| Basic Information | |
|---|---|
| Family ID | F049992 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MTKNKWLVHLAKVRKENPKIKDVAKLAKLAKKTYKK |
| Number of Associated Samples | 53 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 64.79 % |
| % of genes near scaffold ends (potentially truncated) | 5.48 % |
| % of genes from short scaffolds (< 2000 bps) | 68.49 % |
| Associated GOLD sequencing projects | 49 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (82.192 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (39.726 % of family members) |
| Environment Ontology (ENVO) | Unclassified (50.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (49.315 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 35.94% β-sheet: 0.00% Coil/Unstructured: 64.06% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF07460 | NUMOD3 | 5.48 |
| PF13639 | zf-RING_2 | 0.68 |
| PF13692 | Glyco_trans_1_4 | 0.68 |
| PF01972 | SDH_sah | 0.68 |
| PF00145 | DNA_methylase | 0.68 |
| PF07043 | DUF1328 | 0.68 |
| PF04480 | DUF559 | 0.68 |
| PF01145 | Band_7 | 0.68 |
| PF13392 | HNH_3 | 0.68 |
| PF10102 | DUF2341 | 0.68 |
| PF00583 | Acetyltransf_1 | 0.68 |
| PF13489 | Methyltransf_23 | 0.68 |
| PF12323 | HTH_OrfB_IS605 | 0.68 |
| PF01844 | HNH | 0.68 |
| PF16203 | ERCC3_RAD25_C | 0.68 |
| PF02518 | HATPase_c | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0616 | Periplasmic serine protease, ClpP class | Posttranslational modification, protein turnover, chaperones [O] | 1.37 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.68 |
| COG5487 | Uncharacterized membrane protein YtjA, UPF0391 family | Function unknown [S] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 82.19 % |
| All Organisms | root | All Organisms | 17.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 39.73% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 23.29% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 12.33% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 6.85% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.05% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 2.05% |
| Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 2.05% |
| Benthic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Benthic | 1.37% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 1.37% |
| Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.37% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.68% |
| Groundwater | Environmental → Aquatic → Freshwater → Drinking Water → Chlorinated → Groundwater | 0.68% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.68% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001533 | Benthic freshwater microbial communities from British Columbia, Canada | Environmental | Open in IMG/M |
| 3300002223 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2 | Environmental | Open in IMG/M |
| 3300003852 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB | Environmental | Open in IMG/M |
| 3300004239 | Groundwater microbial communities from aquifer - Crystal Geyser CG23_combo_of_CG06-09_8/20/14_all | Environmental | Open in IMG/M |
| 3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009285 | Microbial communities from groundwater in Rifle, Colorado, USA - 2A_0.1um | Environmental | Open in IMG/M |
| 3300009529 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG | Environmental | Open in IMG/M |
| 3300009666 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG | Engineered | Open in IMG/M |
| 3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
| 3300013128 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cm | Environmental | Open in IMG/M |
| 3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
| 3300013138 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_12m | Environmental | Open in IMG/M |
| 3300014204 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaG | Engineered | Open in IMG/M |
| 3300014205 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaG | Engineered | Open in IMG/M |
| 3300014613 | Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300019217 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNNA4_MetaT (Metagenome Metatranscriptome) | Engineered | Open in IMG/M |
| 3300020171 | Groundwater microbial communities from the Olkiluoto Island deep subsurface site, Finland - KR11_0.1 MetaG | Environmental | Open in IMG/M |
| 3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
| 3300024262 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027856 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_23 | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
| 3300028553 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_16m | Environmental | Open in IMG/M |
| 3300029268 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_19m | Environmental | Open in IMG/M |
| 3300031227 | Saline water microbial communities from Ace Lake, Antarctica - #232 | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032173 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_top | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MLSed_101887481 | 3300001533 | Benthic | MANKWLVHLAKVRKANPKIKDVAKLAKLAKKSYRK* |
| MLSed_102285661 | 3300001533 | Benthic | MVCKNPWLKHLAKVRKENPKIKNVAALAKLARKSYRKGGK* |
| C687J26845_101406644 | 3300002223 | Soil | MAGNPWLVHVAKVRKANPKLKFKAILVMAKKSYKKKSYKK* |
| Ga0031655_100943113 | 3300003852 | Freshwater Lake Sediment | MAKTINKWLQHLAKVRKANPKIKDVAKLAKLAKKTYKPAK* |
| Ga0066650_105337102 | 3300004239 | Groundwater | MTKQNSWLVHLAEVRKENPKVKDVGKLAKLAKKTYKPKK* |
| Ga0102851_131053112 | 3300009091 | Freshwater Wetlands | MTKNKWLEHLAEVRKENPKVKDVGKLAKLAKKSYKPNKK* |
| Ga0114918_100316553 | 3300009149 | Deep Subsurface | MAKKNPWMIHLAKVRKANPKIKDVGKIAKLAKKSYKK* |
| Ga0114918_100558715 | 3300009149 | Deep Subsurface | MVKTNPWLVHLAKCRKQNPKIKDIGLIAKLAKKTYKPTKK* |
| Ga0114918_100787105 | 3300009149 | Deep Subsurface | MKTKNKWLIHLAKVRKANPKVKKVSLIAKLAKKSYKK* |
| Ga0114918_100915583 | 3300009149 | Deep Subsurface | MVKTNPWLVHLAKCRKENPKIKNVSLIAKLAKKTYKPVKK* |
| Ga0114918_100949762 | 3300009149 | Deep Subsurface | MKVTTKKKCNPWLVHLKKVRKANPKVTDVGKLAKMAKKTYKPMK* |
| Ga0114918_101392821 | 3300009149 | Deep Subsurface | MAKSKNPWILHLSATRKANPKIKEFAKLAKLAKSTYKPKK* |
| Ga0114918_101629433 | 3300009149 | Deep Subsurface | MAKQNKWLVHLAKVRKENPKVKHVGKLAKLAKKTYKPCHN* |
| Ga0114918_101978983 | 3300009149 | Deep Subsurface | MTNKNPWLEHLAKVRKANPKEKNVGKLAKLAKSTYKKK* |
| Ga0114918_102027182 | 3300009149 | Deep Subsurface | MKTKNPWMIHLAKVRMANPKIKDVGALAKLAKKTYKPIKK* |
| Ga0114918_102797382 | 3300009149 | Deep Subsurface | MKTKNKWLIHLAKVRKANPKIKDVTLIAKLAKKSYTK* |
| Ga0114918_104862742 | 3300009149 | Deep Subsurface | MSSKTNPWLLHLSKVRKENPKIRDVGKIAMMAKKTYAPKK* |
| Ga0114918_107021481 | 3300009149 | Deep Subsurface | NYKEVKMKSKNPWIVHLAKIRKENPKIKDVGKLAKLAKQSYKPKK* |
| Ga0105097_100199337 | 3300009169 | Freshwater Sediment | MVKKHNKWLDHLAKVRKAHPKIKDVAELAKLAKKSYK* |
| Ga0105101_106560542 | 3300009171 | Freshwater Sediment | MVNAWMKHLAQVRKDNPKIKDVVKISKIAKATYKKGK* |
| Ga0103680_101549974 | 3300009285 | Groundwater | MNKWMIHLAKVRRANPKIKNVVELARLAKKTYRA* |
| Ga0114919_100123638 | 3300009529 | Deep Subsurface | MANKWIVHMAKVRKANPKIKDFKALANLAKKTYKK* |
| Ga0114919_1001834413 | 3300009529 | Deep Subsurface | MKSKNPWIAHLAKVRKENPKIKDVAKLAKLAKKSYSPKK* |
| Ga0114919_1002414611 | 3300009529 | Deep Subsurface | MKSKNPWMIHLAKVRKANPKVKNVGELAKLAKKSYKK* |
| Ga0114919_100248066 | 3300009529 | Deep Subsurface | MKTNKWLIHLAQFRKANPKMPVTDIMKNAKKTYKPKGGK* |
| Ga0114919_100424103 | 3300009529 | Deep Subsurface | MKSKNPWIVHLAKVRKENPKIKDVAALAKLAKKSYKPIK* |
| Ga0114919_101124203 | 3300009529 | Deep Subsurface | MVKQNPWLVHLAKCRKENPKIKDVGLIAKLAKKTYKPAKKC* |
| Ga0114919_101477892 | 3300009529 | Deep Subsurface | MKTKNPWMIHLAKVRIANPKIKDVGALAKLAKKTYKPIKK* |
| Ga0114919_102018953 | 3300009529 | Deep Subsurface | MATKKKNPWMVHLAKVRKDNPKIKDVVKLSKMAKKTYKCIK* |
| Ga0114919_102536883 | 3300009529 | Deep Subsurface | MKTQNKWLLHLAKVRKENPKIKDVSQIAKLAKKTYKGGK* |
| Ga0116182_10095173 | 3300009666 | Anaerobic Digestor Sludge | MKSKNPWLEHLAKTRKLNPKVKDVKKLAKLAKATYKKK* |
| (restricted) Ga0172365_102188134 | 3300013127 | Sediment | MKNKWMEHLAKTRKENPKIKDVAKIAKLAKASYKPIKK* |
| (restricted) Ga0172365_105591622 | 3300013127 | Sediment | MKTKNPWMVHLAAVRKANPKIKDVAKIAKLAKSTYKPKK* |
| (restricted) Ga0172366_100374904 | 3300013128 | Sediment | MVKKVNSWIKHLAKVRKENPKIKDVKALAKIAKSTYKIK* |
| (restricted) Ga0172366_105850103 | 3300013128 | Sediment | MKTKNPWLVHLAKIRKENPKIKDVVKLSAIAKKSYKPIK* |
| (restricted) Ga0172366_105883142 | 3300013128 | Sediment | MNAWIKHLLKVRKENPKIKDVKQLAKLAKKTYKK* |
| (restricted) Ga0172363_104835691 | 3300013130 | Sediment | MVTKNPWLTHLAKVRKQNPKIKDFKKLAVLAKKSYK* |
| (restricted) Ga0172371_101246663 | 3300013138 | Freshwater | MTQNKWLQHLAEVRKENPKVKDVSKLAKLAKKTYKPNKK* |
| Ga0172381_100274405 | 3300014204 | Landfill Leachate | MKKVVTKNPWLVHLSKVRKENPKIKDVKTLAKIAKKTYKK* |
| Ga0172381_102383072 | 3300014204 | Landfill Leachate | MTKNKNPWLEHLAVVRKENPKIKDVSKISAIAKKSYKK* |
| Ga0172380_105940394 | 3300014205 | Landfill Leachate | MPSSIIMTKNKNPWLEHLAVVRKENPKIKDVSKISAIAKKSYKK* |
| Ga0180008_12104923 | 3300014613 | Groundwater | MAKVNPWFAHLAKTRKANPKVKDVAKIARLAKKTYKK* |
| Ga0182027_102087366 | 3300014839 | Fen | MAKSNNPWINHLSKVRKDNPKVKDVKKLSQIAKKSYKPVKK* |
| Ga0179946_10732451 | 3300019217 | Anaerobic Digestor Sludge | KNPWLEHLAKTRKLNPKVKDVKKLAKLAKATYKKK |
| Ga0180732_10567313 | 3300020171 | Groundwater | MTKNKWLVHLAKVRKENPKIKDVAKLAKLAKKTYKK |
| (restricted) Ga0233432_104417401 | 3300023109 | Seawater | MNPWFKHLAEVRRANPNIKDVGEIAKLAKKTYQPSG |
| Ga0210003_10244467 | 3300024262 | Deep Subsurface | MVKKNPWLVHLAKCRKENPKIKNVSLIAKLAKKTYKPVKK |
| Ga0210003_10622653 | 3300024262 | Deep Subsurface | MTNKNPWLEHLAKVRKANPKEKNVGKLAKLAKSTYKKK |
| Ga0210003_10803285 | 3300024262 | Deep Subsurface | MKTKNKWLIHLAKVRKANPKVKKVSLIAKLAKKSYKK |
| Ga0210003_10900301 | 3300024262 | Deep Subsurface | TKEVNKYMAKSKNPWILHLSATRKANPKIKNFAKLAKLAKSTYKPKK |
| Ga0210003_10972982 | 3300024262 | Deep Subsurface | MKTKTTKVRKVNPWLKHLAKVRKANPKVKNVGDLCKLAKKSYKK |
| Ga0210003_11712222 | 3300024262 | Deep Subsurface | MAKQNKWLVHLAKVRKENPKVKHVGKLAKLAKKTYKPCHN |
| Ga0210003_12434162 | 3300024262 | Deep Subsurface | MKTKNKWLIHLAKVRKANPKIKDVTLIAKLAKKSYTK |
| Ga0209986_1002335510 | 3300024433 | Deep Subsurface | MATKKKNPWMVHLAKVRKDNPKIKDVVKLSKMAKKTYKCIK |
| Ga0209986_100362656 | 3300024433 | Deep Subsurface | MKSKNPWMIHLAKVRKANPKVKNVGELAKLAKKSYKK |
| Ga0209986_100974433 | 3300024433 | Deep Subsurface | MKTNKWLIHLAQFRKANPKMPVTDIMKNAKKTYKPKGGK |
| Ga0209986_101327433 | 3300024433 | Deep Subsurface | MKSKNPWIAHLAKVRKENPKIKDVAKLAKLAKKSYSPKK |
| Ga0209986_101562694 | 3300024433 | Deep Subsurface | MKTKNPWMIHLAKVRIANPKIKDVGALAKLAKKTYKPIKK |
| Ga0209986_103227613 | 3300024433 | Deep Subsurface | MVKQNPWLVHLAKCRKENPKIKDVGLIAKLAKKTYKPAKKC |
| Ga0209521_102921032 | 3300025164 | Soil | MANKWMQHLAKVRKANPKIKDVGAMSKLAKKTYKK |
| Ga0209492_10083408 | 3300027721 | Freshwater Sediment | MVKKHNKWLDHLAKVRKAHPKIKDVAELAKLAKKSYK |
| (restricted) Ga0255054_104962872 | 3300027856 | Seawater | MKTKNPWMIHLAKVRMANPKIKDVGALAKLAKKTYCPVKK |
| Ga0209450_102224982 | 3300027885 | Freshwater Lake Sediment | MAKSKNPWILHLSATRKANPKIKEFAKLAKLAKSTYKPKK |
| Ga0209777_1000212719 | 3300027896 | Freshwater Lake Sediment | MAKTINKWLQHLAKVRKANPKIKDVAKLAKLAKKTYKPAK |
| Ga0209777_100366264 | 3300027896 | Freshwater Lake Sediment | MKSNSWLIHLAKVRKANPEIKNVAQLARLAKKTYK |
| Ga0209777_100654281 | 3300027896 | Freshwater Lake Sediment | MKTKNAWLVHLAKVRKANPKIKDVGALAKLAKSTYKKK |
| Ga0209777_100678334 | 3300027896 | Freshwater Lake Sediment | MANKWLQHLAKVRKENPKIKDVSKLAKLAKKTYVPIKK |
| Ga0209777_101007756 | 3300027896 | Freshwater Lake Sediment | MKTKNPWMVHLAKVRKANPKIKDVAALAKLAKKTYKPGK |
| Ga0209777_102729915 | 3300027896 | Freshwater Lake Sediment | MANKWLVHLAKVRKANPKIKDVAALAKLAKKTYKPVK |
| Ga0209777_106941413 | 3300027896 | Freshwater Lake Sediment | MVKKKNPWMEHLAKVRKANPKIKDVKLIAKLAKKSYK |
| Ga0209777_109552881 | 3300027896 | Freshwater Lake Sediment | MAQKNPWMVHLAKIRKENPKVKNVGALAKLAKKTYKK |
| (restricted) Ga0247839_11582561 | 3300028553 | Freshwater | LWRLNMVNKWIEHLAKVRKANPTVKDVKKLAKMAKETYKK |
| (restricted) Ga0247842_100126059 | 3300029268 | Freshwater | MVNKWIEHLAKVRKANPTVKDVKKLAKMAKETYKK |
| (restricted) Ga0247842_100977954 | 3300029268 | Freshwater | MAKNPWLIHLAKVRKDNPKIKDVAALAKLAKKSYKK |
| Ga0307928_101446892 | 3300031227 | Saline Water | MANKWFIHLAKVRKANPKIKDIGTLAKLAKKTYKK |
| Ga0307380_101769393 | 3300031539 | Soil | MVKQKQLVKRVNPWMVHLAKVRKANPTIKDITLLAKLAKKSYKK |
| Ga0307380_104590141 | 3300031539 | Soil | MKSKNPWMVHLAKVRKANPKIKNVGELAKLAKKSYKK |
| Ga0307380_105562203 | 3300031539 | Soil | MKEKKTNPWLTHMAKTRKENPKVKDVGKLAKLAKATYKPKK |
| Ga0307380_106334523 | 3300031539 | Soil | MTANKWILHLSKVRKANPKIKDFAKLAKLAKSTYKPIK |
| Ga0307380_107044341 | 3300031539 | Soil | MATKNNWLVHMAKVRKENPKIKNVSILAKLAKKTYKPKTCKP |
| Ga0307380_107946602 | 3300031539 | Soil | MKSKNPWMIHLAKVRMDNPKIKDVGALAKLAKKTYKPIKK |
| Ga0307380_111184112 | 3300031539 | Soil | MKTKNKWLIHLAKVRKANPKVKNVGVLAKLAKKSYKK |
| Ga0307379_104141512 | 3300031565 | Soil | MKTKNKWLVHLAQVRKANPKIKDVGALAKLAKKSYSKK |
| Ga0307379_108448033 | 3300031565 | Soil | MVKQKQLVKRVNPWMVHLAKVRKANPNIKDITLLAKLAKKSYKK |
| Ga0307379_111113111 | 3300031565 | Soil | MSNKNPWLEHLAKVRKANPKEKNVGKLAKLAKSTYKKK |
| Ga0307379_114428532 | 3300031565 | Soil | MKENKWLVHLAKVRKANPKIKDIGKLAKIAKKTYKPIK |
| Ga0307379_114622541 | 3300031565 | Soil | MEMKKKNNPWLVHLAKVRKANPKVKDVGKLAKLAKMTYKPKK |
| Ga0307376_101519792 | 3300031578 | Soil | MKTKNPWMIHLAKVRKDNPKIKDITLLAKLAKKSYKPNK |
| Ga0307376_101775792 | 3300031578 | Soil | MKENKWLVHLAKVRKANPKIKDIGKLAKIARKTYKPIK |
| Ga0307376_108943503 | 3300031578 | Soil | MVKQKQLVKRVNPWMVHLAKVRKANPTIKDITLLAKLAKKTYKK |
| Ga0307376_109166462 | 3300031578 | Soil | MKTKNPWMIHLAKVRKDNPKIKDITLLAKMAKKSYKK |
| Ga0307377_109250172 | 3300031673 | Soil | MANKWLIHLAKVRKANPKIKDIGKMAKLAKKTYKPCK |
| Ga0307377_109481922 | 3300031673 | Soil | MVNKWLVHLAKVRKANPKVKDVAKLAKLAKKTYKK |
| Ga0315291_100497069 | 3300031707 | Sediment | MANKWLLHLAKVRKANPKIKDVAKIAKLAKKSYKK |
| Ga0315291_101334014 | 3300031707 | Sediment | MVVKKTNPWMKHLAQVRKANPKVKDVGKLAKLAKASYKKK |
| Ga0315291_101560962 | 3300031707 | Sediment | MGSSNKWLIHLAKVRKANPQIKDVVKLSKIAKKSYKK |
| Ga0315291_105434872 | 3300031707 | Sediment | MVKKKNPWLVHLAKCRKDNPKVKDVKQLAKLARKSYQAGK |
| Ga0315291_106081981 | 3300031707 | Sediment | MAKQNKWMVHLAKVRKENPKIKNVAMIAKIAKKSYLK |
| Ga0315293_1000027185 | 3300031746 | Sediment | MVVKNKWLEHLAKTRKANPKIKDVGKLAKLAKASYQK |
| Ga0315293_102688522 | 3300031746 | Sediment | MANKWIQHLAQVRKENPKIKNVKEIAKIAKASYSKQVKK |
| Ga0315288_106194762 | 3300031772 | Sediment | MAKNPWLAHMAWVRKQNPKIKDFKKIALIAKKSYKIKVK |
| Ga0315288_108322002 | 3300031772 | Sediment | MVVKKNPWMVHLAKVRKENPKIKDVAKLAKLAKRSYHK |
| Ga0315288_112202382 | 3300031772 | Sediment | MKSNPWLIHLAKTRKANPKIKSVVELSKIAKKTYKK |
| Ga0315297_1000030316 | 3300031873 | Sediment | MTKTNAWLVHLAKVRKANPKLSVVEIAKKASKTYHKK |
| Ga0315297_104063254 | 3300031873 | Sediment | MAKNKWLVHLAAVRKANPKIKDVGALAKLAKKTYKPIKK |
| Ga0315285_100900744 | 3300031885 | Sediment | MAKSKNPWMIHLAAVRKANPKVKDVSALAKLAKKTYKPIK |
| Ga0315285_105869761 | 3300031885 | Sediment | MAKQNKWLIHLAKVRKENPKIKDVGKLAKLAKSSYKK |
| Ga0315285_108654664 | 3300031885 | Sediment | MVKKINPWMVHLAKIRKANPKIKNVGELAKLAKRSYK |
| Ga0315294_101195512 | 3300031952 | Sediment | MAKSTNPWILHLKKIRAANPKIKDVAKLAKLAKATYKPKK |
| Ga0315294_101881492 | 3300031952 | Sediment | MAKKINPWMVHLSKVRKANPGMKVGKLAKLAKSTYKKK |
| Ga0315294_104520591 | 3300031952 | Sediment | MKQNKWLQHLAKCRRENPKIKDVAKIAKLAKKTYKK |
| Ga0315294_105265594 | 3300031952 | Sediment | MVKQSVKNPWLVHLAKVRKANPKIKDFAKLARLAKKSYK |
| Ga0315294_105721002 | 3300031952 | Sediment | MKPNNWLIHLAKIRKQNPKLKISALAKLAKSSYKK |
| Ga0315294_115186091 | 3300031952 | Sediment | MKTQNKWLLHLAKIRRENPKIKDVAQIAKLAKKSYSPKK |
| Ga0315294_115427401 | 3300031952 | Sediment | MTNQNPWIKHLSVVRKQNPTIKDVKKLAKIAKASYKPKK |
| Ga0315274_1000111020 | 3300031999 | Sediment | MVQNKWLLHLKKIRKENPKIKDFAKLAKLAKASYQK |
| Ga0315274_100797553 | 3300031999 | Sediment | MANAWLVHLAKVRKANPKVKDVAALAKLAKKSYKSKK |
| Ga0315274_101579211 | 3300031999 | Sediment | MGSNNPWITHLAKIRKANPKVKDIVKLSKIAKASYKPAIKKK |
| Ga0315274_102125187 | 3300031999 | Sediment | MVKKTNPWLVHLAKCRKDNPKIKDVGKLAKLAKKTYKVK |
| Ga0315274_102877981 | 3300031999 | Sediment | MAKKINPWMVHLAKVRKANPKIKNVSALAKLAKKTYK |
| Ga0315274_104495865 | 3300031999 | Sediment | MAKQNKWMVHLAKVRKENPKIKNVVELSKIAKKSYLK |
| Ga0315274_105232592 | 3300031999 | Sediment | MASTNPWIMHLSKTRAANPKIKDVKILAKMAKATYVGVKKK |
| Ga0315274_105257573 | 3300031999 | Sediment | MGNNAWLNHLAKTRKAHPQVKDVAKLAKLAKKTYKK |
| Ga0315274_109299362 | 3300031999 | Sediment | MKTKFLTKNPWLVHLAKCRKAHPEIKDVAKMAKLAKKTYKK |
| Ga0315289_104421253 | 3300032046 | Sediment | MTKNKWLLHLADVRKAHPKIKDVAKLAKLAKSTYKK |
| Ga0315289_105131312 | 3300032046 | Sediment | MVKQNKWLVHLAKTRKENPKVKDVVKLSKIAKKTYKCAK |
| Ga0315289_111676792 | 3300032046 | Sediment | MANAWLVHLAKTRKANPKVKDIVKLAKIAKASYKK |
| Ga0315289_111994883 | 3300032046 | Sediment | MAKSKNPWIVHLSKIRAQNPKIKDVKTLAKLAKKSYKPKK |
| Ga0315289_113196232 | 3300032046 | Sediment | MAKLNKWLIHLAKVRKANPKIKDVVKLSKIAKASYKK |
| Ga0315289_115572573 | 3300032046 | Sediment | MAKSTNPWILHLKKIRAANPKIKDVAKLAKLAKSTYKPIKK |
| Ga0315284_100136535 | 3300032053 | Sediment | MANKWLVHLAKVRKANPKIKDVAKLAQLAKKSYKPAK |
| Ga0315284_106598973 | 3300032053 | Sediment | YIIANELNGMAKQNPWLVHLAKCRKANPKVKDVAKLAKIAKKTYTPKK |
| Ga0315284_110259972 | 3300032053 | Sediment | MAKKTNPWMVHLSKVRKANPKIKDVGKLAKLAKSTYKKK |
| Ga0315284_113132904 | 3300032053 | Sediment | MIMATKNKWLVHLAQVRKANPKIKDFAALAKIAKKS |
| Ga0315282_103595613 | 3300032069 | Sediment | MANKWQQHLAKTRKANPKIKDVGKISKLAKKTYKK |
| Ga0315277_113297362 | 3300032118 | Sediment | MVTKINPWIAHLGKVRKANPTIKDVKILAKMAKKTYLK |
| Ga0315295_109762152 | 3300032156 | Sediment | MTNPWLVHLAKVRKQHPNIKDVKKISIIAKKTYKK |
| Ga0315268_107349263 | 3300032173 | Sediment | MAKKKNAWMVHLAATRKANPKLGVAAAAKKAKSSYKPAPKK |
| Ga0315275_100399363 | 3300032401 | Sediment | MVVKKTNPWMTHLAKVRKANPKIKDVGKLAKLAKKTYKA |
| Ga0315273_102195155 | 3300032516 | Sediment | MAKQNAWLIHLAKCRKLHPKIKDVGKIAKLAKATYKKK |
| Ga0315273_102589593 | 3300032516 | Sediment | MANNPWLVHLAKVRKANPKIKDFAKLAKIAKKTYK |
| Ga0315273_103076263 | 3300032516 | Sediment | MAKQNKWLVHLAKVRKENPKCKDVAKLAKLAKKTYKV |
| Ga0315273_105638373 | 3300032516 | Sediment | MAKTNPWMVHLAKVRKANPKIKDFAELAKIAKKSYSK |
| Ga0315273_110510394 | 3300032516 | Sediment | MAKQNKWMIHLAKVRKENPKIKSVALISKIAKKSYLK |
| Ga0334722_112466983 | 3300033233 | Sediment | MTKNKWLIHLAQTRKENPKIKDVSILAKLAKKSYKK |
| Ga0326726_112862813 | 3300033433 | Peat Soil | MTQNKWLQHLAETRKENPKVKDVAKIAALAKKTYKKK |
| ⦗Top⦘ |