | ISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNSNERYE |
| Ga0211729_111866611 | 3300020172 | Freshwater | ISLNQDLEDNYNVQSKINIQGQIMATEHLLSVATDIMNSTNERYE |
| Ga0208050_10011915 | 3300020498 | Freshwater | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETREN |
| Ga0208232_10280263 | 3300020527 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNSSNERYN |
| Ga0208224_10012202 | 3300020528 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNETREN |
| Ga0208233_10003758 | 3300020529 | Freshwater | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERYNNDNI |
| Ga0222713_100458265 | 3300021962 | Estuarine Water | MKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNENERI |
| Ga0222712_1000257153 | 3300021963 | Estuarine Water | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNNERVY |
| Ga0222712_1000448128 | 3300021963 | Estuarine Water | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDNLQGKGY |
| Ga0222712_100101334 | 3300021963 | Estuarine Water | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNDDLQGKGY |
| Ga0214919_100942532 | 3300023184 | Freshwater | MKIHLISLNQDFDGKYNTETKIHIQGQIDATRHLLSVATDIMNNSNERYDNE |
| Ga0214919_102401372 | 3300023184 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLMSVATDIMNSTNERYE |
| Ga0214919_106949342 | 3300023184 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNETNEREYV |
| Ga0244775_100496529 | 3300024346 | Estuarine | MKIHLISLNQDFEDKYNVQSKINIQGQIIATEHLLSVATDIMNDDLQGKGY |
| Ga0244775_101243698 | 3300024346 | Estuarine | MKLHLISLNQDMDKDLNVESKINIQGQIMATEHLLSVALDIMARSERI |
| Ga0244775_102083662 | 3300024346 | Estuarine | MKIHLISLNQDFDGKYNTETKIHIQGQIDATRHLLSVATDIMNDDIQGKGY |
| Ga0255222_10053282 | 3300024487 | Freshwater | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNENERV |
| Ga0255246_10176794 | 3300024863 | Freshwater | MKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDTNERVYG |
| Ga0255070_10006474 | 3300027133 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNDNLQGKGY |
| Ga0255073_10270695 | 3300027135 | Freshwater | YMKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERYNNDNI |
| Ga0208163_10467513 | 3300027198 | Estuarine | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDI |
| Ga0208807_10254343 | 3300027239 | Estuarine | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNSSNERYE |
| Ga0255132_10057467 | 3300027293 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG |
| Ga0208168_10901281 | 3300027305 | Estuarine | KIHLISLNQDFEDKYNVQSKINIQGQIIATEHLLSVATDIMNDDLQGKGY |
| Ga0255084_10416084 | 3300027488 | Freshwater | YMKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNDNLQGKGY |
| Ga0208787_100036133 | 3300027518 | Deep Subsurface | MKLHLISLNQDLEGEYNIQSKINIQGQIMATEHLLSVATDIMNNSNERVYG |
| Ga0209552_11075173 | 3300027563 | Freshwater Lake | IHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDDLQGKGY |
| Ga0209552_11514533 | 3300027563 | Freshwater Lake | HLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDNERI |
| Ga0208897_10638341 | 3300027571 | Estuarine | FIEYMKIHLISLNQDFEDKYNVQSKINIQGQIIATEHLLSVATDIMNDDLQGKGY |
| Ga0209651_10373261 | 3300027581 | Freshwater Lake | HLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERV |
| Ga0208966_100007055 | 3300027586 | Freshwater Lentic | MKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERV |
| Ga0255119_10237456 | 3300027596 | Freshwater | LISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG |
| Ga0255117_10270201 | 3300027600 | Freshwater | ISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDTNERVYG |
| Ga0208975_10792492 | 3300027659 | Freshwater Lentic | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERYE |
| Ga0209033_10389892 | 3300027697 | Freshwater Lake | MKLHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNNERIYG |
| Ga0209617_100757481 | 3300027720 | Freshwater And Sediment | YMKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNDTNERVYG |
| Ga0209087_100044252 | 3300027734 | Freshwater Lake | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSTNERIYE |
| Ga0209087_10006811 | 3300027734 | Freshwater Lake | HLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERIYE |
| Ga0208671_100311293 | 3300027757 | Estuarine | MKIHLISLNQDLESDYNVQSKINIQGQIMATEHLLSVATDIMNDNLQGKGY |
| Ga0209296_11267042 | 3300027759 | Freshwater Lake | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNSTNERYNNE |
| Ga0209107_101817001 | 3300027797 | Freshwater And Sediment | LNQDLEADYNVQSKINIQGQIMATEHLLSVANDIMISYNERYNNE |
| Ga0209298_1000227930 | 3300027973 | Freshwater Lake | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNDNIQGKGY |
| Ga0247723_10823503 | 3300028025 | Deep Subsurface Sediment | MHKLLEYMSIHLISLNQDMEAGYNTETKINIQGQIMATEHLLSVAEDILV |
| Ga0315899_104916811 | 3300031784 | Freshwater | LTKSSQFLEYMKLHLISLNQDMDKDLNVESKINIQGQIMATEHLLSVALD |
| Ga0315900_107701662 | 3300031787 | Freshwater | MKLHLISLNQDLESHDNPETKIHLDGQIVATRHLLSVATDIMNNSNERYE |
| Ga0315904_113146013 | 3300031951 | Freshwater | MLSQLIEYMNIHLISLNQDLEGDYNVESKINIQGQIMATEHLMSVAQDIMGS |
| Ga0315901_102792592 | 3300031963 | Freshwater | MKLHLISLNQDMEKDLNVESKINIQGQIMATEHLLSVATDIINSSNERVYE |
| Ga0315901_108614602 | 3300031963 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNETKESYAD |
| Ga0315901_110856513 | 3300031963 | Freshwater | KLHLISLNQDLESHDNPETKIHLDGQIVATRHLLSVATDIMNESNERYNND |
| Ga0315902_107033751 | 3300032093 | Freshwater | LISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETKEN |
| Ga0334979_0000683_15871_16026 | 3300033996 | Freshwater | MKIHLISLNQDLDKDLNVQSKINIQGQIMATEHLLSVATDIMNDNLQGKGY |
| Ga0334991_0033178_2512_2667 | 3300034013 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNESNERVYG |
| Ga0334998_0297270_2_142 | 3300034019 | Freshwater | ISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG |
| Ga0335004_0673274_376_537 | 3300034021 | Freshwater | RFIEYMKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETREN |
| Ga0334983_0257169_201_365 | 3300034060 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMESTNERYNNDNI |
| Ga0335019_0000065_18071_18226 | 3300034066 | Freshwater | MKLHLISLNQDMEKDLNVESKINIQGQIMATEHLLSVATDIMNSSNERVYG |
| Ga0335019_0815740_235_387 | 3300034066 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNESERIYS |
| Ga0334990_0049267_451_609 | 3300034068 | Freshwater | MKIYLISLNQDLEDNYNVQSKINIQGQIMATEHLLSVATDIMNKSNEMVYHE |
| Ga0335028_0246426_3_155 | 3300034071 | Freshwater | MKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERYE |
| Ga0335028_0269795_794_940 | 3300034071 | Freshwater | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETKEN |
| Ga0335028_0398065_2_154 | 3300034071 | Freshwater | EYMKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETREN |
| Ga0335028_0508591_1_138 | 3300034071 | Freshwater | SLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG |
| Ga0335035_0536656_405_560 | 3300034105 | Freshwater | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYE |
| Ga0335051_0594278_2_139 | 3300034109 | Freshwater | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETR |
| Ga0335063_0005767_1652_1804 | 3300034111 | Freshwater | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNSSNERYN |
| Ga0335066_0156933_74_229 | 3300034112 | Freshwater | MKLHLISLNQDLDKDLNVQSKINIQGQIMATEHLLSVATDIMNSTNERVYG |
| Ga0335068_0400760_93_239 | 3300034116 | Freshwater | MKIHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNETKEN |
| Ga0335056_0176665_674_829 | 3300034120 | Freshwater | MKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG |
| Ga0335058_0245759_896_1042 | 3300034121 | Freshwater | LNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNSSNERYNNEYNI |
| Ga0335060_0008103_1_141 | 3300034122 | Freshwater | MKLHLISLNQDLDKDLNVQSKINIQGQIMATEHLLSVATDIMNSTNE |
| Ga0335060_0636823_2_148 | 3300034122 | Freshwater | HLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETKESYAD |
| Ga0335065_0479862_1_147 | 3300034200 | Freshwater | MKLHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNETREN |
| Ga0335052_0658512_2_142 | 3300034279 | Freshwater | LISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNSSNERVY |
| Ga0335013_0127274_79_231 | 3300034284 | Freshwater | MKLHLISLNQDLEADYNVQSKINIQGQIMATEHLLSVATDIMNNNERVYG |
| ⦗Top⦘ |