Basic Information | |
---|---|
Family ID | F050026 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 146 |
Average Sequence Length | 43 residues |
Representative Sequence | PDGEHAYLCCHDDAEVFEFELATGRITRTFPTAAGCEFIVAYH |
Number of Associated Samples | 133 |
Number of Associated Scaffolds | 146 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 10.34 % |
% of genes near scaffold ends (potentially truncated) | 34.25 % |
% of genes from short scaffolds (< 2000 bps) | 37.67 % |
Associated GOLD sequencing projects | 130 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (71.918 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (10.274 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.548 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.836 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 28.17% Coil/Unstructured: 71.83% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 146 Family Scaffolds |
---|---|---|
PF13460 | NAD_binding_10 | 34.25 |
PF02245 | Pur_DNA_glyco | 22.60 |
PF01370 | Epimerase | 6.16 |
PF00009 | GTP_EFTU | 4.11 |
PF03401 | TctC | 2.05 |
PF05257 | CHAP | 2.05 |
PF04199 | Cyclase | 1.37 |
PF00920 | ILVD_EDD | 1.37 |
PF12697 | Abhydrolase_6 | 0.68 |
PF00079 | Serpin | 0.68 |
PF01381 | HTH_3 | 0.68 |
PF02265 | S1-P1_nuclease | 0.68 |
PF02777 | Sod_Fe_C | 0.68 |
PF13517 | FG-GAP_3 | 0.68 |
PF00889 | EF_TS | 0.68 |
PF09084 | NMT1 | 0.68 |
PF12794 | MscS_TM | 0.68 |
PF16881 | LIAS_N | 0.68 |
PF16658 | RF3_C | 0.68 |
PF00696 | AA_kinase | 0.68 |
PF10691 | DUF2497 | 0.68 |
PF00571 | CBS | 0.68 |
PF12802 | MarR_2 | 0.68 |
PF00149 | Metallophos | 0.68 |
COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
---|---|---|---|
COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 22.60 |
COG0129 | Dihydroxyacid dehydratase/phosphogluconate dehydratase | Carbohydrate transport and metabolism [G] | 2.74 |
COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 2.05 |
COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.37 |
COG0264 | Translation elongation factor EF-Ts | Translation, ribosomal structure and biogenesis [J] | 0.68 |
COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.68 |
COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.68 |
COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.68 |
COG4826 | Serine protease inhibitor | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 71.92 % |
All Organisms | root | All Organisms | 28.08 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459003|FZN2CUW02GPPF5 | Not Available | 509 | Open in IMG/M |
3300005332|Ga0066388_101403699 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1213 | Open in IMG/M |
3300005354|Ga0070675_101806797 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
3300005541|Ga0070733_11184479 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300005836|Ga0074470_10295657 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300005938|Ga0066795_10242643 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300006049|Ga0075417_10614095 | Not Available | 554 | Open in IMG/M |
3300006578|Ga0074059_11199503 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300006795|Ga0075520_1424856 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
3300006871|Ga0075434_102077192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
3300006954|Ga0079219_10707885 | Not Available | 767 | Open in IMG/M |
3300007004|Ga0079218_12138432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Bruguierivoracaceae → Sodalis → Sodalis ligni | 647 | Open in IMG/M |
3300009090|Ga0099827_10456098 | Not Available | 1096 | Open in IMG/M |
3300009649|Ga0105855_1130852 | Not Available | 720 | Open in IMG/M |
3300009662|Ga0105856_1289893 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300010042|Ga0126314_10572152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Bruguierivoracaceae → Sodalis → Sodalis ligni | 823 | Open in IMG/M |
3300010047|Ga0126382_10423235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1047 | Open in IMG/M |
3300010362|Ga0126377_12890789 | Not Available | 554 | Open in IMG/M |
3300010362|Ga0126377_13102310 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
3300010366|Ga0126379_11564613 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 765 | Open in IMG/M |
3300010376|Ga0126381_104804388 | Not Available | 519 | Open in IMG/M |
3300010398|Ga0126383_12695337 | Not Available | 580 | Open in IMG/M |
3300010399|Ga0134127_11530714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Bruguierivoracaceae → Sodalis → Sodalis ligni | 740 | Open in IMG/M |
3300013296|Ga0157374_10889191 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
3300013307|Ga0157372_12062875 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300013308|Ga0157375_13762576 | Not Available | 504 | Open in IMG/M |
3300014162|Ga0181538_10126620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1483 | Open in IMG/M |
3300015200|Ga0173480_10028124 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2401 | Open in IMG/M |
3300015245|Ga0137409_10706990 | Not Available | 842 | Open in IMG/M |
3300017975|Ga0187782_11090792 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
3300018057|Ga0187858_10774111 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300018060|Ga0187765_10218408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1109 | Open in IMG/M |
3300018083|Ga0184628_10248103 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
3300018465|Ga0190269_11216015 | Not Available | 593 | Open in IMG/M |
3300018920|Ga0190273_11404502 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 610 | Open in IMG/M |
3300025165|Ga0209108_10121655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1393 | Open in IMG/M |
3300025885|Ga0207653_10332277 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300025919|Ga0207657_10858274 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
3300025941|Ga0207711_10502896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1130 | Open in IMG/M |
3300026854|Ga0207727_103223 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → unclassified Pseudolabrys → Pseudolabrys sp. Root1462 | 1756 | Open in IMG/M |
3300026990|Ga0207824_1009248 | Not Available | 1094 | Open in IMG/M |
3300027039|Ga0207855_1050690 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300027903|Ga0209488_10574304 | Not Available | 820 | Open in IMG/M |
3300028710|Ga0307322_10232063 | Not Available | 509 | Open in IMG/M |
3300028796|Ga0307287_10276122 | Not Available | 636 | Open in IMG/M |
3300029999|Ga0311339_11113319 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
3300030007|Ga0311338_10686100 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
3300030013|Ga0302178_10154017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1137 | Open in IMG/M |
3300030053|Ga0302177_10276619 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300031521|Ga0311364_11855176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 592 | Open in IMG/M |
3300031563|Ga0307436_1013337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2723 | Open in IMG/M |
3300031699|Ga0315535_1078255 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300031910|Ga0306923_11999254 | Not Available | 588 | Open in IMG/M |
3300032061|Ga0315540_10028940 | Not Available | 2737 | Open in IMG/M |
3300032076|Ga0306924_12299402 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300032782|Ga0335082_10277232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1554 | Open in IMG/M |
3300032783|Ga0335079_10615189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1144 | Open in IMG/M |
3300033829|Ga0334854_155510 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.22% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.16% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.16% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.79% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.42% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.74% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.74% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.05% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.05% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.05% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.05% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.37% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.37% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.37% |
Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 1.37% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.37% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 1.37% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.37% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.37% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.37% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.37% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.37% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.68% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.68% |
Mangrove Soil | Environmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Soil | 0.68% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.68% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.68% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.68% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.68% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.68% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.68% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.68% |
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.68% | |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.68% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908016 | Sample 642 | Environmental | Open in IMG/M |
2170459003 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300000733 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001402 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-092012 | Environmental | Open in IMG/M |
3300002069 | Barrow Graham LP Ref core NGADG0002-212 (Barrow Graham LP Ref core NGADG0002-212,NGADG0004-211, ASSEMBLY_DATE=20131010) | Environmental | Open in IMG/M |
3300002822 | Illumina_Fosmid_Bertioga | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
3300006578 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009649 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059 | Environmental | Open in IMG/M |
3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026464 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 CS5 | Environmental | Open in IMG/M |
3300026854 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes) | Environmental | Open in IMG/M |
3300026860 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 70 (SPAdes) | Environmental | Open in IMG/M |
3300026889 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 57 (SPAdes) | Environmental | Open in IMG/M |
3300026990 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 73 (SPAdes) | Environmental | Open in IMG/M |
3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031563 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1604-40 | Environmental | Open in IMG/M |
3300031699 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-20 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
OU_01730890 | 2124908016 | AHAFVCCHDDATVMEFELSTGRATREFKTASGCEFIISY | |
E4A_07285730 | 2170459003 | Grass Soil | MGFGFAGDGKHAYLCCHDAAITLEFELASGKVTRQFPTAAGCEFVICY |
JGI12408J11912_10015571 | 3300000733 | Tropical Forest Soil | HVYLCCHDAAATLELELAGGHITGQFKTAAGCEFIVSY* |
JGIcombinedJ13530_1000631122 | 3300001213 | Wetland | DGRHAILCCHDAAVTLEFELASGRITRQFETAAGCEFVISY* |
JGI20195J14853_10433742 | 3300001402 | Arctic Peat Soil | AADGRHAFLCCHDDAMVLEFELASGRITRRFSTAAGCEFIIAYS* |
JGIcombinedJ21912_101458971 | 3300002069 | Arctic Peat Soil | CHDAAITLEFELDNGRVTRQFPTAAGCEFVISYS* |
BMAI_10972881 | 3300002822 | Mangrove Soil | FAAGGSLGYLCCHDAAVVLEFELATGRVQREFATAAGCEFIVSY* |
Ga0062387_1009691192 | 3300004091 | Bog Forest Soil | FAPDGQCAYLCCHDDAIVTEFELATGKTTRTFATDAGCEFIVAYH* |
Ga0063455_1015377982 | 3300004153 | Soil | FAAGGRHAFVCCHDAAIVTEFELSTGRVSREFPTASGCEFIIAYQ* |
Ga0063356_1063860392 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DGKHAYLCCHDDGVVFEFELATGKVTRTFPTAAGCEFIVAYH* |
Ga0062592_1009126631 | 3300004480 | Soil | FAAGGKHAFVCCHDDATVMEFELSTGRATREFKTASGCEFIISY* |
Ga0070690_1009963532 | 3300005330 | Switchgrass Rhizosphere | ANGEHAYLCCHDAAITLEFELASGRITRQFSTAAGCEFIVSY* |
Ga0066388_1013199273 | 3300005332 | Tropical Forest Soil | GFAPGGTHAYVCCHDDAEVFEFELATGRVTRTFATAAGCEFIVAYH* |
Ga0066388_1014036991 | 3300005332 | Tropical Forest Soil | PMGFGFAADGKHAYLCCHDDAEVFEFELASGRVTRTFPTAAGCEFIVAYH* |
Ga0070660_1010988772 | 3300005339 | Corn Rhizosphere | GEHAYLCCHDAAITLEFELASGRITRQFPTAAGCEFIVSY* |
Ga0070675_1018067972 | 3300005354 | Miscanthus Rhizosphere | FAANGEHAYLCCHDAAITLEFELASGRITRQFSTAAGCEFIVSY* |
Ga0070733_111844791 | 3300005541 | Surface Soil | PMGFGFAPDGKLAYLCCHDDAIVFEFELASGRVTRTFPTADGCEFIVAYH* |
Ga0070693_1001173763 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | GQRAYLCCHDAAVTLEFELASGRITRQFPTAAGCEFIFSY* |
Ga0070764_106490742 | 3300005712 | Soil | AYLCCHDDAVVFEFELKTGKVARTFPTEAGCEFIVAYQ* |
Ga0066905_1021522441 | 3300005713 | Tropical Forest Soil | YLCCHDDAEVFEFELATGRVVRTFPTAAGCEFIVGYSA* |
Ga0074470_102956572 | 3300005836 | Sediment (Intertidal) | FAADGKHAYLCCHDATTVLEFELASGRITRQFETAAGCEFIIAY* |
Ga0066795_102426431 | 3300005938 | Soil | AADGKHAFLCCHDAAITLEFEMSSGRITRQFPTAAGCEFIIAY* |
Ga0075417_106140952 | 3300006049 | Populus Rhizosphere | MGFGFAADGKHAYLCCHDDAVVFEFELASGRVTRTFPTAAGCEFIVAYA* |
Ga0075364_100921603 | 3300006051 | Populus Endosphere | VCCHDDNEVWEFELATGKVTRTFPTAAGCEFIVAYH* |
Ga0074059_111995032 | 3300006578 | Soil | FAADGKHAFLCCHDAAVVLEFDLGAARISREFQTAAGCEFIVSY* |
Ga0074057_120085212 | 3300006605 | Soil | GERAYLCCHDAAITLEFELASGRITRQFPTAAGCEFILSY* |
Ga0075520_14248562 | 3300006795 | Arctic Peat Soil | FAADGMHAYLCCHDAAITMEFELRNGRVTRQFPTAAGCEFIISYS* |
Ga0075421_1000528386 | 3300006845 | Populus Rhizosphere | CCHDDAEVFEFELATGRVTRTFPTAAGCEFIIAYQ* |
Ga0075434_1020771921 | 3300006871 | Populus Rhizosphere | FGFAGDGKHAWLCCHDDAEVFEFELASGRVTRTFPTAAGCEFILGYPA* |
Ga0079219_107078851 | 3300006954 | Agricultural Soil | PMGMGFAPGGTHAYVCCHDDAEVFGFELATGRVTRTFSTAAGCEFIVAYH* |
Ga0079218_121384321 | 3300007004 | Agricultural Soil | RKAPMGFGFAADGRHAFVCCHDDAIVIEFELSTGRATRSFPTAAGCEFIISY* |
Ga0099827_104560982 | 3300009090 | Vadose Zone Soil | MSTKKSPMGFGFAADRTHAYLCCHDDAVVFEFELATGRVRRTFPTAAGCEFVVAY* |
Ga0105245_111084671 | 3300009098 | Miscanthus Rhizosphere | HAFVCCHDDATVMEFELSTGRATREFKTASGCEFIISY* |
Ga0075418_101512266 | 3300009100 | Populus Rhizosphere | YLCCHDDAEVFEFELASGRVNRTFPTAAGCEFIVAYS* |
Ga0075418_119272422 | 3300009100 | Populus Rhizosphere | YICCHDDAEVFEFELATGRVTRTFPTAAGCEFIVAYH* |
Ga0075423_131063652 | 3300009162 | Populus Rhizosphere | CCHDDAEVFEFELATGRVTRTFPTAAGCEFIVAYH* |
Ga0113563_120527472 | 3300009167 | Freshwater Wetlands | YVCCHDAAITLEFELTSGRIARQFPTAAGCEFIIAY* |
Ga0116126_10501293 | 3300009640 | Peatland | LCCHDDAVVFEFELASGEITRTFPTAAGCEFIVAYH* |
Ga0105855_11308522 | 3300009649 | Permafrost Soil | GFGFAADGKHAYICCHDDAVVSEFELASGRITRNFTTAAGCEFIVAY* |
Ga0105856_12898931 | 3300009662 | Permafrost Soil | FAADNMHAYLCCHDAAITMEFELKNGRVTRQFPTAAGCEFIIAY* |
Ga0126304_112673612 | 3300010037 | Serpentine Soil | RAYLCCHDDAVVLEFELDSGRVTRQFPTASGCEFIISY* |
Ga0126314_105721521 | 3300010042 | Serpentine Soil | MGFGFAAGGRHAFVCCHDAAIVTEFELSTGRVSREFPTASGCEFIIAYQ* |
Ga0126382_100770301 | 3300010047 | Tropical Forest Soil | AYLCCHDDAEVFEFELATGRVVRTFPTAAGCEFIVGYSA* |
Ga0126382_104232352 | 3300010047 | Tropical Forest Soil | MGFGFGPDGTHAYLCCHDDAVVFELELSSGRVSRTFATASGCEFIIAY* |
Ga0126382_115289211 | 3300010047 | Tropical Forest Soil | AYICCHDDAEVFEFELATGRVNRTFPTAAGCEFIVGYSV* |
Ga0126382_120884692 | 3300010047 | Tropical Forest Soil | LCCHDDAEVFEFELATGRVARTFPTAAGCEFIVGYSA* |
Ga0134070_104808171 | 3300010301 | Grasslands Soil | GDGKYGYLCCHDDAVVFEFELANGCVTRTFPTASGCEFVVAYH* |
Ga0126376_103468873 | 3300010359 | Tropical Forest Soil | DGRHAYLCCHDDAEVFEFELATGRVVRTFPTAAGCEFIVGYSA* |
Ga0126376_108829582 | 3300010359 | Tropical Forest Soil | FAAGGTHAYLCCHDDAEVFEFELATGRVTRTFPTAAGCEFIVAYH* |
Ga0126372_112060531 | 3300010360 | Tropical Forest Soil | DGKHAYLCCHDDAEVFEFELASGRVARTFPTAAGCEFIVAYH* |
Ga0126377_102615831 | 3300010362 | Tropical Forest Soil | CCHDDAEVFEFELASGRVTRTFATAAGCEFIVAYQ* |
Ga0126377_128907891 | 3300010362 | Tropical Forest Soil | GMGFAPGGTHAYLCCHDDAEVFEFELASGRVTRTFATAAGCEFIVAYQ* |
Ga0126377_131023102 | 3300010362 | Tropical Forest Soil | MGFGFGPDGAHAYLCCHDDAVVFELELSSGCVSRTFATGPGCEFIIAYQ* |
Ga0126379_115646132 | 3300010366 | Tropical Forest Soil | MGFGFGPDGAHAYLCCHDDAVVFELELESGCVSRTFATGPGCEFIIAYQ* |
Ga0126381_1048043882 | 3300010376 | Tropical Forest Soil | PMGFGFAADGRHAYLCCHDDAVVFEIELATGRVTREFPTAAGCEFVLAY* |
Ga0126383_126953371 | 3300010398 | Tropical Forest Soil | KKSPMGMGFAPGGTHAYVCCHDDAEVFEFELATGRVTRTFPTAAGCEFIIAYQ* |
Ga0134127_115307141 | 3300010399 | Terrestrial Soil | MGFGFAADGKHAFVCCHDAAIVTEFELSTGRVTREFPTASGCEFIIAY* |
Ga0154003_10733072 | 3300012081 | Attine Ant Fungus Gardens | CCHDDAVVTEFELASGRVTRDVSTAAGCEFIVAYH* |
Ga0137404_111707801 | 3300012929 | Vadose Zone Soil | GGTHAYVCCHDDAEVFEFELATGRVTRTFPTAAGCEFIIAYM* |
Ga0126375_105138073 | 3300012948 | Tropical Forest Soil | CCHDDAEVFEFELASGRVTRTFPTAAGCEFILGYPA* |
Ga0153916_132162882 | 3300012964 | Freshwater Wetlands | AADGRHAYLCCHDDAIVLEFELASGHVTREFATAAGCEFIVSY* |
Ga0153916_132933202 | 3300012964 | Freshwater Wetlands | KHAYLCCHDAAIALEIELSSGRITRQFETAAGCEFIISYS* |
Ga0126369_127537972 | 3300012971 | Tropical Forest Soil | GPDGAHAYLCCHDDAVVFELELASGCVSRTFATGPGCEFIIAYQ* |
Ga0157374_108891912 | 3300013296 | Miscanthus Rhizosphere | FGFAADGQRAYLCCHDAAVTLEFELASGRITRQFPTAAGCEFIFSY* |
Ga0157372_120628752 | 3300013307 | Corn Rhizosphere | FGFAAGGERAYLCCHDAAITLEFELASGRITRQFPTGAGCEFIVSY* |
Ga0157375_137625761 | 3300013308 | Miscanthus Rhizosphere | KSPMGFGFAPGGTHAYVCCHDDAEVFEFELATGRVTRTFPTAAGCEFIVAYH* |
Ga0181538_101266203 | 3300014162 | Bog | GFAPDGEHAYLCCHDDAVVFEFELASGEITRRFPTAAGCEFIVAYH* |
Ga0181535_100766234 | 3300014199 | Bog | FAPDGKHAYLCCHDDAVVFEFALANGRIARTFPTAAGCEFIVAYH* |
Ga0181537_105009492 | 3300014201 | Bog | CHDDAVVYEFELATGHLTRTFETAAGCEFIVAYH* |
Ga0157377_115763502 | 3300014745 | Miscanthus Rhizosphere | HAFVCCHDDATVMEFELSTGRATREFRTASGCEFIISY* |
Ga0173483_104734231 | 3300015077 | Soil | GKHAFVCCHDDATVMEFELSTGRATREFKTASGCEFIISY* |
Ga0173480_100281241 | 3300015200 | Soil | PMGFGFAADGMHAFVCCHDDATVMEFELSTGRATREFKTASGCEFIISY* |
Ga0137409_107069902 | 3300015245 | Vadose Zone Soil | FGFAADGAHAFLCCHDDAEVCEFELASGRITRTFATAAGCEFMVAYQ* |
Ga0182032_100301105 | 3300016357 | Soil | HGYLCCHDAAVTLEFELAGGHITGQFKTAAGCEFIVSY |
Ga0187782_110907921 | 3300017975 | Tropical Peatland | GFGFAPDGRHAYLCCHDDAVVFEFDLASGQIARSFPTAAGCEFIVAYR |
Ga0187889_104003212 | 3300018023 | Peatland | AYLCCHDDAVVFEFELASGEITRTFPTAAGCEFIVAYH |
Ga0187855_101686513 | 3300018038 | Peatland | CCHDDAVVFEFDLSSGLVTRTFPTAAGCEFIVAYH |
Ga0187871_103224551 | 3300018042 | Peatland | APDGKHAYLCCHDDAVVYEFELATGHLTRTFETAAGCEFIVAYH |
Ga0187858_107741111 | 3300018057 | Peatland | KKSPMGFGFAPDGNHAYLCCHDDAVVFEFDLSSGLVTRTFPTAAGCEFIVAYH |
Ga0187765_102184083 | 3300018060 | Tropical Peatland | GPMGFGFAPDGEHAYLCCHDDAVVFEFELNSGRVTRTFPTEAGCEFIVAYH |
Ga0184625_102531282 | 3300018081 | Groundwater Sediment | ADGKHGYLCCHDDAEVFEFELASGRVNRAFPTAAGCEFIVAYH |
Ga0184628_102481032 | 3300018083 | Groundwater Sediment | PMGFGFAGDGKHAYLCCHDAAIILEFELASGRVTRQFETAAGCEFIIAY |
Ga0187769_102679801 | 3300018086 | Tropical Peatland | SAYLCCHDDAVVFEFELKTGKVKRTFPTDAGCEFIVAYH |
Ga0190275_134749712 | 3300018432 | Soil | CCHDDAVVLEFALATGRVMRQFTTASGCEYVIAYQEG |
Ga0190275_135415731 | 3300018432 | Soil | PGGTHAYVCCHDDAEVLEFELATGQVARTFSTAAGCEFIVAYH |
Ga0190269_112160151 | 3300018465 | Soil | KGPMGFGFAPDGRHAYLCCHDDAEVFEFELATGTVSRTFSTAAGCEFIVAYH |
Ga0190273_114045021 | 3300018920 | Soil | GFGFAPDGRHAYVCCHDDAEVWEFELATGKVTRTVPTAAGCEFIVAYQ |
Ga0210391_110092531 | 3300021433 | Soil | LCCHDDAIVTEFELATGKATRTFSTDAGCEFVVAYH |
Ga0210398_101461144 | 3300021477 | Soil | FAPDGKHAYLCCHDDGVVYEFELASGYLNRTFETAAGCEFIVAYH |
Ga0209109_100561725 | 3300025160 | Soil | GKHAFLCCHGDATVLEFELATGGITREFGTDKGCEFIISYQ |
Ga0209108_101216553 | 3300025165 | Soil | GFGFAADGKHAFLCCHGDATVLEFELESGRITREFGTDKGCEFIICYQ |
Ga0209640_105284613 | 3300025324 | Soil | FLCCHDDVVVLELELTTGRITREFATDKGCEFVIAYR |
Ga0208820_11295522 | 3300025576 | Peatland | LCCHDDAVVFEFELASGEITRTFPTAAGCEFIVAYH |
Ga0207653_103322771 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | FAADGQRAYLCCHDAAVTLEFELASGRITRQFPTAAGCEFIFSY |
Ga0207657_108582741 | 3300025919 | Corn Rhizosphere | GFAADGEHAYLCCHDAAITLEFELASGRITRQFPTAAGCEFIVSY |
Ga0207711_105028963 | 3300025941 | Switchgrass Rhizosphere | PMGFGFAADGEHAYLCCHDAAITLEFELASGRITRQFPTAAGCEFIVSY |
Ga0207711_112470122 | 3300025941 | Switchgrass Rhizosphere | VCCHDDATVMEFELSTGRATREFKTASGCEFIISY |
Ga0207689_108854561 | 3300025942 | Miscanthus Rhizosphere | HAFVCCHDDAIVIEFELSTGRATRSFPTAAGCEFIISY |
Ga0207712_114234051 | 3300025961 | Switchgrass Rhizosphere | FAPDGKHAFLCCHDDAVVFEFELASGRVTRTFPTASGCEFIVAYH |
Ga0256814_10302481 | 3300026464 | Sediment | DRHAFLCCHDAAVMLEFELGSARITRQFPTAAGCEFVISY |
Ga0207727_1032233 | 3300026854 | Tropical Forest Soil | AADGRHAYLCCHDAAVMLEFELASGHITRQVETAAGCEFVLSY |
Ga0207823_1002054 | 3300026860 | Tropical Forest Soil | LCCHDAAATLELELAGGHITGQFKTAAGCEFIVSY |
Ga0207745_100014113 | 3300026889 | Tropical Forest Soil | LCCHDAAATLELELAGGHITRQFKTAAGCEFIVSY |
Ga0207824_10092481 | 3300026990 | Tropical Forest Soil | MGFCFDGHGQHGYLCCHDAAATLELELAGGHITGQFKTAAGCEFIVSY |
Ga0207855_10506901 | 3300027039 | Tropical Forest Soil | ANGRHAYLCCHDAAVMLEFELASGHITRQVETAAGCEFVLSY |
Ga0208199_11070771 | 3300027497 | Peatlands Soil | DGAHGYLCCHDDAVVFEFDLSSGLVTRTFPTAIGCEFIVAYH |
Ga0209008_10963862 | 3300027545 | Forest Soil | GFAPDGKHAYLCCHDDGVVYEFELASGYLNRTFETAAGCEFIVAYH |
Ga0209039_102178642 | 3300027825 | Bog Forest Soil | HAYLCCHDDAVVIEFELASGKAARTFPTAAGCEFIVAYH |
Ga0209488_105743042 | 3300027903 | Vadose Zone Soil | MGFGFAADGKHAYLCCHDDAEVFEFELASGRVTRTFPTAAGCEFIVAYH |
Ga0209382_106192991 | 3300027909 | Populus Rhizosphere | APDGKHAYVCCHDDAAVFEFELATGRVTREFATAAGCEFIVAYH |
Ga0307295_102161141 | 3300028708 | Soil | ADGKHAYLCCHDAAVTLEFDLANGKITRQFPTAAGCEFVISY |
Ga0307322_102320631 | 3300028710 | Soil | MGFGFAADGKHAYLCCHDDAEVFEFELAGGRVTRTFPTAAGCEFIVAYH |
Ga0307504_104120342 | 3300028792 | Soil | AKHAFLCCHDAAVTLEFDMASARITRQFPTAAGCEFVISY |
Ga0307287_102761222 | 3300028796 | Soil | SPMGMGFAPGGTHAYVCCHDDAEVFEFELATGRVTRTFPTAAGCEFIVAYH |
Ga0302226_104343061 | 3300028801 | Palsa | GKHAYLCCHDDGVVYEFELATGHLTRTFETAAGCEFIVAYH |
Ga0311339_111133191 | 3300029999 | Palsa | KKSPMGFGFAPDGKHAYLCCHDDAVVYEFELATGHLTRTFETAAGCEFIVAYH |
Ga0311338_106861002 | 3300030007 | Palsa | KSPMGFGFAPDGKHAYLCCHDDGVVYEFELATGHLTRTFETAAGCEFIVAYH |
Ga0302178_101540173 | 3300030013 | Palsa | KSPMGFGFAPDGKHAYLCCHDDAVVYEFELATGHLSRTFETAAGCEFIVAYH |
Ga0302177_102766192 | 3300030053 | Palsa | MGFGFAPDGKHAYLCCHDDGVVYEFELATGHLTRTFETAAGCEFIVAYH |
Ga0302177_104345841 | 3300030053 | Palsa | PDGKHAYLCCHDDAVVYEFELATGHLSRTFETAAGCEFIVAYH |
Ga0311356_114189992 | 3300030617 | Palsa | HAYLCCHDDAVVYEFELATGHLSRTFETAAGCEFIVAYH |
Ga0310039_103513302 | 3300030706 | Peatlands Soil | PDGAHGYLCCHDDAVVFEFDLSSGLVTRTFPTAIGCEFIVAYH |
Ga0302180_106001361 | 3300031028 | Palsa | GGKHAYLCCHDDAVVYEFELATGHLTRTFETAAGCEFIVAYH |
Ga0307500_100728641 | 3300031198 | Soil | GGKHAYICCHDDAEVFEFELASGRVTRTFPTAAGCEFIVAYH |
Ga0307506_102339802 | 3300031366 | Soil | LCCHDAAVVLEFNLGAARITREFQTAAGCEFIVSY |
Ga0311364_118551761 | 3300031521 | Fen | GFGFAADNRHAYLCCHDEAVTLEFNLESGRVTRQFPTASGCEFVISY |
Ga0302326_134081261 | 3300031525 | Palsa | CCHDDAVVYEFELATGHLTRTFETAAGCEFIVAYH |
Ga0307436_10133371 | 3300031563 | Salt Marsh | NEHAYLCCHDAAVTLEFTLASGRVTRQFDTAPGCEFVISY |
Ga0315535_10782551 | 3300031699 | Salt Marsh Sediment | EHAFLCCHDAAVTLEFTLASGRVTRQFATAPGCEFVISY |
Ga0318535_102186352 | 3300031764 | Soil | LCCHDAAVTLEFELAGGHITGQFKTAAGCEFIVSY |
Ga0310917_103947812 | 3300031833 | Soil | GWHGYLCCHDAAVTLEFELAGGHITGQFKTAAGCEFIVSY |
Ga0306923_119992541 | 3300031910 | Soil | FAADGRHAYLCCHDAATTLEFDMTNGKITRQFPTAAGCEFVVSY |
Ga0310912_102894793 | 3300031941 | Soil | HAYLCCHDAATTLEFDMTNGKITRQFPTAAGCEFVVSY |
Ga0310906_105366871 | 3300032013 | Soil | RAYLCCHDDAVVLEFELDSGRVTRQFPTASGCEFIISY |
Ga0310899_104089121 | 3300032017 | Soil | LCCHDAAVTLEFELASGRITRQFPTAAGCEFIFSY |
Ga0315540_100289401 | 3300032061 | Salt Marsh Sediment | FGFAADNEHAFLCCHDAAVTLEFALASGRITRAFETAAGCEFVISY |
Ga0308173_108413611 | 3300032074 | Soil | AYLCCHDAAVMLEFELATGRITRQVETAAGCEFVLSY |
Ga0306924_122994021 | 3300032076 | Soil | GFAPDGEHAYLCCHDDAVVFEFELNSGRVTRTFPTEAGCEFIVAYH |
Ga0310889_104190972 | 3300032179 | Soil | VCCHDDAEVFEFELATGRVTRTFPTAAGCEFIVAYH |
Ga0335085_103984713 | 3300032770 | Soil | GQRAYLCCHDAATTLEFELARGRITRQFDTAAGCEFIISY |
Ga0335082_102772323 | 3300032782 | Soil | APMGFGFAPDGTHAYICCHDDAVVSEFELATGRVTREFPTAAGCEFIVAYH |
Ga0335079_106151891 | 3300032783 | Soil | KGPMGFGFAPDGKHAYLCCHDDAEVFEFALESGRVTRTFPTAAGCEFIVAYH |
Ga0335080_113447201 | 3300032828 | Soil | CCHDDAVVSEFELASGRITRNFTTAAGCEFIVAYH |
Ga0335080_115660571 | 3300032828 | Soil | PDGEHAYLCCHDDAEVFEFELATGRITRTFPTAAGCEFIVAYH |
Ga0335076_116149481 | 3300032955 | Soil | AYLCCHDDAIVTEFELATGAAARAFSTDTGCEFVVAYH |
Ga0334854_155510_399_548 | 3300033829 | Soil | MGFGFAPDGNHAYLCCHDDAVVFEFDLSSGLVTRTFPTAAGCEFIVAYH |
⦗Top⦘ |