Metagenome Family F050051

Overview

Basic Information

• Family ID: F050051
• Family Type: Metagenome
• Number of Sequences: 145
• Average Sequence Length: 37 residues
• Representative Sequence: ALGSDGALKDTRFILVRAECPYVQFVAARVISTENGS
• Number of Associated Samples: 63
• Number of Associated Scaffolds: 145

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 0.70 %
• % of genes near scaffold ends (potentially truncated): 98.62 %
• % of genes from short scaffolds (< 2000 bps): 98.62 %
• Associated GOLD sequencing projects: 63
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (97.931 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (96.552 % of family members)
• Environment Ontology (ENVO): Unclassified (96.552 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (96.552 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 41.54%
  β-sheet: 0.00%
  Coil/Unstructured: 58.46%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
All Organisms	root	All Organisms	2.07 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
cellular organisms	root	All Organisms → cellular organisms	2.07 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	2.07 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	2.07 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	2.07 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	2.07 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2.07 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	2.07 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	2.07 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	2.07 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	2.07 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	2.07 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	1.38 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.69 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	1.38 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.69 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	1.38 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.69 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	1.38 %
rosids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids	0.69 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1.38 %
rosids incertae sedis	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis	0.69 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	1.38 %
Vitales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales	0.69 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1.38 %
Vitaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae	0.69 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	1.38 %
Viteae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae	0.69 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	1.38 %
Vitis	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis	0.69 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	1.38 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.69 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	1.38 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.69 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	97.93 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1.38 %
Vitis vinifera	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	0.69 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005718|Ga0068866_11414409	Not Available	509
3300013296|Ga0157374_12007427	Not Available	605
3300013297|Ga0157378_11493973	Not Available	720
3300013297|Ga0157378_13316377	Not Available	500
3300015268|Ga0182154_1009810	Not Available	863
3300015268|Ga0182154_1011006	Not Available	837
3300015269|Ga0182113_1012808	Not Available	904
3300015274|Ga0182188_1050277	Not Available	533
3300015275|Ga0182172_1003640	Not Available	1162
3300015275|Ga0182172_1017983	Not Available	752
3300015275|Ga0182172_1019273	Not Available	739
3300015275|Ga0182172_1038772	Not Available	614
3300015275|Ga0182172_1061324	Not Available	538
3300015275|Ga0182172_1068101	Not Available	521
3300015279|Ga0182174_1036389	Not Available	648
3300015279|Ga0182174_1038987	Not Available	635
3300015279|Ga0182174_1060830	Not Available	559
3300015281|Ga0182160_1020735	Not Available	745
3300015282|Ga0182124_1025254	Not Available	702
3300015282|Ga0182124_1029167	Not Available	675
3300015282|Ga0182124_1033014	Not Available	653
3300015283|Ga0182156_1007917	Not Available	990
3300015283|Ga0182156_1017665	Not Available	796
3300015283|Ga0182156_1038804	Not Available	639
3300015285|Ga0182186_1050869	Not Available	582
3300015285|Ga0182186_1065677	Not Available	540
3300015286|Ga0182176_1030725	Not Available	693
3300015286|Ga0182176_1048106	Not Available	604
3300015286|Ga0182176_1083471	Not Available	506
3300015287|Ga0182171_1018213	Not Available	785
3300015288|Ga0182173_1013878	Not Available	836
3300015289|Ga0182138_1042605	Not Available	625
3300015291|Ga0182125_1010482	Not Available	937
3300015291|Ga0182125_1032861	Not Available	685
3300015291|Ga0182125_1064662	Not Available	564
3300015291|Ga0182125_1080105	Not Available	529
3300015291|Ga0182125_1085479	Not Available	519
3300015291|Ga0182125_1087643	Not Available	515
3300015292|Ga0182141_1007052	Not Available	1037
3300015292|Ga0182141_1050476	Not Available	606
3300015292|Ga0182141_1054977	Not Available	591
3300015294|Ga0182126_1080990	Not Available	530
3300015295|Ga0182175_1031385	Not Available	704
3300015295|Ga0182175_1039839	Not Available	659
3300015295|Ga0182175_1054075	Not Available	603
3300015296|Ga0182157_1041704	Not Available	660
3300015296|Ga0182157_1092758	Not Available	520
3300015298|Ga0182106_1012124	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → rosids incertae sedis → Vitales → Vitaceae → Viteae → Vitis → Vitis vinifera	941
3300015300|Ga0182108_1032432	Not Available	719
3300015300|Ga0182108_1086868	Not Available	536
3300015302|Ga0182143_1035574	Not Available	693
3300015302|Ga0182143_1049054	Not Available	633
3300015302|Ga0182143_1102888	Not Available	504
3300015303|Ga0182123_1017296	Not Available	819
3300015303|Ga0182123_1080893	Not Available	534
3300015304|Ga0182112_1028824	Not Available	738
3300015304|Ga0182112_1065853	Not Available	582
3300015305|Ga0182158_1064672	Not Available	583
3300015305|Ga0182158_1088856	Not Available	529
3300015307|Ga0182144_1034640	Not Available	708
3300015307|Ga0182144_1046590	Not Available	650
3300015307|Ga0182144_1066634	Not Available	585
3300015308|Ga0182142_1017709	Not Available	874
3300015314|Ga0182140_1012696	Not Available	957
3300015314|Ga0182140_1047727	Not Available	660
3300015314|Ga0182140_1056863	Not Available	627
3300015314|Ga0182140_1062020	Not Available	611
3300015314|Ga0182140_1067228	Not Available	596
3300015314|Ga0182140_1087323	Not Available	550
3300015314|Ga0182140_1106059	Not Available	517
3300015321|Ga0182127_1058309	Not Available	639
3300015321|Ga0182127_1064362	Not Available	620
3300015321|Ga0182127_1107588	Not Available	527
3300015322|Ga0182110_1055903	Not Available	645
3300015322|Ga0182110_1061001	Not Available	629
3300015323|Ga0182129_1071408	Not Available	584
3300015341|Ga0182187_1098950	Not Available	648
3300015341|Ga0182187_1124036	Not Available	599
3300015342|Ga0182109_1176620	Not Available	550
3300015342|Ga0182109_1198855	Not Available	525
3300015342|Ga0182109_1212677	Not Available	512
3300015343|Ga0182155_1063450	Not Available	791
3300015343|Ga0182155_1126474	Not Available	623
3300015345|Ga0182111_1097037	Not Available	716
3300015345|Ga0182111_1131789	Not Available	639
3300015345|Ga0182111_1170351	Not Available	579
3300015345|Ga0182111_1215078	Not Available	529
3300015346|Ga0182139_1070606	Not Available	805
3300015346|Ga0182139_1100690	Not Available	707
3300015346|Ga0182139_1132001	Not Available	639
3300015346|Ga0182139_1168131	Not Available	583
3300015346|Ga0182139_1208762	Not Available	536
3300015346|Ga0182139_1229446	Not Available	516
3300015346|Ga0182139_1245891	Not Available	501
3300015351|Ga0182161_1101269	Not Available	737
3300015351|Ga0182161_1161552	Not Available	616
3300015351|Ga0182161_1188188	Not Available	579
3300015351|Ga0182161_1241374	Not Available	524
3300015351|Ga0182161_1263977	Not Available	505
3300015355|Ga0182159_1099740	Not Available	859
3300015355|Ga0182159_1155573	Not Available	715
3300015355|Ga0182159_1192445	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	653
3300015355|Ga0182159_1199876	Not Available	643
3300015355|Ga0182159_1279030	Not Available	556
3300015361|Ga0182145_1073215	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	698
3300015361|Ga0182145_1074061	Not Available	695
3300017410|Ga0182207_1107642	Not Available	596
3300017411|Ga0182208_1064454	Not Available	626
3300017411|Ga0182208_1070226	Not Available	609
3300017411|Ga0182208_1102048	Not Available	542
3300017411|Ga0182208_1102638	Not Available	541
3300017413|Ga0182222_1059958	Not Available	587
3300017417|Ga0182230_1047889	Not Available	750
3300017417|Ga0182230_1076149	Not Available	604
3300017420|Ga0182228_1025934	Not Available	929
3300017420|Ga0182228_1056997	Not Available	678
3300017420|Ga0182228_1066382	Not Available	641
3300017425|Ga0182224_1075766	Not Available	646
3300017427|Ga0182190_1085460	Not Available	631
3300017427|Ga0182190_1127948	Not Available	549
3300017427|Ga0182190_1158942	Not Available	509
3300017430|Ga0182192_1166135	Not Available	510
3300017433|Ga0182206_1142617	Not Available	521
3300017436|Ga0182209_1114890	Not Available	576
3300017436|Ga0182209_1133675	Not Available	548
3300017438|Ga0182191_1168217	Not Available	517
3300017442|Ga0182221_1121307	Not Available	560
3300017442|Ga0182221_1151344	Not Available	522
3300017443|Ga0182193_1085847	Not Available	669
3300017443|Ga0182193_1106066	Not Available	624
3300017443|Ga0182193_1190055	Not Available	509
3300017681|Ga0182226_1028021	Not Available	1002
3300017682|Ga0182229_1037350	Not Available	832
3300017683|Ga0182218_1084381	Not Available	606
3300017683|Ga0182218_1155982	Not Available	500
3300017684|Ga0182225_1055751	Not Available	675
3300017684|Ga0182225_1089141	Not Available	585
3300017684|Ga0182225_1091935	Not Available	579
3300017684|Ga0182225_1128272	Not Available	522
3300017685|Ga0182227_1051621	Not Available	733
3300017686|Ga0182205_1098058	Not Available	608
3300017690|Ga0182223_1061661	Not Available	611
3300025908|Ga0207643_10652942	Not Available	679

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	96.55%
Rhizosphere	Host-Associated → Plants → Rhizosphere	2.07%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.38%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	96.55%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.07%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.38%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	96.55%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.07%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.38%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	96.55%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.07%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.38%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017681	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068866_114144092	3300005718	Miscanthus Rhizosphere	CALGPDGVLKDTRFILVQAECPYVQSVAACVISTEKGS*
Ga0157374_120074271	3300013296	Miscanthus Rhizosphere	YNYCALGPDGALKDTMFIRVRAECPYVQSAAARVISTEKGS*
Ga0157378_114939731	3300013297	Miscanthus Rhizosphere	ALGPDGALMDTRFILVRAECLYVQSVAARVISTENGS*
Ga0157378_133163771	3300013297	Miscanthus Rhizosphere	TLGSDGALKDTRYILVRVEYPYVQFVAARIISTMNGA*
Ga0182154_10098101	3300015268	Miscanthus Phyllosphere	LGSDGVLKDTRFILVRAECSYVQFVAARVISTENGS*
Ga0182154_10110062	3300015268	Miscanthus Phyllosphere	SDGALKDTRFILVRAECPYVQFAAACVISTVNDL*
Ga0182113_10128082	3300015269	Miscanthus Phyllosphere	TLGSDGALKDTRFILVRAEYPYVQFVAARVISTMNGS*
Ga0182188_10502771	3300015274	Miscanthus Phyllosphere	TLGPDGVLKDTRFILVRAECPYVQFTAARVISTKKGS*
Ga0182172_10036401	3300015275	Miscanthus Phyllosphere	VLGSDGALKDTRFILIRAESPYVQFVAARVISTMNG
Ga0182172_10179831	3300015275	Miscanthus Phyllosphere	LGPDGALKDTRFILVQAECPYVQSVVAHVISAESGS*
Ga0182172_10192731	3300015275	Miscanthus Phyllosphere	GPDGALMDTRFILVRAKCPYVQSVAARVISTENGS*
Ga0182172_10387721	3300015275	Miscanthus Phyllosphere	GPDGVLKDTRFILVRAECPYVESTVAACIVSTEYGS*
Ga0182172_10613241	3300015275	Miscanthus Phyllosphere	ALGSDGALKDTRFILVRAESPYVQFVAARVISTVNGLQ*
Ga0182172_10681011	3300015275	Miscanthus Phyllosphere	LGPDGALKDTRFILVWAECPYVQSVAAHVISTENGS*
Ga0182174_10363891	3300015279	Miscanthus Phyllosphere	VLGPDGALKDTRFILVRAECPYVQSVAARVISAKSG
Ga0182174_10389871	3300015279	Miscanthus Phyllosphere	LGSDGALKDTRFILVRAECPYVQSAAARIISTRKGS*
Ga0182174_10608301	3300015279	Miscanthus Phyllosphere	SALGPDGVLKDTRFILVRAECPYVQFAAARVISTEKCS*
Ga0182160_10207352	3300015281	Miscanthus Phyllosphere	TLGLDGALKDTRVILVRAECPYVQSVAARVISTE*
Ga0182124_10252541	3300015282	Miscanthus Phyllosphere	ALGSDGALKDTRFILVRAECPYVQFAAARVISTVNGL*
Ga0182124_10291671	3300015282	Miscanthus Phyllosphere	VLGPDGALKDTRFILVQAEHPYVQSAAARVTSTEKGS*
Ga0182124_10330141	3300015282	Miscanthus Phyllosphere	ALGPYGALKDTRFILVRVECPYVQSVAARVISAESGS*
Ga0182156_10079171	3300015283	Miscanthus Phyllosphere	ICCVLGPDGVLKDTRFIPVRAECPYVQFAAACVISTEKGS*
Ga0182156_10176651	3300015283	Miscanthus Phyllosphere	IYICCALRSNGVLKDTRFVLVWAECPYVRFAAAHVISTEKGS*
Ga0182156_10388041	3300015283	Miscanthus Phyllosphere	MLGPDGVLKDTRFILVRAECPYIQSAAARVISTKKG
Ga0182186_10508691	3300015285	Miscanthus Phyllosphere	GSDGALKDTRFILVRAECPYVQFVAARVISTVNGL*
Ga0182186_10656771	3300015285	Miscanthus Phyllosphere	SDGALKDTRFILVRAKCPYIQFVAARVISTVNGS*
Ga0182176_10307251	3300015286	Miscanthus Phyllosphere	LGPDGALMDTRFILVRAECPYVQSVAARVISTKNGS*
Ga0182176_10481061	3300015286	Miscanthus Phyllosphere	LGSDGALKDTRFILVRAEYPYVQFVAARVISTVNGS*
Ga0182176_10834711	3300015286	Miscanthus Phyllosphere	VLGPDGVLKDTRFRLVRAECPFVQFATAAYIISSERFIVEG
Ga0182171_10182131	3300015287	Miscanthus Phyllosphere	GSDGALKDTRFILVRAESPYVQFVAARVISTENGS*
Ga0182173_10138781	3300015288	Miscanthus Phyllosphere	ALGSDGVLKDTRFILIWAECLYVQFVAARVISTKKGS*
Ga0182138_10426051	3300015289	Miscanthus Phyllosphere	GLDGALKDTRFILVRVECPYIQFATARVISTKKGS*
Ga0182125_10104821	3300015291	Miscanthus Phyllosphere	SDGALKDTRFILVRAESPYVQFVAARVISTVNGL*
Ga0182125_10328611	3300015291	Miscanthus Phyllosphere	NLYCCALGSDGVLKDTRFILVRAECLYVQFAAAYVISTKKGS*
Ga0182125_10646621	3300015291	Miscanthus Phyllosphere	CTLGSDGALKDTRFILVRVEYPYVQFVAARVISTVNGS*
Ga0182125_10801051	3300015291	Miscanthus Phyllosphere	SDGALKDTRFILVRAEYRYVQFIAASVISTVNCS*
Ga0182125_10854791	3300015291	Miscanthus Phyllosphere	ALGSDGALKDTGFILVRAERPYVQFVAACVISTVNDL*
Ga0182125_10876431	3300015291	Miscanthus Phyllosphere	ALDSDGVLKDTRFILVRAECPHVQFAAARVISTEK*
Ga0182141_10070522	3300015292	Miscanthus Phyllosphere	SDGALKDTRFILVRAERPYVQFAAACVISTVNDL*
Ga0182141_10504761	3300015292	Miscanthus Phyllosphere	GSDGVLKDTRFILVQAECPYVQCAVARVISTEKCS*
Ga0182141_10549771	3300015292	Miscanthus Phyllosphere	VIGCGQALNDIGFILVWAEYPYVQFAAARVISTEKGS
Ga0182126_10809901	3300015294	Miscanthus Phyllosphere	SDGALKDIRFILGRAEYPYIQFAAARVIITKKGS*
Ga0182175_10313851	3300015295	Miscanthus Phyllosphere	CALGSDGALKDTRFILVRAECPYVQFAAACVISTVNGL*
Ga0182175_10398391	3300015295	Miscanthus Phyllosphere	ALGSDGVLKDTRFILVRAERPYVQFAAARVINTKKGS*
Ga0182175_10540751	3300015295	Miscanthus Phyllosphere	GPDGALKDTRFILVQAECPYVQSVVARVISTKSSS*
Ga0182157_10417041	3300015296	Miscanthus Phyllosphere	LCALGPDGALKDTRFILVRAECPYVQSVAARVISAENGS*
Ga0182157_10927581	3300015296	Miscanthus Phyllosphere	SLNGVLKDTRFILIRTEYLYVQFAAAHVISTEKGL*
Ga0182106_10121243	3300015298	Miscanthus Phyllosphere	PDGALKDTRFILVQAECPYVQSVAARVISTENGS*
Ga0182108_10324321	3300015300	Miscanthus Phyllosphere	VLGSDGALKGTRFILVRAECPYVQFATARVISTVNGL*
Ga0182108_10868681	3300015300	Miscanthus Phyllosphere	SDGVLKDTRFILVRAEYPYVQFVVARVISTVNGS*
Ga0182143_10355741	3300015302	Miscanthus Phyllosphere	CALGPDGALKGTRFILVRAECPYVQSVVAHVISTENGL*
Ga0182143_10490541	3300015302	Miscanthus Phyllosphere	LGSDGALKDTRFILVRAECPYVQFVAARVISTVNGL*
Ga0182143_11028881	3300015302	Miscanthus Phyllosphere	ALGSDGALNDTRFILVWAECPYVQFVAARVISTVNGS*
Ga0182123_10172961	3300015303	Miscanthus Phyllosphere	LGLDGALKDTRFILVRAECPYVHSIAAHVISTKNGS*
Ga0182123_10808931	3300015303	Miscanthus Phyllosphere	LGPDGVLKDTRFILVRAECPYVQSAAAACIISTEYGS*
Ga0182112_10288241	3300015304	Miscanthus Phyllosphere	MLGSDGVLKDTRFILVRAEYPYVQFVAARVISTGK
Ga0182112_10658531	3300015304	Miscanthus Phyllosphere	LGPDGALKDTRFILVRAECPYVYSAAARVISTKKGS*
Ga0182158_10646721	3300015305	Miscanthus Phyllosphere	GPDGALKDTRVILVRAECPYVQSAAGRVISTEKGS*
Ga0182158_10888561	3300015305	Miscanthus Phyllosphere	ALGSDGALKDTRFILVRAECPYVQFVAARVISTENGS*
Ga0182144_10346401	3300015307	Miscanthus Phyllosphere	ALGPDGALMDIRFILVRAECPYVQSVAARVISTE*
Ga0182144_10465901	3300015307	Miscanthus Phyllosphere	ICCALGLDSVLKNTRFILVRTEYSYVQFATARVISTEKGS*
Ga0182144_10666342	3300015307	Miscanthus Phyllosphere	VLGSNGALKDTRFILLRAECPYVQFVAAHVISTVNGL*
Ga0182142_10177092	3300015308	Miscanthus Phyllosphere	LGSDGALKDTRFILVRAERPYVQFAAARVISTVNGL*
Ga0182140_10126961	3300015314	Miscanthus Phyllosphere	MLGSDGALKDTRFILVRAEYPYVQFVAARVISTVN
Ga0182140_10477271	3300015314	Miscanthus Phyllosphere	GSDGALKDTRFILVRAECPYVQFVATRVISTVNGL*
Ga0182140_10568631	3300015314	Miscanthus Phyllosphere	LGPDGALKDTRFILVRAEYPYFQYVAARVISTENSL*
Ga0182140_10620201	3300015314	Miscanthus Phyllosphere	CALGPDGVLKDTRFILVRAEYPYVQFAAAARVISIEKCL*
Ga0182140_10672282	3300015314	Miscanthus Phyllosphere	ALGPDGALMATRFILVRAECPYVQSIAARVISTE*
Ga0182140_10873231	3300015314	Miscanthus Phyllosphere	TLGPDGALKDTRFILVRAECPYVQSVAAHVISAESGS*
Ga0182140_11060591	3300015314	Miscanthus Phyllosphere	GPDGVLKDIRFILVRAECPYVQSAAAACIISTKYGS*
Ga0182127_10583092	3300015321	Miscanthus Phyllosphere	VLGPDGALKDTRFILIRDECPYVQSVAARVISTENGL*
Ga0182127_10643621	3300015321	Miscanthus Phyllosphere	IYNCCALCPDGALKDTRFILVRAECPYVQSAAAHVISTEKGS*
Ga0182127_11075881	3300015321	Miscanthus Phyllosphere	PDGALNDTRFILVRAEYPYVKSAASRVINTEKGS*
Ga0182110_10517551	3300015322	Miscanthus Phyllosphere	LYYCALGLDGVLKDTRFILVREECPYVQFMAVAHVIS
Ga0182110_10559031	3300015322	Miscanthus Phyllosphere	CALGPDGALQDTRVILVRAECPYVQSVAACVIRTE*
Ga0182110_10610011	3300015322	Miscanthus Phyllosphere	PDGALKDTRFILVRAECPYVQSAVAALVISTEKGS*
Ga0182129_10714081	3300015323	Miscanthus Phyllosphere	ALGSDSVLKDIRFILVRAEYPYIQSAATRVISTEKGS*
Ga0182187_10989501	3300015341	Miscanthus Phyllosphere	PDGALKDTRFILVRAECPYVQSVAARLISAESGS*
Ga0182187_11240361	3300015341	Miscanthus Phyllosphere	TLGPDSALKDTRFILVQAECPYVQSVAACVISTEKGS*
Ga0182109_11766201	3300015342	Miscanthus Phyllosphere	CTLGPDGALKDTRFILVRVKCPYVQSAAAHVISTEKGS*
Ga0182109_11988551	3300015342	Miscanthus Phyllosphere	LGSDGALKDTRFILVRAESPYVQFVAARVISTVNSLQ*
Ga0182109_12126771	3300015342	Miscanthus Phyllosphere	VLGSDGALKDTRFILVRVERPYVQSAAARVISTKNGS*
Ga0182155_10634501	3300015343	Miscanthus Phyllosphere	CALGSDGALKDTRFILVWAECPYVQSAAARVISTEKDL*
Ga0182155_11264741	3300015343	Miscanthus Phyllosphere	CALGPDGVLKDTRFILVWAECPYVQFAAAHVISTEKGS*
Ga0182111_10970371	3300015345	Miscanthus Phyllosphere	VLDSDGVLKDTRFILVQAEYLYVQFAAARVISTEKG
Ga0182111_11317891	3300015345	Miscanthus Phyllosphere	GPDGALKDTRFILVRAEYPYIQFVAARVISTVNGS*
Ga0182111_11703511	3300015345	Miscanthus Phyllosphere	CALGSDGVLKDTRFILVRSECPYVQFAVARVISTEKGS*
Ga0182111_12150781	3300015345	Miscanthus Phyllosphere	CTLGPDGALKDTRFILVWAECPYVQSIAARVISTERGS*
Ga0182139_10706061	3300015346	Miscanthus Phyllosphere	ALTLDGVLKDTRFILVQAEHPYIQFATARVISTEKGS*
Ga0182139_11006902	3300015346	Miscanthus Phyllosphere	LGPDGALKDTRFILVRAECPYVQSAAARVISTKKGS*
Ga0182139_11320011	3300015346	Miscanthus Phyllosphere	ALGSDGALKDTRFILVRAECPYVQFVAAHVISTVNGL*
Ga0182139_11681311	3300015346	Miscanthus Phyllosphere	CMLGPDGALKDMRFILVWAERPYVHSTAAHVINTKNGS*
Ga0182139_12087621	3300015346	Miscanthus Phyllosphere	GPDGALMEIRFIRVRVECPYIQSVAARVISTESGS*
Ga0182139_12294461	3300015346	Miscanthus Phyllosphere	ALGPDGALKDTRFILVRSEHPYIQSTVAHVISTEKGS*
Ga0182139_12458912	3300015346	Miscanthus Phyllosphere	LCALGPDGALKDTRFIMVQAECPYVQSVAARVISTENGS*
Ga0182177_10748371	3300015347	Miscanthus Phyllosphere	ALGLDGVLKDTRFILVLAQCPYIQFAAACVISTGKGS*
Ga0182161_11012691	3300015351	Miscanthus Phyllosphere	ALVPNGVLKDTRFILVQAECPYDQFAVAHVISTEKGS*
Ga0182161_11615521	3300015351	Miscanthus Phyllosphere	YNCCALGSDGVLKDTRFILGWAECPYVQFAAARVISTEKGS*
Ga0182161_11881881	3300015351	Miscanthus Phyllosphere	LGPDGVLKDTRFILVRAECPYVQSAAVACIISTKYDL*
Ga0182161_12413741	3300015351	Miscanthus Phyllosphere	MLGPDGALKDTMFILVRAECPYVQSVATRVISTESGL
Ga0182161_12639771	3300015351	Miscanthus Phyllosphere	GSDGALKDTRFILVRAECPYVQFVAARVISTVNGS*
Ga0182159_10997401	3300015355	Miscanthus Phyllosphere	GSDGVLKDTRFILVWAECPYVQFVAARVISTKKGS*
Ga0182159_11555731	3300015355	Miscanthus Phyllosphere	SDGALKDTRFILARAECPYIQSAAVARVISTEKGS*
Ga0182159_11924452	3300015355	Miscanthus Phyllosphere	MLKDIRFILVRTECPYVQFAAVARVISTEKVRSRGT
Ga0182159_11998761	3300015355	Miscanthus Phyllosphere	CALGPDGVLKDTRFILVRAECPYVQSVVARVISTESGS*
Ga0182159_12790301	3300015355	Miscanthus Phyllosphere	ALGSDGVLKNTRFILVQAECPYVQFATARVISTKKGS*
Ga0182145_10732151	3300015361	Miscanthus Phyllosphere	VLGSDGALKDTRFILVRAECPYVQFVAARVISTVNG
Ga0182145_10740611	3300015361	Miscanthus Phyllosphere	LGSDGVLKDTRFILVRAEYPYVQFAAARVISTGKGL*
Ga0182207_11076421	3300017410	Miscanthus Phyllosphere	IYICCALGPDDVLRDTMFILVRAEYPYVQFTVARVISTEK
Ga0182208_10644541	3300017411	Miscanthus Phyllosphere	ALGSDGALKDTRFILVRAECPYVQFAATRVISTVNGL
Ga0182208_10702261	3300017411	Miscanthus Phyllosphere	ALGSNGVLKDTRLILVWAECPYVQFAAARVISTEKGS
Ga0182208_11020481	3300017411	Miscanthus Phyllosphere	YIRCALGPDGVLKDTRFILVRVEHPYVQFVAAHVISTKKGS
Ga0182208_11026381	3300017411	Miscanthus Phyllosphere	ALGSDGALKDTRFILVWAECPYIQFVAARVISTVNGL
Ga0182222_10599581	3300017413	Miscanthus Phyllosphere	ALGPDGALKDTRFILVRAECPYVQSIAARVISTENGS
Ga0182230_10478891	3300017417	Miscanthus Phyllosphere	ALGPDGAPKDTRFILVRAECPYVQSVVARVISIEKGS
Ga0182230_10761491	3300017417	Miscanthus Phyllosphere	CALGPGGALKDTRFILVRAECPYVHSTAARVISTKKGS
Ga0182228_10259342	3300017420	Miscanthus Phyllosphere	GSDGALKDTRFILVRAERPYVQFAASCVISTVNDL
Ga0182228_10569971	3300017420	Miscanthus Phyllosphere	CCALGSDGVLKDTRFILVRTERPYVQSTTTRVISTEKGS
Ga0182228_10663821	3300017420	Miscanthus Phyllosphere	ALGPDGALKDTRFILVRPECPYVQSAIARVISTEKGS
Ga0182224_10757662	3300017425	Miscanthus Phyllosphere	GSDGGLKGTRFILVRAKCPYVQFAAARVISTVNGL
Ga0182190_10854601	3300017427	Miscanthus Phyllosphere	CTLGSDGALKDTRFILVRAEYPYVQFVAAHVISTMNGS
Ga0182190_11279481	3300017427	Miscanthus Phyllosphere	ALGLDGALKDIKFILVRAECFYVQFAAACVISTVNGL
Ga0182190_11589422	3300017427	Miscanthus Phyllosphere	GSDGALKDTRFILVRAECPYVQFVAAHVISTENGS
Ga0182192_11661351	3300017430	Miscanthus Phyllosphere	ALGSDGALKDTRFILVRAEYPYVQFVAARVISTMNGS
Ga0182206_11426172	3300017433	Miscanthus Phyllosphere	GSDGALKDTRFILVRAEYPYVQFVAARVISTINGL
Ga0182209_11148901	3300017436	Miscanthus Phyllosphere	LDAFSALGSDGVLKDIRFILVWAECPYVQFAAARVISTEKDS
Ga0182209_11336752	3300017436	Miscanthus Phyllosphere	CTLGSDGVLKDTRFILVRAKCPYVQSTAAACIISTEYGS
Ga0182191_11682171	3300017438	Miscanthus Phyllosphere	GPDGALKDTRFILVQAECPYVQSAAAHVISAEKGLQ
Ga0182221_11213071	3300017442	Miscanthus Phyllosphere	ALGSDGALKDTRFILVRAESPYVQFVAARVISTVNGL
Ga0182221_11513441	3300017442	Miscanthus Phyllosphere	LGPDGALKDTRFILVRAECPYVQSAAAYVISTETGS
Ga0182193_10858471	3300017443	Miscanthus Phyllosphere	CTLGSDGALKDIRFILVQAECLYVQFVAARVISTVNDL
Ga0182193_11060661	3300017443	Miscanthus Phyllosphere	LGPNGALKDIRFILVWAECPYVQSIAARVISTGKGS
Ga0182193_11900551	3300017443	Miscanthus Phyllosphere	ALGSDGALKDTRFILVRAECLYVQFVAARVISTVNGL
Ga0182226_10280211	3300017681	Miscanthus Phyllosphere	LGSDGALKDTRFILVRAECPYVQFAAARVISTVNGLQ
Ga0182229_10373501	3300017682	Miscanthus Phyllosphere	GSNGALKDTRFILLRAECPYVQFVAAHVISTVNGL
Ga0182218_10843811	3300017683	Miscanthus Phyllosphere	ALGSDGALKDTGFILVRAERPYVQFVAACVISTVNDL
Ga0182218_11559821	3300017683	Miscanthus Phyllosphere	ALGSDGALKDIRFILVRAEYPYVQFVAAHVISTVNGS
Ga0182225_10557511	3300017684	Miscanthus Phyllosphere	YALGSDGVLKDTRFILVQAECPYIQSAAARVISTEKGS
Ga0182225_10891411	3300017684	Miscanthus Phyllosphere	GLDGALKNTRFILVRAERPYVQFATVAHVINTKNGL
Ga0182225_10919351	3300017684	Miscanthus Phyllosphere	CALGPDGALKDMRFILVRAERPYIQSAADAAHVISIENGS
Ga0182225_11282721	3300017684	Miscanthus Phyllosphere	ALGSDDVLKDTRFILVRTKCPCVQSAAARGISTEKDS
Ga0182227_10516211	3300017685	Miscanthus Phyllosphere	ALGPDGALKDTRFILVRTKCPYVQSVAARVISTKSGS
Ga0182205_10980581	3300017686	Miscanthus Phyllosphere	LGPDGALKDTRFILVRAECPYVQSVAARVISTKRGS
Ga0182223_10616612	3300017690	Miscanthus Phyllosphere	GSDGALKDTRFILVRAEYPYVQFVAARVISTMNGS
Ga0207643_106529421	3300025908	Miscanthus Rhizosphere	MLGPDGALMDTRFILVRAECLYVQSVAARVISTKNGS