| Basic Information | |
|---|---|
| Family ID | F050015 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 54 residues |
| Representative Sequence | MNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRVMGWP |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 81.51 % |
| % of genes near scaffold ends (potentially truncated) | 23.29 % |
| % of genes from short scaffolds (< 2000 bps) | 83.56 % |
| Associated GOLD sequencing projects | 77 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.068 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (22.603 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.260 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.699 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 57.32% β-sheet: 0.00% Coil/Unstructured: 42.68% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF00724 | Oxidored_FMN | 4.79 |
| PF03626 | COX4_pro | 2.74 |
| PF00106 | adh_short | 2.05 |
| PF14707 | Sulfatase_C | 2.05 |
| PF13561 | adh_short_C2 | 1.37 |
| PF09335 | SNARE_assoc | 1.37 |
| PF02780 | Transketolase_C | 1.37 |
| PF00510 | COX3 | 1.37 |
| PF02113 | Peptidase_S13 | 0.68 |
| PF13567 | DUF4131 | 0.68 |
| PF00480 | ROK | 0.68 |
| PF13424 | TPR_12 | 0.68 |
| PF02518 | HATPase_c | 0.68 |
| PF12840 | HTH_20 | 0.68 |
| PF02632 | BioY | 0.68 |
| PF13374 | TPR_10 | 0.68 |
| PF00487 | FA_desaturase | 0.68 |
| PF07730 | HisKA_3 | 0.68 |
| PF07690 | MFS_1 | 0.68 |
| PF00165 | HTH_AraC | 0.68 |
| PF02913 | FAD-oxidase_C | 0.68 |
| PF06240 | COXG | 0.68 |
| PF13419 | HAD_2 | 0.68 |
| PF13560 | HTH_31 | 0.68 |
| PF00528 | BPD_transp_1 | 0.68 |
| PF02515 | CoA_transf_3 | 0.68 |
| PF00378 | ECH_1 | 0.68 |
| PF02371 | Transposase_20 | 0.68 |
| PF01494 | FAD_binding_3 | 0.68 |
| PF03186 | CobD_Cbib | 0.68 |
| PF00535 | Glycos_transf_2 | 0.68 |
| PF16177 | ACAS_N | 0.68 |
| PF12071 | DUF3551 | 0.68 |
| PF05378 | Hydant_A_N | 0.68 |
| PF04392 | ABC_sub_bind | 0.68 |
| PF07568 | HisKA_2 | 0.68 |
| PF02627 | CMD | 0.68 |
| PF00190 | Cupin_1 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0042 | tRNA-dihydrouridine synthase | Translation, ribosomal structure and biogenesis [J] | 4.79 |
| COG1902 | 2,4-dienoyl-CoA reductase or related NADH-dependent reductase, Old Yellow Enzyme (OYE) family | Energy production and conversion [C] | 4.79 |
| COG3125 | Heme/copper-type cytochrome/quinol oxidase, subunit 4 | Energy production and conversion [C] | 2.74 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 1.37 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.37 |
| COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 1.37 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 1.37 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.37 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 1.37 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 1.37 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.68 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.68 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.68 |
| COG3920 | Two-component sensor histidine kinase, HisKA and HATPase domains | Signal transduction mechanisms [T] | 0.68 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.68 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.68 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.68 |
| COG3427 | Carbon monoxide dehydrogenase subunit CoxG | Energy production and conversion [C] | 0.68 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 0.68 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.68 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.68 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.68 |
| COG2027 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.68 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.68 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 0.68 |
| COG1270 | Cobalamin biosynthesis protein CobD/CbiB | Coenzyme transport and metabolism [H] | 0.68 |
| COG1268 | Biotin transporter BioY | Coenzyme transport and metabolism [H] | 0.68 |
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.68 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.07 % |
| Unclassified | root | N/A | 34.93 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104649903 | Not Available | 569 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10001903 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5447 | Open in IMG/M |
| 3300000955|JGI1027J12803_100445410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1352 | Open in IMG/M |
| 3300000955|JGI1027J12803_109579464 | Not Available | 964 | Open in IMG/M |
| 3300000956|JGI10216J12902_114169181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 661 | Open in IMG/M |
| 3300001431|F14TB_100540686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium | 501 | Open in IMG/M |
| 3300004463|Ga0063356_105551900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 541 | Open in IMG/M |
| 3300004480|Ga0062592_100412762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1079 | Open in IMG/M |
| 3300004633|Ga0066395_10377317 | Not Available | 794 | Open in IMG/M |
| 3300005175|Ga0066673_10895841 | Not Available | 505 | Open in IMG/M |
| 3300005184|Ga0066671_10279587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1039 | Open in IMG/M |
| 3300005332|Ga0066388_100013792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium | 6570 | Open in IMG/M |
| 3300005332|Ga0066388_100135274 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3018 | Open in IMG/M |
| 3300005332|Ga0066388_100924211 | Not Available | 1447 | Open in IMG/M |
| 3300005332|Ga0066388_101088160 | Not Available | 1352 | Open in IMG/M |
| 3300005332|Ga0066388_101410674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1211 | Open in IMG/M |
| 3300005332|Ga0066388_101519661 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1172 | Open in IMG/M |
| 3300005332|Ga0066388_101971449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
| 3300005332|Ga0066388_105291537 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300005332|Ga0066388_106787977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 576 | Open in IMG/M |
| 3300005363|Ga0008090_10196372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 701 | Open in IMG/M |
| 3300005441|Ga0070700_101061998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 669 | Open in IMG/M |
| 3300005540|Ga0066697_10204754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1173 | Open in IMG/M |
| 3300005560|Ga0066670_10033670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2530 | Open in IMG/M |
| 3300005561|Ga0066699_10251613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1247 | Open in IMG/M |
| 3300005562|Ga0058697_10109906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1156 | Open in IMG/M |
| 3300005713|Ga0066905_100169895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1595 | Open in IMG/M |
| 3300005713|Ga0066905_100182949 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1548 | Open in IMG/M |
| 3300005713|Ga0066905_100258016 | Not Available | 1344 | Open in IMG/M |
| 3300005713|Ga0066905_100324899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1219 | Open in IMG/M |
| 3300005713|Ga0066905_100357913 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300005713|Ga0066905_100387135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1130 | Open in IMG/M |
| 3300005713|Ga0066905_100927247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300005713|Ga0066905_100949024 | Not Available | 756 | Open in IMG/M |
| 3300005713|Ga0066905_101066446 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300005713|Ga0066905_101392955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. 99 | 634 | Open in IMG/M |
| 3300005764|Ga0066903_100070564 | All Organisms → cellular organisms → Bacteria | 4465 | Open in IMG/M |
| 3300005764|Ga0066903_100094736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3993 | Open in IMG/M |
| 3300005764|Ga0066903_100244962 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2756 | Open in IMG/M |
| 3300005764|Ga0066903_100484809 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2086 | Open in IMG/M |
| 3300005764|Ga0066903_100939506 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1571 | Open in IMG/M |
| 3300005764|Ga0066903_101062867 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300005764|Ga0066903_103311827 | Not Available | 870 | Open in IMG/M |
| 3300005764|Ga0066903_105176509 | Not Available | 690 | Open in IMG/M |
| 3300005764|Ga0066903_105932794 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300005764|Ga0066903_106652755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300005843|Ga0068860_100576349 | Not Available | 1129 | Open in IMG/M |
| 3300005937|Ga0081455_10020137 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 6292 | Open in IMG/M |
| 3300006038|Ga0075365_10277431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300006049|Ga0075417_10104477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1287 | Open in IMG/M |
| 3300006051|Ga0075364_10625871 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
| 3300006806|Ga0079220_10691627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 747 | Open in IMG/M |
| 3300006844|Ga0075428_100027418 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 6304 | Open in IMG/M |
| 3300006844|Ga0075428_102494243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 530 | Open in IMG/M |
| 3300006845|Ga0075421_100001802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 25253 | Open in IMG/M |
| 3300006845|Ga0075421_100684468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1194 | Open in IMG/M |
| 3300006846|Ga0075430_100511410 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300006846|Ga0075430_101502693 | Not Available | 553 | Open in IMG/M |
| 3300006854|Ga0075425_100002994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 17036 | Open in IMG/M |
| 3300006871|Ga0075434_102432822 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300006904|Ga0075424_102325021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 563 | Open in IMG/M |
| 3300009094|Ga0111539_10418678 | Not Available | 1560 | Open in IMG/M |
| 3300009100|Ga0075418_10613678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1171 | Open in IMG/M |
| 3300009100|Ga0075418_11136627 | Not Available | 846 | Open in IMG/M |
| 3300009101|Ga0105247_10392952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 986 | Open in IMG/M |
| 3300009147|Ga0114129_10205618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2664 | Open in IMG/M |
| 3300009147|Ga0114129_10211735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2620 | Open in IMG/M |
| 3300009147|Ga0114129_12287390 | Not Available | 649 | Open in IMG/M |
| 3300009147|Ga0114129_12699354 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300009156|Ga0111538_11264316 | Not Available | 932 | Open in IMG/M |
| 3300009177|Ga0105248_10702244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1141 | Open in IMG/M |
| 3300009553|Ga0105249_11360951 | Not Available | 782 | Open in IMG/M |
| 3300009792|Ga0126374_11649369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
| 3300010036|Ga0126305_10630491 | Not Available | 722 | Open in IMG/M |
| 3300010043|Ga0126380_10045147 | Not Available | 2342 | Open in IMG/M |
| 3300010043|Ga0126380_10783609 | Not Available | 778 | Open in IMG/M |
| 3300010043|Ga0126380_10835701 | Not Available | 758 | Open in IMG/M |
| 3300010043|Ga0126380_11158383 | Not Available | 663 | Open in IMG/M |
| 3300010043|Ga0126380_11364629 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300010046|Ga0126384_10125521 | All Organisms → cellular organisms → Bacteria | 1938 | Open in IMG/M |
| 3300010046|Ga0126384_10537332 | Not Available | 1014 | Open in IMG/M |
| 3300010046|Ga0126384_11673971 | Not Available | 601 | Open in IMG/M |
| 3300010046|Ga0126384_12393648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 511 | Open in IMG/M |
| 3300010047|Ga0126382_10458403 | Not Available | 1013 | Open in IMG/M |
| 3300010047|Ga0126382_10662489 | Not Available | 869 | Open in IMG/M |
| 3300010047|Ga0126382_11053891 | Not Available | 717 | Open in IMG/M |
| 3300010047|Ga0126382_11176686 | Not Available | 685 | Open in IMG/M |
| 3300010358|Ga0126370_10048934 | Not Available | 2675 | Open in IMG/M |
| 3300010358|Ga0126370_10564948 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 975 | Open in IMG/M |
| 3300010359|Ga0126376_11234436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300010359|Ga0126376_12334229 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010362|Ga0126377_10032494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4423 | Open in IMG/M |
| 3300010362|Ga0126377_10239978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Sinorhizobium/Ensifer group → Ensifer → Ensifer aridi | 1759 | Open in IMG/M |
| 3300010362|Ga0126377_10894386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 950 | Open in IMG/M |
| 3300010362|Ga0126377_12365129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium centrolobii | 607 | Open in IMG/M |
| 3300010366|Ga0126379_10973399 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300010366|Ga0126379_12343826 | Not Available | 634 | Open in IMG/M |
| 3300010398|Ga0126383_10647000 | Not Available | 1132 | Open in IMG/M |
| 3300010398|Ga0126383_11156816 | Not Available | 863 | Open in IMG/M |
| 3300010398|Ga0126383_12865673 | Not Available | 563 | Open in IMG/M |
| 3300012081|Ga0154003_1012971 | Not Available | 1760 | Open in IMG/M |
| 3300012200|Ga0137382_10588821 | Not Available | 794 | Open in IMG/M |
| 3300012582|Ga0137358_10036253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 3256 | Open in IMG/M |
| 3300012582|Ga0137358_10181891 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1434 | Open in IMG/M |
| 3300012948|Ga0126375_10804051 | Not Available | 745 | Open in IMG/M |
| 3300012948|Ga0126375_11117912 | Not Available | 650 | Open in IMG/M |
| 3300012971|Ga0126369_12375905 | Not Available | 616 | Open in IMG/M |
| 3300014267|Ga0075313_1100114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 715 | Open in IMG/M |
| 3300014968|Ga0157379_11686365 | Not Available | 620 | Open in IMG/M |
| 3300014969|Ga0157376_12051680 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300015371|Ga0132258_10206689 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4766 | Open in IMG/M |
| 3300015371|Ga0132258_12026478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1448 | Open in IMG/M |
| 3300016357|Ga0182032_10102625 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 2022 | Open in IMG/M |
| 3300016387|Ga0182040_10502901 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300017974|Ga0187777_11294109 | Not Available | 535 | Open in IMG/M |
| 3300018058|Ga0187766_10606917 | Not Available | 747 | Open in IMG/M |
| 3300018433|Ga0066667_10106973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1877 | Open in IMG/M |
| 3300018433|Ga0066667_12320746 | Not Available | 503 | Open in IMG/M |
| 3300018469|Ga0190270_10681994 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
| 3300018469|Ga0190270_10815423 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300020581|Ga0210399_11482958 | Not Available | 527 | Open in IMG/M |
| 3300021082|Ga0210380_10022583 | All Organisms → cellular organisms → Bacteria | 2673 | Open in IMG/M |
| 3300021178|Ga0210408_11233874 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS188 | 570 | Open in IMG/M |
| 3300021377|Ga0213874_10353921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 563 | Open in IMG/M |
| 3300021560|Ga0126371_10064217 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3550 | Open in IMG/M |
| 3300021560|Ga0126371_10820300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp. | 1076 | Open in IMG/M |
| 3300021560|Ga0126371_12138268 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → unclassified Methylocystis → Methylocystis sp. MJC1 | 675 | Open in IMG/M |
| 3300026075|Ga0207708_11739713 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300026342|Ga0209057_1198744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
| 3300027873|Ga0209814_10017309 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2895 | Open in IMG/M |
| 3300027873|Ga0209814_10442461 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300027874|Ga0209465_10144521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300027880|Ga0209481_10264856 | Not Available | 867 | Open in IMG/M |
| 3300027907|Ga0207428_10420190 | Not Available | 977 | Open in IMG/M |
| 3300027909|Ga0209382_10005613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 16316 | Open in IMG/M |
| 3300028381|Ga0268264_11280959 | Not Available | 743 | Open in IMG/M |
| 3300028592|Ga0247822_10569415 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
| 3300028875|Ga0307289_10449934 | Not Available | 529 | Open in IMG/M |
| 3300028878|Ga0307278_10284900 | Not Available | 731 | Open in IMG/M |
| 3300031545|Ga0318541_10566552 | Not Available | 635 | Open in IMG/M |
| 3300031573|Ga0310915_10154738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1587 | Open in IMG/M |
| 3300031740|Ga0307468_100870375 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
| 3300031740|Ga0307468_101980853 | Not Available | 557 | Open in IMG/M |
| 3300031879|Ga0306919_10347321 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1133 | Open in IMG/M |
| 3300032261|Ga0306920_101357779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1020 | Open in IMG/M |
| 3300033158|Ga0335077_11989326 | Not Available | 540 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 22.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 21.23% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 15.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.16% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.74% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.37% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.37% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.68% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.68% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.68% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.68% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.68% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005562 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006038 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012081 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL087 MetaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1046499031 | 3300000364 | Soil | MGLIVEYFRLIDLLALTALAAPACAAFVRNRNVWLFVAGISVAIRGTIRVMGLA* |
| AF_2010_repII_A1DRAFT_100019037 | 3300000597 | Forest Soil | MNFFVQYFKLIDVLALAALAALACAALVRNRSVWLFVAGILVAIWGAMRIMGWP* |
| JGI1027J12803_1004454102 | 3300000955 | Soil | MNFFVEYFKLIDLLALAALAALACAALVRNRSVWLFVAGSLAAIWGAMRILGWP* |
| JGI1027J12803_1095794641 | 3300000955 | Soil | MGLIVEYFRLIDLLALTALAAPACAAFVRNRNVWLFVAGISVAIRGTI |
| JGI10216J12902_1141691812 | 3300000956 | Soil | LIDLLALAALAALACAALVRNRSVWLFVAGSLAAIWGAMRILGWP* |
| F14TB_1005406861 | 3300001431 | Soil | MNFFVEYFKLIDLLALAALAALACAALVRTRSVWLFVAGILVAIWGAMRIMGWP* |
| Ga0063356_1055519002 | 3300004463 | Arabidopsis Thaliana Rhizosphere | KLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGTVRALGLA* |
| Ga0062592_1004127621 | 3300004480 | Soil | MGLILEYFRLIDLLALAALVALACAAFVRNRSVWLFVAGISVAIWGTLRAMGLS* |
| Ga0066395_103773172 | 3300004633 | Tropical Forest Soil | NFFIEYFKLIDLLALAALAALACAALVRNGSVWLFLAGILAAIWGTMRVMGWP* |
| Ga0066673_108958412 | 3300005175 | Soil | MNFLVEYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIVGWP* |
| Ga0066671_102795871 | 3300005184 | Soil | EALMNFLVEYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWP* |
| Ga0066388_10001379210 | 3300005332 | Tropical Forest Soil | MSFFIEYFKLIDLLALAALAALACAALVRNGSVWLFLAGILVAIWGVMRVVAWP* |
| Ga0066388_1001352743 | 3300005332 | Tropical Forest Soil | MNFFVEYFRLIDLLALAALVALACAALVRNRSVWLFVAAILVAIWGAMRIISLP* |
| Ga0066388_1009242112 | 3300005332 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAALACAALFRNGSVWLFVAGILVAIWGAMRVMGGNQTASV* |
| Ga0066388_1010881603 | 3300005332 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAALACAALVRNRSVWLFVAVVLVAIWGAMRIMGWP* |
| Ga0066388_1014106742 | 3300005332 | Tropical Forest Soil | VSVVIEYFKLIDLLALLALAVLAFVALRRTGSVWLFVSGILIAIWGAMRLLGWP* |
| Ga0066388_1015196612 | 3300005332 | Tropical Forest Soil | MNFLVEYFKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWP* |
| Ga0066388_1019714492 | 3300005332 | Tropical Forest Soil | MNFLVDYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWP* |
| Ga0066388_1052915371 | 3300005332 | Tropical Forest Soil | MNFFFEYFKLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRVMGWP* |
| Ga0066388_1067879771 | 3300005332 | Tropical Forest Soil | MRVVIEYFRLIDLLALLALAVLAFAALRRTGSVWLFVSGILIAIWGAMRLLGWP* |
| Ga0008090_101963722 | 3300005363 | Tropical Rainforest Soil | MNFFVEYFRLIDLLALAALVALACAALVRNRSVWLFVAAILVAIWGAMRIITLP* |
| Ga0070700_1010619981 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSTFLIDYFKAIDLLALAGLAALACAALSRNGNVWLFIAGVIVAIWGTMRVLGWP* |
| Ga0066697_102047541 | 3300005540 | Soil | MNFLVEYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIW |
| Ga0066670_100336704 | 3300005560 | Soil | MNFLVEYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWP* |
| Ga0066699_102516132 | 3300005561 | Soil | MNFFVEYFKLIDLLALAALAVLACAALVRNRSVWLFVAGILVAIWGAMRIMGWP* |
| Ga0058697_101099062 | 3300005562 | Agave | MNFFVEYLKLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRIMGWP* |
| Ga0066905_1001698952 | 3300005713 | Tropical Forest Soil | MNFFIDYFKLIDILALAALAALACAALVRNKSVWLFVAVILVVIWGATRIMGWP* |
| Ga0066905_1001829494 | 3300005713 | Tropical Forest Soil | MSVVIEYFKLIDLLALLALAVLAFVALRRTGSVWLFVSGILIAIWGAMRLLGWP* |
| Ga0066905_1002580162 | 3300005713 | Tropical Forest Soil | LMNFFIEYFKLIDLLALAALAALACAALVRSGTVWLSVAGILVAIWGAMRVLGWP* |
| Ga0066905_1003248992 | 3300005713 | Tropical Forest Soil | MKFFVDYFKLIDLLALAALAALACAALVRNRSVWLFVAGILVAIWGAMRVMGWP* |
| Ga0066905_1003579133 | 3300005713 | Tropical Forest Soil | MNFFVEYFRLIDLLALAALAALACAALVRNRSVWLFVAEILVALWGAMRIIGWFLSWP* |
| Ga0066905_1003871352 | 3300005713 | Tropical Forest Soil | MDYFVEYFKLIDLLALAALAALACAALIRNGSVWLFVAGILAAIWGAMRVLGWP* |
| Ga0066905_1009272472 | 3300005713 | Tropical Forest Soil | MNFFIDYFKLIDLLALAALAALACAALIRNASVWLFVAGILVAIWGAMRVMGWP* |
| Ga0066905_1009490242 | 3300005713 | Tropical Forest Soil | LMNFFIEYFKLIDLLALAALAALACAALVRNASVWLFVAGILVAIWGAMRILGWP* |
| Ga0066905_1010664462 | 3300005713 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRIMGWP* |
| Ga0066905_1013929551 | 3300005713 | Tropical Forest Soil | MNFFVEYFRLIDLLALAALVALACAALVRNRSVWLFVAAILVAIW |
| Ga0066903_10007056410 | 3300005764 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAVLACAALVRNGSVWLFVAGILVAIWGAMRVMGWP* |
| Ga0066903_1000947365 | 3300005764 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRVVGWP* |
| Ga0066903_1002449625 | 3300005764 | Tropical Forest Soil | MNFFVEYFKLIDLLALAALAALACAALIRNRSVWLFVAGILVVIWGAMRITGWP* |
| Ga0066903_1004848092 | 3300005764 | Tropical Forest Soil | VNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFLAGILAAIWGTMRVMGWP* |
| Ga0066903_1009395062 | 3300005764 | Tropical Forest Soil | MNFLVEYLKLIDLLALAALAALACAALVRNRSIWLFVAVILVAIWGAMRIMGWP* |
| Ga0066903_1010628672 | 3300005764 | Tropical Forest Soil | MNFLVDYFKLIDLLALAALAALACAALVRSRSVWLFVAGILVVIWGVMRIMG* |
| Ga0066903_1033118271 | 3300005764 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAALACAALVRNGSIWLFVAAILVAIWGAMRVMGWP* |
| Ga0066903_1051765093 | 3300005764 | Tropical Forest Soil | LTNFFVEYFKLIDLLALAALAALACAALVRNRSVWLFVAEILVAIWGAMRIIGWFLSWLR |
| Ga0066903_1059327942 | 3300005764 | Tropical Forest Soil | MNFLVDYLKLIDLLALAALAALACAALVHNRSVWLFVAVILVAIWGAMRIMGWP* |
| Ga0066903_1066527552 | 3300005764 | Tropical Forest Soil | FLVEYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWP* |
| Ga0068860_1005763492 | 3300005843 | Switchgrass Rhizosphere | MSTFLIDYFKAIDLLALAGLAALACAALFRNGNVWLFIAGVIVAIWGTMRVLGWP* |
| Ga0081455_100201372 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRVVIEYFKLIDLLALPALAVLAFAALRRTGSVWLFVSGILIAIWGAMRLLGWP* |
| Ga0075365_102774312 | 3300006038 | Populus Endosphere | MNFLVDYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIM |
| Ga0075417_101044772 | 3300006049 | Populus Rhizosphere | MNFFVEYFKLIDLLALAALAALACAALVRTGSVWLFVAGILVAIWGAMRIMGWP* |
| Ga0075364_106258712 | 3300006051 | Populus Endosphere | MNFLVDYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAIRIMGWP* |
| Ga0079220_106916272 | 3300006806 | Agricultural Soil | MNFLVDYLKLIDLLALIALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWP* |
| Ga0075428_1000274186 | 3300006844 | Populus Rhizosphere | MSFFIDYFKLIDFLALAGLAALACAALIRNGSVWLFVAGILVAIWGTMRVMGWP* |
| Ga0075428_1024942431 | 3300006844 | Populus Rhizosphere | LMNFFVEYFKLIDLLALGALAALACAALVRTGSVWLFVAGILVAIWGAMRIMGWP* |
| Ga0075421_10000180225 | 3300006845 | Populus Rhizosphere | MSLMVEYFKLIDLLALAALASLACAALVRNGSVWLFVAGLLVAAWGTMRVVGWP* |
| Ga0075421_1006844682 | 3300006845 | Populus Rhizosphere | MESFVEYFRLIDLLALAALAALALAALIRDGSVWLFVAGILAAIWGAMRILGLP* |
| Ga0075430_1005114101 | 3300006846 | Populus Rhizosphere | MSFFIDYFKLIDFLALAGLAALACAALIRNGSVWLFVAGILVAIWGTMRVM |
| Ga0075430_1015026931 | 3300006846 | Populus Rhizosphere | MGLIVEYFRLIDLLALAALAALACAAFVRNRSVWLLVAGISVAIWGTLRVTGLS* |
| Ga0075425_10000299410 | 3300006854 | Populus Rhizosphere | MNFFIEYFKLIDLLALAALAALAFAALVRNGSVWLFVAGILVVIWGAMRVMGWP* |
| Ga0075434_1024328222 | 3300006871 | Populus Rhizosphere | MNFLVEYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGATRIMGWP* |
| Ga0075424_1023250212 | 3300006904 | Populus Rhizosphere | MGFIVEYFKVIDLLALVALAALACAALVRNGSVWLFVAGILVAIWGAMRIMGLP* |
| Ga0111539_104186782 | 3300009094 | Populus Rhizosphere | MTTFLVDYFKAIDLLALAGLAALACAALFRSGSVWLFIAGDIVAIWGTMRVLGWP* |
| Ga0075418_106136782 | 3300009100 | Populus Rhizosphere | MSLIVEYFKLIDLLALAALASLACAALVRNGSVWLFVAGLLVAAWGTMRVVGWP* |
| Ga0075418_111366272 | 3300009100 | Populus Rhizosphere | MGLIVEYFRLIDLLALAALAALACAAFVRNRSVWLFVAGISVAIWGTLRVTGLS* |
| Ga0105247_103929522 | 3300009101 | Switchgrass Rhizosphere | MNYFVEYFSLIDLLALAALAALAYAALVRNGTVWLSLAGIPVSIWGAMRVIG* |
| Ga0114129_102056182 | 3300009147 | Populus Rhizosphere | MTTFLIDYFKAIDLLALAGLAALACAALFRNGSVWLFIAGVAMAVWGTMRVFGWP* |
| Ga0114129_102117355 | 3300009147 | Populus Rhizosphere | MSFFIDYFKLIDFLALAGLAALACAALIRNGSVWLFVAGILVAIWGTMRVMGW |
| Ga0114129_122873901 | 3300009147 | Populus Rhizosphere | MSLMVEYFKLIDLLALAALASLACAALVRNGSVWLFVAGLLVAAWGTMR |
| Ga0114129_126993542 | 3300009147 | Populus Rhizosphere | MGLIVEYFRLIDLLALAALAALACAAFVRNRSVWLFVAGIAVAIWGTIRVMGLS* |
| Ga0111538_112643161 | 3300009156 | Populus Rhizosphere | LEEPMTTFLVDYFKAIDLLALAGLAALACAALFRSGSVWLFIAGDIVAIWGTMRVLGWP* |
| Ga0105248_107022441 | 3300009177 | Switchgrass Rhizosphere | MNYFVEYFRLIDLLALAALAALAYAAWVRNGTVWLSLAGILVAIWGAMRVIG* |
| Ga0105249_113609511 | 3300009553 | Switchgrass Rhizosphere | MGLIVEYFRLIDLLALAALAALACAAFVRNRSVWLFVAGISVAIWGTLRAMGLS* |
| Ga0126374_116493692 | 3300009792 | Tropical Forest Soil | VEYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWP* |
| Ga0126305_106304911 | 3300010036 | Serpentine Soil | MNLFMEYFKLIDLLAIAALAALACTAVVRNGSVWLFIAGILVALWGAMRVMGWP* |
| Ga0126380_100451475 | 3300010043 | Tropical Forest Soil | LVNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFLAGILAAIWGTMRVMGWP* |
| Ga0126380_107836091 | 3300010043 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWP* |
| Ga0126380_108357013 | 3300010043 | Tropical Forest Soil | MNFFVEYFRLIDFLALAALAALACAALVRNRSVWLFVAEILVALWGAMRIIGWFLSWP* |
| Ga0126380_111583831 | 3300010043 | Tropical Forest Soil | ALAALACAALVRNKSVWLFVAVILLVIWGATRIMGWP* |
| Ga0126380_113646291 | 3300010043 | Tropical Forest Soil | LGSSRRCRSAGELNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRIMGWP* |
| Ga0126384_101255211 | 3300010046 | Tropical Forest Soil | LNYFIEYFKLIDLLALAALAALACAALVRNGTVWLSVAGILVAIWGAMRVIGWR* |
| Ga0126384_105373322 | 3300010046 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRVVGWT* |
| Ga0126384_116739711 | 3300010046 | Tropical Forest Soil | MSVIIEYFKLIDLLALLALAVLAFAALRRTGSVWLFVAGILIAIWGVMRLLGWP* |
| Ga0126384_123936481 | 3300010046 | Tropical Forest Soil | VSVVIEYFKLIDLLALLALAVLAVAALRRTGSVWLFVSGILIAIWGAMRLLGWP* |
| Ga0126382_104584032 | 3300010047 | Tropical Forest Soil | MNFFIDYFKLIDILALAALAALACAALVRNKSVWLFVAVILLVIWGATRIMGWP* |
| Ga0126382_106624892 | 3300010047 | Tropical Forest Soil | MNFFVEYFKLIDFLALAALAALACAAFVRNRSVWLFLAGILVAIWGAMRIISLP* |
| Ga0126382_110538911 | 3300010047 | Tropical Forest Soil | PQHRRVLMNFFIEYFKLIDLLALAALAALACAALVRSGTVWLSVAGILVAIWGAMRVLGWP* |
| Ga0126382_111766862 | 3300010047 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALACAALVRNASVWLFVAGILVAIWGAMRILGWP* |
| Ga0126370_100489342 | 3300010358 | Tropical Forest Soil | MNIFIEYFKLIDLLALAALAALACAALVRNGSIWLFVAAILVAIWGAMRVMGWP* |
| Ga0126370_105649482 | 3300010358 | Tropical Forest Soil | RGDFFIEYFKLIDLLALAALAALACAALVRNGSVWLFVVGILVAIWGAMRVMGWP* |
| Ga0126376_112344363 | 3300010359 | Tropical Forest Soil | VNFFVEYFRLIDFLALAALAALACAALVRNRSIWLFVAAILVAIWGAMRIISL |
| Ga0126376_123342291 | 3300010359 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALVVLACAALVRNGSVWLFVAGILVAIWGAMRIMGWP* |
| Ga0126377_100324943 | 3300010362 | Tropical Forest Soil | MRVVIEYFKLIDLLALLALAVLAFAALRRTGSVWLFVSGILIAIWGAMRLLGWP* |
| Ga0126377_102399781 | 3300010362 | Tropical Forest Soil | MKFFVDYFKLIDLLALAALAALACAALVRNRSVWLFVAGILVAIWGAMGVMGWP* |
| Ga0126377_108943862 | 3300010362 | Tropical Forest Soil | RLIDLLALLALAVLAFAALRRTGSVWLFVSGILIAIWGAMRLLGWP* |
| Ga0126377_123651292 | 3300010362 | Tropical Forest Soil | MQFFVEYFKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWP* |
| Ga0126379_109733993 | 3300010366 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAALACAALVRNGTVWLSVAGILVAIWGAMRVIGWR* |
| Ga0126379_123438262 | 3300010366 | Tropical Forest Soil | LTNFFVEYFKLIDLLALAALAVLACAALVRNRSVWLFVAGILVAIWGAMRIMGWP* |
| Ga0126383_106470004 | 3300010398 | Tropical Forest Soil | MNFFVQYFKLIDVLALAALAALACAALVRNRSVWLFVAGILVAIWGAMRIMSWP* |
| Ga0126383_111568161 | 3300010398 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRVMGWP* |
| Ga0126383_128656731 | 3300010398 | Tropical Forest Soil | HRRVLMNFFIDYFKLIDILALAALAALACAALVRNKSVWLFVAVILLVIWGATRIMGWP* |
| Ga0154003_10129712 | 3300012081 | Attine Ant Fungus Gardens | MARFLADYFKAIDLLALAALAALACAALVRNRSVWLCIAGLLVAFWGALRVLGWP* |
| Ga0137382_105888211 | 3300012200 | Vadose Zone Soil | MNFFVEYFKLIDLLALAALAALACAALVRNRSVWLFVAGILVAIWGAMRIMGWP* |
| Ga0137358_100362535 | 3300012582 | Vadose Zone Soil | MNSFIEYLKLIDFLALAALAALACAALVRNRSVWLFVAGILLAIGGAMRIAGWP* |
| Ga0137358_101818912 | 3300012582 | Vadose Zone Soil | MNFLVEYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWS* |
| Ga0126375_108040511 | 3300012948 | Tropical Forest Soil | MSFFIEYFKLIDLLALAALAALACAALVRSGTVWLSVAGILVAIWGAMRVLGWP* |
| Ga0126375_111179122 | 3300012948 | Tropical Forest Soil | ILGSSRRCRSAGELNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFLAGILAAIWGTMRVMGWP* |
| Ga0126369_123759051 | 3300012971 | Tropical Forest Soil | MNFFVEYFKLIDLLALAALAALACAAFIRNRSVWLFVAGILVVIWGAMRITGWP* |
| Ga0075313_11001142 | 3300014267 | Natural And Restored Wetlands | MGFIAEYFKLIDLLALAALAALACAALVRSGSVWLFVAGILVAIWGAVRVLGLS* |
| Ga0157379_116863652 | 3300014968 | Switchgrass Rhizosphere | MSTFLIDYFKAIDLLALAGLAALACAALFRNGNVWLFIAGVIVAIWGTMRELGWP* |
| Ga0157376_120516802 | 3300014969 | Miscanthus Rhizosphere | MGLIAEYFRLIDLLALAALAALACAAFVRTRSVWLFVAGICVAIWGAIRVMGFS* |
| Ga0132258_102066896 | 3300015371 | Arabidopsis Rhizosphere | MNFFIEYFKLIDLLALGALAALACAALVRNGSVWLFVAGILVAIWGAMRVIGWP* |
| Ga0132258_120264782 | 3300015371 | Arabidopsis Rhizosphere | MNFLVDYLKLIDLLALIALAALACAALVRNRSVWLFGGNFGGNLGRHADHGLALKWLIA* |
| Ga0182032_101026251 | 3300016357 | Soil | LIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRVMGWP |
| Ga0182040_105029012 | 3300016387 | Soil | DLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRVMGWP |
| Ga0187777_112941091 | 3300017974 | Tropical Peatland | MNFFVEYFKLIDLLALAALAALACAALVRNRSIWLFTAGILVAIWGAMRVMGWP |
| Ga0187766_106069171 | 3300018058 | Tropical Peatland | MNFFIEYFKLIDLLALAALAALASAALVRNGSVWLFVAGILVVIWGAMRVMGWP |
| Ga0066667_101069732 | 3300018433 | Grasslands Soil | MNFLVEYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGAMRIMGWP |
| Ga0066667_123207461 | 3300018433 | Grasslands Soil | MNFFVEYFKLIDLLALAALAVLACAALVRNRSVWLFVAGILVAIWGAMRIMGWP |
| Ga0190270_106819942 | 3300018469 | Soil | MDFIVEYFKLIDLLALAALAALACAALVRSGSVWLFVAGILVAVWGAVRVLGFS |
| Ga0190270_108154231 | 3300018469 | Soil | QDGRAAMGFIAEYFKLIDLLALAALGALACAALVRSGSVWLFVAGILVAIWGAVRVLGLS |
| Ga0210399_114829581 | 3300020581 | Soil | MNFFIEYFKLIDLLALAALAALAFAALVRNGSVWLFVAGILVVIWGAMRVMGWP |
| Ga0210380_100225832 | 3300021082 | Groundwater Sediment | MGLIVEYFRLIDLLALAALVALACAAFVRNRSVWLFVAGISVAIWGTLRAMGLS |
| Ga0210408_112338743 | 3300021178 | Soil | IDLLALAALAALAFAALVRNGSVWLFVAGILVVIWGAIRVMGWP |
| Ga0213874_103539212 | 3300021377 | Plant Roots | MNFLVDYLKLIDLLALAALAALACAALVRNGCVWLFVAVILVAIWGAMRILGWP |
| Ga0126371_100642177 | 3300021560 | Tropical Forest Soil | VNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFLAGILAAIWGTMRVMGWP |
| Ga0126371_108203001 | 3300021560 | Tropical Forest Soil | MNFFIEYFKLIDLLALAALAALACAALVRNGSIWLFVAAILVAIWGAMRVMGWP |
| Ga0126371_121382682 | 3300021560 | Tropical Forest Soil | MNFLIEYFKLIDLLALAALAALACAVLVRNRSVWLFVAGTLVAVWGAMRIMGWP |
| Ga0207708_117397131 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLIAEYFRLIDLLALAALAALACAAFVRNRNVWLFVAGISVAIWGTVRVMGLS |
| Ga0209057_11987441 | 3300026342 | Soil | MNFLVEYLKLIDLLALAALAALACAALVRNRSVWLFVAVILVAIWGRDADHGLALK |
| Ga0209814_100173092 | 3300027873 | Populus Rhizosphere | MNFFVEYFKLIDLLALAALAALACAALVRTGSVWLFVAGILVAIWGAMRIMGWP |
| Ga0209814_104424612 | 3300027873 | Populus Rhizosphere | IDFLALAGLAALACAALIRNGSVWLFVAGILVAIWGTMRVMGWP |
| Ga0209465_101445212 | 3300027874 | Tropical Forest Soil | FKLIDLLALLALAVLAFVALRRTGSVWLFVSGILIAIWGAMRLLGWP |
| Ga0209481_102648561 | 3300027880 | Populus Rhizosphere | MSLMVEYFKLIDLLALAALASLACAALVRNGSVWLFVAGLLVAAWGTMRVVGWP |
| Ga0207428_104201903 | 3300027907 | Populus Rhizosphere | MTTFLVDYFKAIDLLALAGLAALACAALFRSGSVWLFIAGDIVAIWGTMRVLGWP |
| Ga0209382_100056131 | 3300027909 | Populus Rhizosphere | MSFFIDYFKLIDFLALAGLAALACAALIRNGSVWLFVAGILVAIWGTMRVMGWP |
| Ga0268264_112809591 | 3300028381 | Switchgrass Rhizosphere | MSTFLIDYFKAIDLLALAGLAALACAALFRNGNVWLFIAGVIVAIWGTM |
| Ga0247822_105694152 | 3300028592 | Soil | MGFFVEYFKLIDLLALAALAALACAALVRNGSVWLCVAGILVATWGAVRVMGLS |
| Ga0307289_104499341 | 3300028875 | Soil | RRVLMNFFVEYFKLIDLLALAALAVLACAALVRNRSVWLFVAGILVAIWGAMRIMGWP |
| Ga0307278_102849002 | 3300028878 | Soil | KLIDLLALAALAALACAALVRTRSVWLFVAGILVAIWGAMRIMGWP |
| Ga0318541_105665521 | 3300031545 | Soil | MNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRVMGWP |
| Ga0310915_101547381 | 3300031573 | Soil | MNFFIEYFKLIDLLALAALAALACAALVRNGSVWLFVAGILVAIWGAMRVMGW |
| Ga0307468_1008703752 | 3300031740 | Hardwood Forest Soil | MSVVIEYFKLIDFLALLALAVLAFAALRRTGSVWLLVSGVLIAIWGTMRLLGWP |
| Ga0307468_1019808532 | 3300031740 | Hardwood Forest Soil | MSVVVEYFKIIDLLALLALAVLAFAALRRNGSVWLFVSGVLIVIWGAMRIL |
| Ga0306919_103473212 | 3300031879 | Soil | ALAALACAALVRNGSVWLFVAGILVAIWGAMRVMGWP |
| Ga0306920_1013577792 | 3300032261 | Soil | MNFFIEYFKLIDLLALAALAALACAALLRNGNVWLFVAGILVAIWGAMRVMGWP |
| Ga0335077_119893261 | 3300033158 | Soil | MNFFVEYFKLVDLLALGALVALACAALVRNGSVWLFVAGISVAIWGAMRVIGWP |
| ⦗Top⦘ |