Metagenome / Metatranscriptome Family F049973

Overview

Basic Information

• Family ID: F049973
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 146
• Average Sequence Length: 38 residues
• Representative Sequence: MNGLQIVLMVIAVNACVLGVAFFALYQFNKAVSQSGR
• Number of Associated Samples: 105
• Number of Associated Scaffolds: 146

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 85.62 %
• % of genes near scaffold ends (potentially truncated): 10.96 %
• % of genes from short scaffolds (< 2000 bps): 76.71 %
• Associated GOLD sequencing projects: 98
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (93.836 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.288 % of family members)
• Environment Ontology (ENVO): Unclassified (36.986 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (59.589 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 52.31%
  β-sheet: 0.00%
  Coil/Unstructured: 47.69%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 146 Family Scaffolds
PF12796	Ank_2	9.59
PF07586	HXXSHH	2.05
PF07637	PSD5	1.37
PF13578	Methyltransf_24	1.37
PF02518	HATPase_c	0.68
PF00512	HisKA	0.68
PF00115	COX1	0.68
PF01425	Amidase	0.68
PF00753	Lactamase_B	0.68
PF01717	Meth_synt_2	0.68
PF07746	LigA	0.68
PF13857	Ank_5	0.68
PF07631	PSD4	0.68
PF00300	His_Phos_1	0.68
PF04226	Transgly_assoc	0.68
PF13606	Ank_3	0.68
PF03401	TctC	0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 146 Family Scaffolds
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.68
COG0620	Methionine synthase II (cobalamin-independent)	Amino acid transport and metabolism [E]	0.68
COG2261	Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family	General function prediction only [R]	0.68
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.68

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	93.84 %
Unclassified	root	N/A	6.16 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	93.84 %
Unclassified	root	N/A	6.16 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	93.84 %
Unclassified	root	N/A	6.16 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	52.05 %
Unclassified	root	N/A	6.16 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.68 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	43.15 %
Unclassified	root	N/A	6.16 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.05 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.68 %

Level 6

Name	Rank	Taxonomy	Distribution
unclassified Alphaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria	37.67 %
Unclassified	root	N/A	6.16 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.05 %
Alteromonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales	0.68 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.68 %

Level 7

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	37.67 %
Unclassified	root	N/A	6.16 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.05 %
Alteromonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae	0.68 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.68 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300001593|JGI12635J15846_10471158	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	745
3300002245|JGIcombinedJ26739_100907504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	763
3300002914|JGI25617J43924_10304537	All Organisms → cellular organisms → Bacteria → Proteobacteria	549
3300004633|Ga0066395_10099449	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1399
3300004633|Ga0066395_10772599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	575
3300005531|Ga0070738_10008611	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	9755
3300005533|Ga0070734_10002783	All Organisms → cellular organisms → Bacteria	20001
3300005542|Ga0070732_10964791	Not Available	521
3300005764|Ga0066903_100012830	All Organisms → cellular organisms → Bacteria	8264
3300005764|Ga0066903_100084316	All Organisms → cellular organisms → Bacteria	4173
3300005764|Ga0066903_100128231	All Organisms → cellular organisms → Bacteria → Proteobacteria	3556
3300005764|Ga0066903_100286200	All Organisms → cellular organisms → Bacteria	2590
3300005764|Ga0066903_104382998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	754
3300005764|Ga0066903_107949972	All Organisms → cellular organisms → Bacteria	544
3300006041|Ga0075023_100220636	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	742
3300006047|Ga0075024_100354273	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	734
3300006047|Ga0075024_100356561	All Organisms → cellular organisms → Bacteria → Proteobacteria	732
3300006047|Ga0075024_100531526	Not Available	621
3300006052|Ga0075029_100404275	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae	888
3300006086|Ga0075019_10333230	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	919
3300006163|Ga0070715_10098547	All Organisms → cellular organisms → Bacteria	1359
3300007255|Ga0099791_10000643	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	13041
3300007258|Ga0099793_10508957	All Organisms → cellular organisms → Bacteria	599
3300007788|Ga0099795_10009152	All Organisms → cellular organisms → Bacteria	2861
3300009038|Ga0099829_10120949	All Organisms → cellular organisms → Bacteria → Proteobacteria	2061
3300009038|Ga0099829_10294155	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1330
3300009088|Ga0099830_10509078	All Organisms → cellular organisms → Bacteria	983
3300009143|Ga0099792_10223438	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1083
3300009521|Ga0116222_1191554	All Organisms → cellular organisms → Bacteria	880
3300009633|Ga0116129_1003809	All Organisms → cellular organisms → Bacteria	7114
3300009792|Ga0126374_10452659	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	912
3300009824|Ga0116219_10286603	All Organisms → cellular organisms → Bacteria → Proteobacteria	930
3300009826|Ga0123355_10986352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	897
3300010043|Ga0126380_10165085	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1439
3300010043|Ga0126380_10529473	All Organisms → cellular organisms → Bacteria	912
3300010043|Ga0126380_10713678	Not Available	808
3300010046|Ga0126384_10025179	All Organisms → cellular organisms → Bacteria	3884
3300010046|Ga0126384_12491996	All Organisms → cellular organisms → Bacteria	502
3300010047|Ga0126382_10176385	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1495
3300010048|Ga0126373_10110814	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2553
3300010048|Ga0126373_12394666	Not Available	588
3300010159|Ga0099796_10056884	All Organisms → cellular organisms → Bacteria	1374
3300010162|Ga0131853_10890101	All Organisms → cellular organisms → Bacteria	701
3300010358|Ga0126370_10206600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1489
3300010358|Ga0126370_10299827	All Organisms → cellular organisms → Bacteria	1274
3300010358|Ga0126370_10337774	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1212
3300010358|Ga0126370_12057626	Not Available	559
3300010359|Ga0126376_10590715	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1048
3300010359|Ga0126376_11139393	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	791
3300010359|Ga0126376_11554428	All Organisms → cellular organisms → Bacteria	692
3300010360|Ga0126372_10026514	All Organisms → cellular organisms → Bacteria	3545
3300010360|Ga0126372_10570951	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1079
3300010360|Ga0126372_10915121	All Organisms → cellular organisms → Bacteria	881
3300010360|Ga0126372_10956859	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	864
3300010361|Ga0126378_10560205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1257
3300010366|Ga0126379_11077910	All Organisms → cellular organisms → Bacteria	909
3300010366|Ga0126379_12166806	Not Available	657
3300010376|Ga0126381_100448069	All Organisms → cellular organisms → Bacteria	1810
3300010398|Ga0126383_11641246	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	732
3300010398|Ga0126383_11703172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	719
3300011269|Ga0137392_10208533	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1600
3300011270|Ga0137391_10178938	All Organisms → cellular organisms → Bacteria	1848
3300011271|Ga0137393_10723524	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	852
3300011271|Ga0137393_11631623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	534
3300012199|Ga0137383_10087248	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2258
3300012202|Ga0137363_10091108	All Organisms → cellular organisms → Bacteria	2295
3300012202|Ga0137363_10362598	All Organisms → cellular organisms → Bacteria	1201
3300012203|Ga0137399_10727341	All Organisms → cellular organisms → Bacteria	835
3300012205|Ga0137362_10035624	All Organisms → cellular organisms → Bacteria	3974
3300012205|Ga0137362_11370357	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	593
3300012359|Ga0137385_10833497	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	765
3300012361|Ga0137360_10858821	All Organisms → cellular organisms → Bacteria	782
3300012362|Ga0137361_10863717	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	822
3300012363|Ga0137390_10372551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1408
3300012917|Ga0137395_10060100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	2422
3300012917|Ga0137395_10420855	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	958
3300012923|Ga0137359_11194036	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	649
3300012925|Ga0137419_10826238	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	759
3300012971|Ga0126369_10056334	All Organisms → cellular organisms → Bacteria	3383
3300014838|Ga0182030_10951513	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	762
3300015053|Ga0137405_1372341	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1295
3300016341|Ga0182035_11702775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	570
3300017934|Ga0187803_10121476	All Organisms → cellular organisms → Bacteria	1026
3300017943|Ga0187819_10289846	All Organisms → cellular organisms → Bacteria	953
3300017970|Ga0187783_10037147	All Organisms → cellular organisms → Bacteria → Proteobacteria	3610
3300017970|Ga0187783_10092906	All Organisms → cellular organisms → Bacteria	2223
3300017970|Ga0187783_10123737	All Organisms → cellular organisms → Bacteria	1906
3300017970|Ga0187783_10767539	All Organisms → cellular organisms → Bacteria	695
3300017970|Ga0187783_11279918	All Organisms → cellular organisms → Bacteria	528
3300017975|Ga0187782_11106354	All Organisms → cellular organisms → Bacteria	618
3300020170|Ga0179594_10151103	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	859
3300020199|Ga0179592_10106002	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1291
3300020580|Ga0210403_10585445	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	902
3300020580|Ga0210403_10919800	All Organisms → cellular organisms → Bacteria	689
3300020581|Ga0210399_10384673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1171
3300021178|Ga0210408_10706288	All Organisms → cellular organisms → Bacteria	794
3300021178|Ga0210408_11411042	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	524
3300021404|Ga0210389_10054785	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	3057
3300021420|Ga0210394_10073579	All Organisms → cellular organisms → Bacteria	2958
3300021476|Ga0187846_10167142	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	928
3300021560|Ga0126371_10129578	All Organisms → cellular organisms → Bacteria	2560
3300021560|Ga0126371_11540883	All Organisms → cellular organisms → Bacteria	792
3300021861|Ga0213853_10796642	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	637
3300022532|Ga0242655_10114139	All Organisms → cellular organisms → Bacteria	757
3300022533|Ga0242662_10172229	All Organisms → cellular organisms → Bacteria	667
3300022722|Ga0242657_1178448	Not Available	575
3300025463|Ga0208193_1026677	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1472
3300026304|Ga0209240_1120208	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	899
3300026304|Ga0209240_1198542	All Organisms → cellular organisms → Bacteria	606
3300026341|Ga0257151_1000224	All Organisms → cellular organisms → Bacteria	4027
3300026358|Ga0257166_1014051	All Organisms → cellular organisms → Bacteria	1017
3300026467|Ga0257154_1011123	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1238
3300026551|Ga0209648_10148634	All Organisms → cellular organisms → Bacteria → Proteobacteria	1853
3300026551|Ga0209648_10207738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1487
3300027587|Ga0209220_1104046	All Organisms → cellular organisms → Bacteria	744
3300027654|Ga0209799_1030920	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1187
3300027671|Ga0209588_1003882	All Organisms → cellular organisms → Bacteria	4176
3300027674|Ga0209118_1047522	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1275
3300027773|Ga0209810_1017612	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	4845
3300027826|Ga0209060_10001551	All Organisms → cellular organisms → Bacteria	24653
3300027874|Ga0209465_10002789	All Organisms → cellular organisms → Bacteria	7656
3300027874|Ga0209465_10662181	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	514
3300027875|Ga0209283_10926777	All Organisms → cellular organisms → Bacteria	525
3300027894|Ga0209068_10606979	Not Available	637
3300027903|Ga0209488_10061125	All Organisms → cellular organisms → Bacteria	2784
3300027903|Ga0209488_10118512	All Organisms → cellular organisms → Bacteria → Proteobacteria	1991
3300027905|Ga0209415_10349001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1233
3300027911|Ga0209698_10059730	All Organisms → cellular organisms → Bacteria	3299
3300027915|Ga0209069_10357702	All Organisms → cellular organisms → Bacteria	790
3300027915|Ga0209069_10662360	Not Available	609
3300028047|Ga0209526_10064926	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	2569
3300028047|Ga0209526_10206124	All Organisms → cellular organisms → Bacteria	1360
3300028047|Ga0209526_10841428	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	564
3300028536|Ga0137415_10479655	All Organisms → cellular organisms → Bacteria	1051
3300028773|Ga0302234_10235560	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	789
3300029943|Ga0311340_10054793	All Organisms → cellular organisms → Bacteria	4679
3300030740|Ga0265460_10196471	All Organisms → cellular organisms → Bacteria	1181
3300031231|Ga0170824_112267343	All Organisms → cellular organisms → Bacteria	1041
3300031681|Ga0318572_10297817	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	953
3300031708|Ga0310686_104738057	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	4808
3300031720|Ga0307469_10148501	All Organisms → cellular organisms → Bacteria → Proteobacteria	1750
3300031890|Ga0306925_10648467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1110
3300032001|Ga0306922_12224261	All Organisms → cellular organisms → Bacteria	528
3300032160|Ga0311301_10215077	All Organisms → cellular organisms → Bacteria → Proteobacteria	3256
3300032261|Ga0306920_100885954	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	1306
3300032892|Ga0335081_10977481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium	989

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	98.63%
Host-Associated	Host-Associated	1.37%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	88.36%
Aquatic	Environmental → Aquatic	10.27%
Arthropoda	Host-Associated → Arthropoda	1.37%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	86.30%
Sediment	Environmental → Aquatic → Sediment	6.85%
Freshwater	Environmental → Aquatic → Freshwater	3.42%
Peat	Environmental → Terrestrial → Peat	1.37%
Digestive System	Host-Associated → Arthropoda → Digestive System	1.37%
Cave	Environmental → Terrestrial → Cave	0.68%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	67.81%
Loam	Environmental → Terrestrial → Soil → Loam	13.01%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	6.85%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.48%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	2.74%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	1.37%
Gut	Host-Associated → Arthropoda → Digestive System → Gut	1.37%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.68%
Unclassified	Environmental → Terrestrial → Cave → Unclassified	0.68%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	50.00%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	14.38%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	12.33%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	6.85%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	4.79%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	3.42%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	1.37%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	1.37%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	1.37%
Unclassified	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified	1.37%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.68%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	0.68%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.68%
Unclassified	Environmental → Terrestrial → Cave → Unclassified → Unclassified	0.68%

Habitat

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	23.29%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	19.86%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	10.27%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	7.53%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	6.85%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	4.79%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.11%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	3.42%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	3.42%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	2.74%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.74%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	1.37%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	1.37%
Palsa	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa	1.37%
Termite Gut	Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut	1.37%
Watersheds	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.68%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	0.68%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.68%
Bog	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog	0.68%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.68%
Biofilm	Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm	0.68%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental
3300002245	Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)	Environmental
3300002914	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm	Environmental
3300004633	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio	Environmental
3300005531	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2	Environmental
3300005533	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1	Environmental
3300005542	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental
3300006052	Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013	Environmental
3300006086	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013	Environmental
3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Environmental
3300007255	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1	Environmental
3300007258	Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3	Environmental
3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Environmental
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental
3300009521	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG	Environmental
3300009633	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10	Environmental
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental
3300009824	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG	Environmental
3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Host-Associated
3300010043	Tropical forest soil microbial communities from Panama - MetaG Plot_26	Environmental
3300010046	Tropical forest soil microbial communities from Panama - MetaG Plot_36	Environmental
3300010047	Tropical forest soil microbial communities from Panama - MetaG Plot_30	Environmental
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental
3300010162	Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2)	Host-Associated
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental
3300010361	Tropical forest soil microbial communities from Panama - MetaG Plot_23	Environmental
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental
3300011271	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG	Environmental
3300012199	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG	Environmental
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012203	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG	Environmental
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental
3300012359	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG	Environmental
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental
3300012363	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG	Environmental
3300012917	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300014838	Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)	Environmental
3300015053	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction)	Environmental
3300016341	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170	Environmental
3300017934	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3	Environmental
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental
3300017970	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG	Environmental
3300017975	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG	Environmental
3300020170	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)	Environmental
3300020199	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)	Environmental
3300020580	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M	Environmental
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental
3300021404	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O	Environmental
3300021420	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M	Environmental
3300021476	Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)	Environmental
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental
3300021861	Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)	Environmental
3300022532	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)	Environmental
3300022533	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)	Environmental
3300022722	Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)	Environmental
3300025463	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes)	Environmental
3300026304	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)	Environmental
3300026341	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A	Environmental
3300026358	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B	Environmental
3300026467	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A	Environmental
3300026551	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)	Environmental
3300027587	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)	Environmental
3300027654	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)	Environmental
3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)	Environmental
3300027674	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)	Environmental
3300027773	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)	Environmental
3300027826	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)	Environmental
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental
3300027875	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)	Environmental
3300027894	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)	Environmental
3300027903	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)	Environmental
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental
3300027911	Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)	Environmental
3300027915	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)	Environmental
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental
3300028773	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2	Environmental
3300029943	I_Palsa_N3 coassembly	Environmental
3300030740	Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031681	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20	Environmental
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental
3300032892	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12635J15846_104711582	3300001593	Forest Soil	MSEFQIVLVVIAVNACVLGIAFFAAYRFNKAVSQSGR*
JGIcombinedJ26739_1009075041	3300002245	Forest Soil	MNGFQMFLLVIVVNACVLGVGLLAVYQFNKAVSGCGR*
JGI25617J43924_103045372	3300002914	Grasslands Soil	LIGGCPMNGLQIILMVVAVNAIVLGVAFFAVYQFNKAVSQSGR*
Ga0066395_100994492	3300004633	Tropical Forest Soil	LIEEGCPMNGLQIVLMVIAVNASVLGVAFFVSYQFNKAVSQSGR*
Ga0066395_107725991	3300004633	Tropical Forest Soil	LIGEGCPMNGLQIVLMIIGVNASVLGIAFFAVYQFNKAVSRSGR*
Ga0070738_100086112	3300005531	Surface Soil	MHGLEIVLMAIVTNACVLGLAFFTVYQFNKAVSQSGR*
Ga0070734_100027833	3300005533	Surface Soil	MNGLQVLLAVVATNAFVLGAAFLTVYHFNKLVSRSGR*
Ga0070732_109647911	3300005542	Surface Soil	MNGLQVVLMVIALNACVLGVAFFAIYQFNKAVSQSGR*
Ga0066903_1000128305	3300005764	Tropical Forest Soil	MQGVQMLLAIIAVNASVLGVAFFALYQFNKAVRGCGR*
Ga0066903_1000843162	3300005764	Tropical Forest Soil	MQGFQMLLTVIAVNACVLGVAFFALYQFNKAVRGCGR*
Ga0066903_1001282312	3300005764	Tropical Forest Soil	MNGLQIVLMIIGVNASVLGIAFFAVYQFNKAVSRSGR*
Ga0066903_1002862004	3300005764	Tropical Forest Soil	MNGLQIVLMIIGVNACVLGIAFFTVFQFNKAVSRSGR*
Ga0066903_1043829982	3300005764	Tropical Forest Soil	MSGLHVVLMVVAVNAFVLGVAFFALYQFNKAVSRGGH*
Ga0066903_1079499722	3300005764	Tropical Forest Soil	LIEEGCPMNGLQIVLMVIAVNAGVLGVAFFVSYQFNKAVSQSGR*
Ga0075023_1002206362	3300006041	Watersheds	MDELQMLLAVIAVNASVLGVAFLVLYQFNKAVSGCGR*
Ga0075024_1003542732	3300006047	Watersheds	MSGLQMLLAVIGVNAGVLGVAFFAIYRFDKAVRRSGR*
Ga0075024_1003565612	3300006047	Watersheds	MQGFQILMLVIAVASCVLGVAFLGAYQLNKAVDQCDR*
Ga0075024_1005315262	3300006047	Watersheds	MDELQLLLATIAVNASVLGLAFLVLYQFNKAVSGCGR*
Ga0075029_1004042752	3300006052	Watersheds	MNGFQELLLAIAVNACVLGVALFAIYRFNKNVSGCGR*
Ga0075019_103332303	3300006086	Watersheds	MNGFQILMATLAVNAIVLGAAFLVIYQFNKAVSQCGR*
Ga0070715_100985472	3300006163	Corn, Switchgrass And Miscanthus Rhizosphere	MNGFQMLLTVVAVNASVLSVVFFALYQFNKAVTQSGR*
Ga0099791_100006434	3300007255	Vadose Zone Soil	MNELQIVLMVVAVNAIVLGVAFFAVYQFNKAVSQSGR*
Ga0099793_105089571	3300007258	Vadose Zone Soil	MNALQIVLMVVAVNACVLGVAFFALYQFNKAVGQSGR*
Ga0099795_100091524	3300007788	Vadose Zone Soil	MNGLQIILMVVGVNACVLGVAFFALYQFNKAVSQSGR*
Ga0099829_101209493	3300009038	Vadose Zone Soil	MSGLQIVMMIIAVNACVLGAAVFAFYQFNKAVSQSGR*
Ga0099829_102941552	3300009038	Vadose Zone Soil	MSGLQIVMMVIAVNACVLGAAVFALYQFNKAVSQSGR*
Ga0099830_105090782	3300009088	Vadose Zone Soil	LIGKGCPMNGLQIILMVVGVNACVLGVAFFALYQFNKAVSQSGR*
Ga0099792_102234382	3300009143	Vadose Zone Soil	MNALQIVLMVVAVNACVLGVAFFALYQFNKAVSQSGR*
Ga0116222_11915542	3300009521	Peatlands Soil	MNGFQMLLLVIAVNACVLGVGLLAVYQFNKAVRPCGR*
Ga0116129_10038095	3300009633	Peatland	MAMNGFHMLLMVIAVNACVLGVASFALYQFNKAVRHCGR*
Ga0126374_104526592	3300009792	Tropical Forest Soil	MNGLQIVLMVIAVNAIVLGIAFFAVYQFNKAVSQSGR*
Ga0116219_102866032	3300009824	Peatlands Soil	MQGFQILLLVIAVASCVLGVAFLGAYQLNKAVDQCDR*
Ga0123355_109863521	3300009826	Termite Gut	MNGLEIVLLVIAVNACVLGAAFFAVYQLNSAVSQSGR*
Ga0126380_101650852	3300010043	Tropical Forest Soil	MQGFQMLLTVIAVNACVLGVAFFALYLFNKAVRGCGR*
Ga0126380_105294732	3300010043	Tropical Forest Soil	MNGVQVVLMVIALNVCILGIAFFAVYQFNKAVSQSGR*
Ga0126380_107136783	3300010043	Tropical Forest Soil	MGGLQMLLMVIAVNAFVLGLAFLALYQANKAVSQCGR*
Ga0126384_100251793	3300010046	Tropical Forest Soil	MNGLQIVLMVIAVNAGVLGVAFFVSYQFNKAVSQSGR*
Ga0126384_124919962	3300010046	Tropical Forest Soil	NGLDVVLMVIAVNASVLGVAFVALYQFNKAVSRAGR*
Ga0126382_101763852	3300010047	Tropical Forest Soil	MGGLQMLLMVIAVNAFVLGVAFLALYQSNKAVSQCGR*
Ga0126373_101108143	3300010048	Tropical Forest Soil	MNGLQVVLMVIALNACVLGIAFFAVYQFNKAVSQSGR*
Ga0126373_123946662	3300010048	Tropical Forest Soil	GGCPMNGLDVVLMVIVVNASVLGVAFFALYQFNGAVSRAGR*
Ga0099796_100568842	3300010159	Vadose Zone Soil	MNGLQIVLMVVAVNASVLGVAFFVLYQFNKAVGQSGR*
Ga0131853_108901011	3300010162	Termite Gut	PQVVLMVIAVNACVLGVAFFAVYQFNKAVSQSGR*
Ga0126370_102066002	3300010358	Tropical Forest Soil	MNGLQIVLMIIGVNACVLGIAFFSVFQFNKAVSRSGR*
Ga0126370_102998272	3300010358	Tropical Forest Soil	MNGLQILLAVLAVNASVLGVAVFALYQFNKAVSRTGR*
Ga0126370_103377742	3300010358	Tropical Forest Soil	MNGLQIVLMVIAVNASVLGVAFFVSYQFNKAVSQSGR*
Ga0126370_120576262	3300010358	Tropical Forest Soil	MNGLDVVLMVIVVNASVLGVAFIVVYLFNRAVSRAGR*
Ga0126376_105907151	3300010359	Tropical Forest Soil	MNGLQIVLMIIGVNACVLGIAFFAVYQFNKAVSQSGR*
Ga0126376_111393931	3300010359	Tropical Forest Soil	MNGLQIVLMIIGVNACVLGIAFFTVFQFNKAVSQSGR*
Ga0126376_115544282	3300010359	Tropical Forest Soil	NGLQILLAVLVVNAGVLGVAVFALYQFNKAVSRTGR*
Ga0126372_100265144	3300010360	Tropical Forest Soil	MGGLQMLLMVIAVNAGVLGVAFFALYQFNKAVSQCGR*
Ga0126372_105709512	3300010360	Tropical Forest Soil	MNGLQILLAVLVVNAGVLGVAVFALYQFNKAVNRT
Ga0126372_109151212	3300010360	Tropical Forest Soil	LIEEGCPMNVLQIVLMVIAVNASVLGVAFFVSYQFNKAVSQSGR*
Ga0126372_109568592	3300010360	Tropical Forest Soil	MNGLQIVLMIIGVNASVLGIAFFAVYQFNKAVSQSGR*
Ga0126378_105602052	3300010361	Tropical Forest Soil	MQGFQMLLTVIAVNACVLGLAFFALYQFNKAVRGCGR*
Ga0126379_110779102	3300010366	Tropical Forest Soil	MNGLQIVLMVIAVNACVLGVAFFALYQFNKAVSQSGR*
Ga0126379_121668062	3300010366	Tropical Forest Soil	MAGFQTLLAVLVVNACVLGVAFFALYQFNKAVSGCGR*
Ga0126381_1004480691	3300010376	Tropical Forest Soil	EGCPMNGLQIVLMVIAVNASVLGVAFFVSYQFNKAVSQSGR*
Ga0126383_116412461	3300010398	Tropical Forest Soil	MNGLDVVLMVIAVNASVLGVAFVALYQFNKAVSRAGR*
Ga0126383_117031722	3300010398	Tropical Forest Soil	MNGLQIVLMIIGVNACVLGIAFFAVFQFNKAVSQSGR*
Ga0137392_102085332	3300011269	Vadose Zone Soil	MNGLQIVLMVVAVNACVLGVAFFAVYQFNKAVSQSGR*
Ga0137391_101789383	3300011270	Vadose Zone Soil	MSTFQMLLAVIAVNACVLGVAFFALYLFNKAVSQSGR*
Ga0137393_107235242	3300011271	Vadose Zone Soil	MNGLQIVLMVVAVNAFVLGVAFFAVYQFNKAVSQSGR*
Ga0137393_116316231	3300011271	Vadose Zone Soil	MNGLQMFQMLLAVIAVNACVLGVAFFALYQFNKAVSPSGR*
Ga0137383_100872483	3300012199	Vadose Zone Soil	MNGLQILLVVVAVNACVLGVAFFAAYQFNKAVSRSGR*
Ga0137363_100911083	3300012202	Vadose Zone Soil	MNELQIVLMVVAVNAVVLGVAFFAVYQFNKVVSQSGR*
Ga0137363_103625982	3300012202	Vadose Zone Soil	MSGLQIIMMIIAVNACVLGAAVFALYQFNKAVSQSGR*
Ga0137399_107273412	3300012203	Vadose Zone Soil	MNGLQIILMVVGVNACVLGVAFFAVYQFNKAVSQSGR*
Ga0137362_100356244	3300012205	Vadose Zone Soil	MNGLQIVLMVVAVNAVVLGVAFFAVYQFNKAVSQSGR*
Ga0137362_113703572	3300012205	Vadose Zone Soil	MNGLQILLVVVAVNACVLGVAFFAAYQFNKAVSRCDR*
Ga0137385_108334972	3300012359	Vadose Zone Soil	MNGLQILLVVVAVNAGVLGVAFFAAYQFNKAVSRSGR*
Ga0137360_108588212	3300012361	Vadose Zone Soil	MSTFQMLLAVIAVNACVLGIAFFALYLFNKAVSQSGR*
Ga0137361_108637172	3300012362	Vadose Zone Soil	MNGLQIVLMVVAVNVGVLGVAFFALYQFNKAVSQSGR*
Ga0137390_103725512	3300012363	Vadose Zone Soil	MSTFQMLLAVIAVNACVLGAAFFALYLFNKAVSQSGR*
Ga0137395_100601003	3300012917	Vadose Zone Soil	MNGFQMLLVIVATNACVLGVALFVLHQFNKAVSRCGR*
Ga0137395_104208551	3300012917	Vadose Zone Soil	MNGLQIVLMVVAVNACVLGVAFFALYQFNKAVGQSGR*
Ga0137359_111940361	3300012923	Vadose Zone Soil	MNGFQMFQMLLAVIAVNACVLGVAFFALYQLNKAVSPSGR*
Ga0137419_108262381	3300012925	Vadose Zone Soil	MNGLQIVLMVVVVNACVLGVAFFAVYQFNKAVSQSGR*
Ga0126369_100563343	3300012971	Tropical Forest Soil	MSSFQMILVVIATNACVLGVAFLALYQLNKAVSECGR*
Ga0182030_109515132	3300014838	Bog	LIGERRRMDEFQVFVAVLAINACVLGVALFAVYQFNKVVSRCGR*
Ga0137405_13723414	3300015053	Vadose Zone Soil	MDGFQILLVVIAVNGCVLGVAFFALYQLNKAVSRCGR*
Ga0182035_117027752	3300016341	Soil	MSGFQILLVVVAVNITVLGIAFLALYQLNRTVGGRGL
Ga0187803_101214762	3300017934	Freshwater Sediment	MNGFQMLLMVIAVNACVLGVAFFVLYQFNKAVSRCGR
Ga0187819_102898462	3300017943	Freshwater Sediment	MNGFQILLAAIAVNAGVLGIAFLALYQLNKAVSPCGR
Ga0187783_100371477	3300017970	Tropical Peatland	MSGFQILVVVVAVNITVLGIALLALYQLNKTVGGRGL
Ga0187783_100929062	3300017970	Tropical Peatland	MDGIQTILAVIAVNVCVLGIALFAVYEFNKAVRQSGR
Ga0187783_101237373	3300017970	Tropical Peatland	MNGLQIVLMVIAINAGVLGVAFFAVYQFNKAVSQSGR
Ga0187783_107675391	3300017970	Tropical Peatland	MNGLQIVLMIIAINAIVLGVAFFAVYRFNKAVSQSGR
Ga0187783_112799182	3300017970	Tropical Peatland	MAEFQTVLVVIAVCAGVLGIAFFATYEFNKAVRPSGR
Ga0187782_111063541	3300017975	Tropical Peatland	SDQGRGVLMNGLQIVLMSIAINAIVLGVAFFAVYQFNKAVSQSGR
Ga0179594_101511032	3300020170	Vadose Zone Soil	MNELQIVLMVVAVNAIVLGVAFFAVYQFNKAVSQSGR
Ga0179592_101060022	3300020199	Vadose Zone Soil	MNGLQIILMVVGVNACVLGVAFFALYQFNKAVSQSGR
Ga0210403_105854452	3300020580	Soil	MNGFQMLLTVVAVNASVLGVVFFALYQFNKAVTQSGR
Ga0210403_109198002	3300020580	Soil	EGCPMNGFQMLLTVVAVNASVLGVVFFALYQFNKAVTQSGR
Ga0210399_103846732	3300020581	Soil	MNGFQMLLTVVAVNACVLGVVFFALYQFNKAVSQSGR
Ga0210408_107062882	3300021178	Soil	MNGVQTFQMLLAVIAVNACVLGVAFFASYQFNKAVSRSGR
Ga0210408_114110422	3300021178	Soil	MNGFQMFQMLLAIIAVNAGVLGVAFLALYQFNKAVSRSGR
Ga0210389_100547854	3300021404	Soil	MNGLQVVLMVVALNACVLGAAFFAVYQFNKAVSQSGR
Ga0210394_100735791	3300021420	Soil	RWPMNGFQMFLLVIVVNACVLGVGLLAVYQFNKAVSGCGR
Ga0187846_101671422	3300021476	Biofilm	MNGLQIVLMVIAVNAVVLGVVFFASYQFNKAVSQSGR
Ga0126371_101295783	3300021560	Tropical Forest Soil	MQGVQMLLAIIAVNASVLGVAFFALYQFNKAVRGCGR
Ga0126371_115408832	3300021560	Tropical Forest Soil	MNGLQILLAVLVVNAGVLGVAVFALYQFNKAVSRAGR
Ga0213853_107966422	3300021861	Watersheds	MDELQMLLAVIAVNASVLGVAFLVLYQFNKAVSGCGR
Ga0242655_101141391	3300022532	Soil	WLMSGIQIVLVVIAVNAGVLGVALLIAYQFNKAVSGSGR
Ga0242662_101722291	3300022533	Soil	PMNGLQILLMVVVVNAFVLGAAFFALYQFNKAVSQSGR
Ga0242657_11784482	3300022722	Soil	MNGFQMLLLVIVVNAFVRGVGLLAVYQFNKAVRPCGR
Ga0208193_10266772	3300025463	Peatland	MNGFHMLLMVIAVNACVLGVASFALYQFNKAVRHCGR
Ga0209240_11202082	3300026304	Grasslands Soil	MNGLQIILMVVAVNAIVLGVALFAVYQFNKAVSQSGR
Ga0209240_11985422	3300026304	Grasslands Soil	MNALQIVLMVVAVNACVLGVAFFALYQFNKAVSQSGR
Ga0257151_10002244	3300026341	Soil	MNGFQMFQMLLAIIAVNACVLGVAFLALYQFNKAVSPSGR
Ga0257166_10140512	3300026358	Soil	LIGKGCPMNGLQIILMVVGVNACVLGVAFFALYQFNKAVSQSGR
Ga0257154_10111232	3300026467	Soil	MNGFQMFQMLLAIIAVNACVLGVAFFALYQLNKAVSPSGR
Ga0209648_101486342	3300026551	Grasslands Soil	MNGFQILLAVIAVNACVLGVAFLALYQLDKAVSRCGR
Ga0209648_102077381	3300026551	Grasslands Soil	MNGLQIILMVVAVNAIVLGVAFFAVYQFNKAVSQSGR
Ga0209220_11040462	3300027587	Forest Soil	MSEFQIVLVVIAVNVCVLGIAFFAAYRFNKAVSQSGR
Ga0209799_10309202	3300027654	Tropical Forest Soil	MNGLQIVLMVIAVNAGVLGVAFFVSYQFNKAVSQSGR
Ga0209588_10038821	3300027671	Vadose Zone Soil	TIFDWGCPMNELQIVLMVVAVNAIVLGVAFFAVYQFNKAVSQSGR
Ga0209118_10475222	3300027674	Forest Soil	MSEFQIVLVVIAVNACVLGIAFFAAYRFNKAVSQSGR
Ga0209810_10176125	3300027773	Surface Soil	MHGLEIVLMAIVTNACVLGLAFFTVYQFNKAVSQSGR
Ga0209060_1000155120	3300027826	Surface Soil	MNGLQVLLAVVATNAFVLGAAFLTVYHFNKLVSRSGR
Ga0209465_100027895	3300027874	Tropical Forest Soil	MSSFQMILVVIATNACVLGVAFLALYQLNKAVSECGR
Ga0209465_106621812	3300027874	Tropical Forest Soil	MNGLQIVLMIIGVNASVLGIAFFAVYQFNKAVSRSGR
Ga0209283_109267771	3300027875	Vadose Zone Soil	GKGCPMNGLQIILMVVGVNACVLGVAFFALYQFNKAVSQSGR
Ga0209068_106069792	3300027894	Watersheds	MNGFQMLLMIVAVNACVLGVAFLALYQFNKAVSQSGR
Ga0209488_100611254	3300027903	Vadose Zone Soil	MGKGCLMSGLQIVMMVIAVNACVLGAAFFALYQFNKAVSQSGR
Ga0209488_101185122	3300027903	Vadose Zone Soil	MSGLQIVMMIIAVNACVLGAAFFALYQFNKAVSQSGR
Ga0209415_103490012	3300027905	Peatlands Soil	MNGFQMLLLVIAVNACVLGVGLLAVYQFNKAVRPCGR
Ga0209698_100597302	3300027911	Watersheds	MNGFQILMATLAVNAIVLGAAFLVIYQFNKAVSQCGR
Ga0209069_103577022	3300027915	Watersheds	MSGLQMLLAVIGVNAGVLGVAFFAIYRFDKAVRRSGR
Ga0209069_106623602	3300027915	Watersheds	MDELQLLLATIAVNASVLGVAFLVLYQFNKAVSGCGR
Ga0209526_100649262	3300028047	Forest Soil	MSEFQIVLVVIAVNACVLGVAFFAAYRFNKAVSQSGR
Ga0209526_102061243	3300028047	Forest Soil	MNGFQMFQMLLAIIAVNACVLGVAFLALYQFNKAVSRSGR
Ga0209526_108414282	3300028047	Forest Soil	MNGFQVFQMLLSIIAVNACVLGVAFFALYQFNKSVSRSGR
Ga0137415_104796552	3300028536	Vadose Zone Soil	MSTFQMLLAVIAVNACVLGVAFFALYLFNKAVSQSGR
Ga0302234_102355602	3300028773	Palsa	LIGERRRMDEFQVFVAVLAINACVLGVALFAVYQFNKVVSRCGR
Ga0311340_100547934	3300029943	Palsa	MDEFQVFVAVLAINACVLGVALFAVYQFNKVVSRCGR
Ga0265460_101964712	3300030740	Soil	VNEAQIVLAVIVVNAFVLGIAIMVLYQFNKAVSQSGS
Ga0170824_1122673432	3300031231	Forest Soil	MNGFQMLLLVIVVNAFVLGVGLLAVYQFNNAVKPCGR
Ga0318572_102978172	3300031681	Soil	MQGFQMLLTVIAVNACVLGVAFFALYQFNKAVRGCGR
Ga0310686_1047380572	3300031708	Soil	MNGFHMLLMVVAVNACVLGVASFALYQFNKAVRRCGR
Ga0307469_101485012	3300031720	Hardwood Forest Soil	MGGLQMLLTVIAVNASVLGVAFFALYQFNKAVSQCGR
Ga0306925_106484672	3300031890	Soil	MSGFQILLVVVATNAVVLGIAFLALYQFNKAVSSCGR
Ga0306922_122242612	3300032001	Soil	NGLQIILMIIGVNASVLGIAFFAVYQFNKAVSQSGR
Ga0311301_102150774	3300032160	Peatlands Soil	MQGFQILLLVIAVASCVLGVAFLGAYQLNKAVDQCDR
Ga0306920_1008859542	3300032261	Soil	MNGLQIVLMIIGVNASVLGIAFFAVYQFNKAVSQSGR
Ga0335081_109774812	3300032892	Soil	MNAFQELVTVLAVDACVLGVAIFALYQLNRGVSRCGR