| Basic Information | |
|---|---|
| Family ID | F049973 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MNGLQIVLMVIAVNACVLGVAFFALYQFNKAVSQSGR |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.62 % |
| % of genes near scaffold ends (potentially truncated) | 10.96 % |
| % of genes from short scaffolds (< 2000 bps) | 76.71 % |
| Associated GOLD sequencing projects | 98 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.836 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.288 % of family members) |
| Environment Ontology (ENVO) | Unclassified (36.986 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.589 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 52.31% β-sheet: 0.00% Coil/Unstructured: 47.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF12796 | Ank_2 | 9.59 |
| PF07586 | HXXSHH | 2.05 |
| PF07637 | PSD5 | 1.37 |
| PF13578 | Methyltransf_24 | 1.37 |
| PF02518 | HATPase_c | 0.68 |
| PF00512 | HisKA | 0.68 |
| PF00115 | COX1 | 0.68 |
| PF01425 | Amidase | 0.68 |
| PF00753 | Lactamase_B | 0.68 |
| PF01717 | Meth_synt_2 | 0.68 |
| PF07746 | LigA | 0.68 |
| PF13857 | Ank_5 | 0.68 |
| PF07631 | PSD4 | 0.68 |
| PF00300 | His_Phos_1 | 0.68 |
| PF04226 | Transgly_assoc | 0.68 |
| PF13606 | Ank_3 | 0.68 |
| PF03401 | TctC | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.68 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.68 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.84 % |
| Unclassified | root | N/A | 6.16 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10471158 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100907504 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 763 | Open in IMG/M |
| 3300002914|JGI25617J43924_10304537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 549 | Open in IMG/M |
| 3300004633|Ga0066395_10099449 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1399 | Open in IMG/M |
| 3300004633|Ga0066395_10772599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
| 3300005531|Ga0070738_10008611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 9755 | Open in IMG/M |
| 3300005533|Ga0070734_10002783 | All Organisms → cellular organisms → Bacteria | 20001 | Open in IMG/M |
| 3300005542|Ga0070732_10964791 | Not Available | 521 | Open in IMG/M |
| 3300005764|Ga0066903_100012830 | All Organisms → cellular organisms → Bacteria | 8264 | Open in IMG/M |
| 3300005764|Ga0066903_100084316 | All Organisms → cellular organisms → Bacteria | 4173 | Open in IMG/M |
| 3300005764|Ga0066903_100128231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3556 | Open in IMG/M |
| 3300005764|Ga0066903_100286200 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300005764|Ga0066903_104382998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300005764|Ga0066903_107949972 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300006041|Ga0075023_100220636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 742 | Open in IMG/M |
| 3300006047|Ga0075024_100354273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 734 | Open in IMG/M |
| 3300006047|Ga0075024_100356561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
| 3300006047|Ga0075024_100531526 | Not Available | 621 | Open in IMG/M |
| 3300006052|Ga0075029_100404275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae | 888 | Open in IMG/M |
| 3300006086|Ga0075019_10333230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 919 | Open in IMG/M |
| 3300006163|Ga0070715_10098547 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300007255|Ga0099791_10000643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 13041 | Open in IMG/M |
| 3300007258|Ga0099793_10508957 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300007788|Ga0099795_10009152 | All Organisms → cellular organisms → Bacteria | 2861 | Open in IMG/M |
| 3300009038|Ga0099829_10120949 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2061 | Open in IMG/M |
| 3300009038|Ga0099829_10294155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1330 | Open in IMG/M |
| 3300009088|Ga0099830_10509078 | All Organisms → cellular organisms → Bacteria | 983 | Open in IMG/M |
| 3300009143|Ga0099792_10223438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1083 | Open in IMG/M |
| 3300009521|Ga0116222_1191554 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
| 3300009633|Ga0116129_1003809 | All Organisms → cellular organisms → Bacteria | 7114 | Open in IMG/M |
| 3300009792|Ga0126374_10452659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 912 | Open in IMG/M |
| 3300009824|Ga0116219_10286603 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 930 | Open in IMG/M |
| 3300009826|Ga0123355_10986352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 897 | Open in IMG/M |
| 3300010043|Ga0126380_10165085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1439 | Open in IMG/M |
| 3300010043|Ga0126380_10529473 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300010043|Ga0126380_10713678 | Not Available | 808 | Open in IMG/M |
| 3300010046|Ga0126384_10025179 | All Organisms → cellular organisms → Bacteria | 3884 | Open in IMG/M |
| 3300010046|Ga0126384_12491996 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010047|Ga0126382_10176385 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1495 | Open in IMG/M |
| 3300010048|Ga0126373_10110814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2553 | Open in IMG/M |
| 3300010048|Ga0126373_12394666 | Not Available | 588 | Open in IMG/M |
| 3300010159|Ga0099796_10056884 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300010162|Ga0131853_10890101 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300010358|Ga0126370_10206600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1489 | Open in IMG/M |
| 3300010358|Ga0126370_10299827 | All Organisms → cellular organisms → Bacteria | 1274 | Open in IMG/M |
| 3300010358|Ga0126370_10337774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1212 | Open in IMG/M |
| 3300010358|Ga0126370_12057626 | Not Available | 559 | Open in IMG/M |
| 3300010359|Ga0126376_10590715 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1048 | Open in IMG/M |
| 3300010359|Ga0126376_11139393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300010359|Ga0126376_11554428 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300010360|Ga0126372_10026514 | All Organisms → cellular organisms → Bacteria | 3545 | Open in IMG/M |
| 3300010360|Ga0126372_10570951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1079 | Open in IMG/M |
| 3300010360|Ga0126372_10915121 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300010360|Ga0126372_10956859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 864 | Open in IMG/M |
| 3300010361|Ga0126378_10560205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1257 | Open in IMG/M |
| 3300010366|Ga0126379_11077910 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
| 3300010366|Ga0126379_12166806 | Not Available | 657 | Open in IMG/M |
| 3300010376|Ga0126381_100448069 | All Organisms → cellular organisms → Bacteria | 1810 | Open in IMG/M |
| 3300010398|Ga0126383_11641246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300010398|Ga0126383_11703172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 719 | Open in IMG/M |
| 3300011269|Ga0137392_10208533 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1600 | Open in IMG/M |
| 3300011270|Ga0137391_10178938 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300011271|Ga0137393_10723524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 852 | Open in IMG/M |
| 3300011271|Ga0137393_11631623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 534 | Open in IMG/M |
| 3300012199|Ga0137383_10087248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2258 | Open in IMG/M |
| 3300012202|Ga0137363_10091108 | All Organisms → cellular organisms → Bacteria | 2295 | Open in IMG/M |
| 3300012202|Ga0137363_10362598 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300012203|Ga0137399_10727341 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300012205|Ga0137362_10035624 | All Organisms → cellular organisms → Bacteria | 3974 | Open in IMG/M |
| 3300012205|Ga0137362_11370357 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
| 3300012359|Ga0137385_10833497 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300012361|Ga0137360_10858821 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300012362|Ga0137361_10863717 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 822 | Open in IMG/M |
| 3300012363|Ga0137390_10372551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1408 | Open in IMG/M |
| 3300012917|Ga0137395_10060100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2422 | Open in IMG/M |
| 3300012917|Ga0137395_10420855 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 958 | Open in IMG/M |
| 3300012923|Ga0137359_11194036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 649 | Open in IMG/M |
| 3300012925|Ga0137419_10826238 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 759 | Open in IMG/M |
| 3300012971|Ga0126369_10056334 | All Organisms → cellular organisms → Bacteria | 3383 | Open in IMG/M |
| 3300014838|Ga0182030_10951513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 762 | Open in IMG/M |
| 3300015053|Ga0137405_1372341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1295 | Open in IMG/M |
| 3300016341|Ga0182035_11702775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
| 3300017934|Ga0187803_10121476 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300017943|Ga0187819_10289846 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300017970|Ga0187783_10037147 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3610 | Open in IMG/M |
| 3300017970|Ga0187783_10092906 | All Organisms → cellular organisms → Bacteria | 2223 | Open in IMG/M |
| 3300017970|Ga0187783_10123737 | All Organisms → cellular organisms → Bacteria | 1906 | Open in IMG/M |
| 3300017970|Ga0187783_10767539 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300017970|Ga0187783_11279918 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300017975|Ga0187782_11106354 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300020170|Ga0179594_10151103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 859 | Open in IMG/M |
| 3300020199|Ga0179592_10106002 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1291 | Open in IMG/M |
| 3300020580|Ga0210403_10585445 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 902 | Open in IMG/M |
| 3300020580|Ga0210403_10919800 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300020581|Ga0210399_10384673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1171 | Open in IMG/M |
| 3300021178|Ga0210408_10706288 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300021178|Ga0210408_11411042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300021404|Ga0210389_10054785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3057 | Open in IMG/M |
| 3300021420|Ga0210394_10073579 | All Organisms → cellular organisms → Bacteria | 2958 | Open in IMG/M |
| 3300021476|Ga0187846_10167142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 928 | Open in IMG/M |
| 3300021560|Ga0126371_10129578 | All Organisms → cellular organisms → Bacteria | 2560 | Open in IMG/M |
| 3300021560|Ga0126371_11540883 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300021861|Ga0213853_10796642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 637 | Open in IMG/M |
| 3300022532|Ga0242655_10114139 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300022533|Ga0242662_10172229 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300022722|Ga0242657_1178448 | Not Available | 575 | Open in IMG/M |
| 3300025463|Ga0208193_1026677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1472 | Open in IMG/M |
| 3300026304|Ga0209240_1120208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 899 | Open in IMG/M |
| 3300026304|Ga0209240_1198542 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300026341|Ga0257151_1000224 | All Organisms → cellular organisms → Bacteria | 4027 | Open in IMG/M |
| 3300026358|Ga0257166_1014051 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300026467|Ga0257154_1011123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1238 | Open in IMG/M |
| 3300026551|Ga0209648_10148634 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1853 | Open in IMG/M |
| 3300026551|Ga0209648_10207738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1487 | Open in IMG/M |
| 3300027587|Ga0209220_1104046 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300027654|Ga0209799_1030920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1187 | Open in IMG/M |
| 3300027671|Ga0209588_1003882 | All Organisms → cellular organisms → Bacteria | 4176 | Open in IMG/M |
| 3300027674|Ga0209118_1047522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1275 | Open in IMG/M |
| 3300027773|Ga0209810_1017612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4845 | Open in IMG/M |
| 3300027826|Ga0209060_10001551 | All Organisms → cellular organisms → Bacteria | 24653 | Open in IMG/M |
| 3300027874|Ga0209465_10002789 | All Organisms → cellular organisms → Bacteria | 7656 | Open in IMG/M |
| 3300027874|Ga0209465_10662181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
| 3300027875|Ga0209283_10926777 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300027894|Ga0209068_10606979 | Not Available | 637 | Open in IMG/M |
| 3300027903|Ga0209488_10061125 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
| 3300027903|Ga0209488_10118512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1991 | Open in IMG/M |
| 3300027905|Ga0209415_10349001 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1233 | Open in IMG/M |
| 3300027911|Ga0209698_10059730 | All Organisms → cellular organisms → Bacteria | 3299 | Open in IMG/M |
| 3300027915|Ga0209069_10357702 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300027915|Ga0209069_10662360 | Not Available | 609 | Open in IMG/M |
| 3300028047|Ga0209526_10064926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2569 | Open in IMG/M |
| 3300028047|Ga0209526_10206124 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300028047|Ga0209526_10841428 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 564 | Open in IMG/M |
| 3300028536|Ga0137415_10479655 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300028773|Ga0302234_10235560 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300029943|Ga0311340_10054793 | All Organisms → cellular organisms → Bacteria | 4679 | Open in IMG/M |
| 3300030740|Ga0265460_10196471 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300031231|Ga0170824_112267343 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300031681|Ga0318572_10297817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 953 | Open in IMG/M |
| 3300031708|Ga0310686_104738057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 4808 | Open in IMG/M |
| 3300031720|Ga0307469_10148501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1750 | Open in IMG/M |
| 3300031890|Ga0306925_10648467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1110 | Open in IMG/M |
| 3300032001|Ga0306922_12224261 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300032160|Ga0311301_10215077 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3256 | Open in IMG/M |
| 3300032261|Ga0306920_100885954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1306 | Open in IMG/M |
| 3300032892|Ga0335081_10977481 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 989 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.29% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 19.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.27% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 7.53% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.79% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.11% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.74% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.37% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.37% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.37% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.68% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026341 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A | Environmental | Open in IMG/M |
| 3300026358 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030740 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ARE Co-assembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_104711582 | 3300001593 | Forest Soil | MSEFQIVLVVIAVNACVLGIAFFAAYRFNKAVSQSGR* |
| JGIcombinedJ26739_1009075041 | 3300002245 | Forest Soil | MNGFQMFLLVIVVNACVLGVGLLAVYQFNKAVSGCGR* |
| JGI25617J43924_103045372 | 3300002914 | Grasslands Soil | LIGGCPMNGLQIILMVVAVNAIVLGVAFFAVYQFNKAVSQSGR* |
| Ga0066395_100994492 | 3300004633 | Tropical Forest Soil | LIEEGCPMNGLQIVLMVIAVNASVLGVAFFVSYQFNKAVSQSGR* |
| Ga0066395_107725991 | 3300004633 | Tropical Forest Soil | LIGEGCPMNGLQIVLMIIGVNASVLGIAFFAVYQFNKAVSRSGR* |
| Ga0070738_100086112 | 3300005531 | Surface Soil | MHGLEIVLMAIVTNACVLGLAFFTVYQFNKAVSQSGR* |
| Ga0070734_100027833 | 3300005533 | Surface Soil | MNGLQVLLAVVATNAFVLGAAFLTVYHFNKLVSRSGR* |
| Ga0070732_109647911 | 3300005542 | Surface Soil | MNGLQVVLMVIALNACVLGVAFFAIYQFNKAVSQSGR* |
| Ga0066903_1000128305 | 3300005764 | Tropical Forest Soil | MQGVQMLLAIIAVNASVLGVAFFALYQFNKAVRGCGR* |
| Ga0066903_1000843162 | 3300005764 | Tropical Forest Soil | MQGFQMLLTVIAVNACVLGVAFFALYQFNKAVRGCGR* |
| Ga0066903_1001282312 | 3300005764 | Tropical Forest Soil | MNGLQIVLMIIGVNASVLGIAFFAVYQFNKAVSRSGR* |
| Ga0066903_1002862004 | 3300005764 | Tropical Forest Soil | MNGLQIVLMIIGVNACVLGIAFFTVFQFNKAVSRSGR* |
| Ga0066903_1043829982 | 3300005764 | Tropical Forest Soil | MSGLHVVLMVVAVNAFVLGVAFFALYQFNKAVSRGGH* |
| Ga0066903_1079499722 | 3300005764 | Tropical Forest Soil | LIEEGCPMNGLQIVLMVIAVNAGVLGVAFFVSYQFNKAVSQSGR* |
| Ga0075023_1002206362 | 3300006041 | Watersheds | MDELQMLLAVIAVNASVLGVAFLVLYQFNKAVSGCGR* |
| Ga0075024_1003542732 | 3300006047 | Watersheds | MSGLQMLLAVIGVNAGVLGVAFFAIYRFDKAVRRSGR* |
| Ga0075024_1003565612 | 3300006047 | Watersheds | MQGFQILMLVIAVASCVLGVAFLGAYQLNKAVDQCDR* |
| Ga0075024_1005315262 | 3300006047 | Watersheds | MDELQLLLATIAVNASVLGLAFLVLYQFNKAVSGCGR* |
| Ga0075029_1004042752 | 3300006052 | Watersheds | MNGFQELLLAIAVNACVLGVALFAIYRFNKNVSGCGR* |
| Ga0075019_103332303 | 3300006086 | Watersheds | MNGFQILMATLAVNAIVLGAAFLVIYQFNKAVSQCGR* |
| Ga0070715_100985472 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MNGFQMLLTVVAVNASVLSVVFFALYQFNKAVTQSGR* |
| Ga0099791_100006434 | 3300007255 | Vadose Zone Soil | MNELQIVLMVVAVNAIVLGVAFFAVYQFNKAVSQSGR* |
| Ga0099793_105089571 | 3300007258 | Vadose Zone Soil | MNALQIVLMVVAVNACVLGVAFFALYQFNKAVGQSGR* |
| Ga0099795_100091524 | 3300007788 | Vadose Zone Soil | MNGLQIILMVVGVNACVLGVAFFALYQFNKAVSQSGR* |
| Ga0099829_101209493 | 3300009038 | Vadose Zone Soil | MSGLQIVMMIIAVNACVLGAAVFAFYQFNKAVSQSGR* |
| Ga0099829_102941552 | 3300009038 | Vadose Zone Soil | MSGLQIVMMVIAVNACVLGAAVFALYQFNKAVSQSGR* |
| Ga0099830_105090782 | 3300009088 | Vadose Zone Soil | LIGKGCPMNGLQIILMVVGVNACVLGVAFFALYQFNKAVSQSGR* |
| Ga0099792_102234382 | 3300009143 | Vadose Zone Soil | MNALQIVLMVVAVNACVLGVAFFALYQFNKAVSQSGR* |
| Ga0116222_11915542 | 3300009521 | Peatlands Soil | MNGFQMLLLVIAVNACVLGVGLLAVYQFNKAVRPCGR* |
| Ga0116129_10038095 | 3300009633 | Peatland | MAMNGFHMLLMVIAVNACVLGVASFALYQFNKAVRHCGR* |
| Ga0126374_104526592 | 3300009792 | Tropical Forest Soil | MNGLQIVLMVIAVNAIVLGIAFFAVYQFNKAVSQSGR* |
| Ga0116219_102866032 | 3300009824 | Peatlands Soil | MQGFQILLLVIAVASCVLGVAFLGAYQLNKAVDQCDR* |
| Ga0123355_109863521 | 3300009826 | Termite Gut | MNGLEIVLLVIAVNACVLGAAFFAVYQLNSAVSQSGR* |
| Ga0126380_101650852 | 3300010043 | Tropical Forest Soil | MQGFQMLLTVIAVNACVLGVAFFALYLFNKAVRGCGR* |
| Ga0126380_105294732 | 3300010043 | Tropical Forest Soil | MNGVQVVLMVIALNVCILGIAFFAVYQFNKAVSQSGR* |
| Ga0126380_107136783 | 3300010043 | Tropical Forest Soil | MGGLQMLLMVIAVNAFVLGLAFLALYQANKAVSQCGR* |
| Ga0126384_100251793 | 3300010046 | Tropical Forest Soil | MNGLQIVLMVIAVNAGVLGVAFFVSYQFNKAVSQSGR* |
| Ga0126384_124919962 | 3300010046 | Tropical Forest Soil | NGLDVVLMVIAVNASVLGVAFVALYQFNKAVSRAGR* |
| Ga0126382_101763852 | 3300010047 | Tropical Forest Soil | MGGLQMLLMVIAVNAFVLGVAFLALYQSNKAVSQCGR* |
| Ga0126373_101108143 | 3300010048 | Tropical Forest Soil | MNGLQVVLMVIALNACVLGIAFFAVYQFNKAVSQSGR* |
| Ga0126373_123946662 | 3300010048 | Tropical Forest Soil | GGCPMNGLDVVLMVIVVNASVLGVAFFALYQFNGAVSRAGR* |
| Ga0099796_100568842 | 3300010159 | Vadose Zone Soil | MNGLQIVLMVVAVNASVLGVAFFVLYQFNKAVGQSGR* |
| Ga0131853_108901011 | 3300010162 | Termite Gut | PQVVLMVIAVNACVLGVAFFAVYQFNKAVSQSGR* |
| Ga0126370_102066002 | 3300010358 | Tropical Forest Soil | MNGLQIVLMIIGVNACVLGIAFFSVFQFNKAVSRSGR* |
| Ga0126370_102998272 | 3300010358 | Tropical Forest Soil | MNGLQILLAVLAVNASVLGVAVFALYQFNKAVSRTGR* |
| Ga0126370_103377742 | 3300010358 | Tropical Forest Soil | MNGLQIVLMVIAVNASVLGVAFFVSYQFNKAVSQSGR* |
| Ga0126370_120576262 | 3300010358 | Tropical Forest Soil | MNGLDVVLMVIVVNASVLGVAFIVVYLFNRAVSRAGR* |
| Ga0126376_105907151 | 3300010359 | Tropical Forest Soil | MNGLQIVLMIIGVNACVLGIAFFAVYQFNKAVSQSGR* |
| Ga0126376_111393931 | 3300010359 | Tropical Forest Soil | MNGLQIVLMIIGVNACVLGIAFFTVFQFNKAVSQSGR* |
| Ga0126376_115544282 | 3300010359 | Tropical Forest Soil | NGLQILLAVLVVNAGVLGVAVFALYQFNKAVSRTGR* |
| Ga0126372_100265144 | 3300010360 | Tropical Forest Soil | MGGLQMLLMVIAVNAGVLGVAFFALYQFNKAVSQCGR* |
| Ga0126372_105709512 | 3300010360 | Tropical Forest Soil | MNGLQILLAVLVVNAGVLGVAVFALYQFNKAVNRT |
| Ga0126372_109151212 | 3300010360 | Tropical Forest Soil | LIEEGCPMNVLQIVLMVIAVNASVLGVAFFVSYQFNKAVSQSGR* |
| Ga0126372_109568592 | 3300010360 | Tropical Forest Soil | MNGLQIVLMIIGVNASVLGIAFFAVYQFNKAVSQSGR* |
| Ga0126378_105602052 | 3300010361 | Tropical Forest Soil | MQGFQMLLTVIAVNACVLGLAFFALYQFNKAVRGCGR* |
| Ga0126379_110779102 | 3300010366 | Tropical Forest Soil | MNGLQIVLMVIAVNACVLGVAFFALYQFNKAVSQSGR* |
| Ga0126379_121668062 | 3300010366 | Tropical Forest Soil | MAGFQTLLAVLVVNACVLGVAFFALYQFNKAVSGCGR* |
| Ga0126381_1004480691 | 3300010376 | Tropical Forest Soil | EGCPMNGLQIVLMVIAVNASVLGVAFFVSYQFNKAVSQSGR* |
| Ga0126383_116412461 | 3300010398 | Tropical Forest Soil | MNGLDVVLMVIAVNASVLGVAFVALYQFNKAVSRAGR* |
| Ga0126383_117031722 | 3300010398 | Tropical Forest Soil | MNGLQIVLMIIGVNACVLGIAFFAVFQFNKAVSQSGR* |
| Ga0137392_102085332 | 3300011269 | Vadose Zone Soil | MNGLQIVLMVVAVNACVLGVAFFAVYQFNKAVSQSGR* |
| Ga0137391_101789383 | 3300011270 | Vadose Zone Soil | MSTFQMLLAVIAVNACVLGVAFFALYLFNKAVSQSGR* |
| Ga0137393_107235242 | 3300011271 | Vadose Zone Soil | MNGLQIVLMVVAVNAFVLGVAFFAVYQFNKAVSQSGR* |
| Ga0137393_116316231 | 3300011271 | Vadose Zone Soil | MNGLQMFQMLLAVIAVNACVLGVAFFALYQFNKAVSPSGR* |
| Ga0137383_100872483 | 3300012199 | Vadose Zone Soil | MNGLQILLVVVAVNACVLGVAFFAAYQFNKAVSRSGR* |
| Ga0137363_100911083 | 3300012202 | Vadose Zone Soil | MNELQIVLMVVAVNAVVLGVAFFAVYQFNKVVSQSGR* |
| Ga0137363_103625982 | 3300012202 | Vadose Zone Soil | MSGLQIIMMIIAVNACVLGAAVFALYQFNKAVSQSGR* |
| Ga0137399_107273412 | 3300012203 | Vadose Zone Soil | MNGLQIILMVVGVNACVLGVAFFAVYQFNKAVSQSGR* |
| Ga0137362_100356244 | 3300012205 | Vadose Zone Soil | MNGLQIVLMVVAVNAVVLGVAFFAVYQFNKAVSQSGR* |
| Ga0137362_113703572 | 3300012205 | Vadose Zone Soil | MNGLQILLVVVAVNACVLGVAFFAAYQFNKAVSRCDR* |
| Ga0137385_108334972 | 3300012359 | Vadose Zone Soil | MNGLQILLVVVAVNAGVLGVAFFAAYQFNKAVSRSGR* |
| Ga0137360_108588212 | 3300012361 | Vadose Zone Soil | MSTFQMLLAVIAVNACVLGIAFFALYLFNKAVSQSGR* |
| Ga0137361_108637172 | 3300012362 | Vadose Zone Soil | MNGLQIVLMVVAVNVGVLGVAFFALYQFNKAVSQSGR* |
| Ga0137390_103725512 | 3300012363 | Vadose Zone Soil | MSTFQMLLAVIAVNACVLGAAFFALYLFNKAVSQSGR* |
| Ga0137395_100601003 | 3300012917 | Vadose Zone Soil | MNGFQMLLVIVATNACVLGVALFVLHQFNKAVSRCGR* |
| Ga0137395_104208551 | 3300012917 | Vadose Zone Soil | MNGLQIVLMVVAVNACVLGVAFFALYQFNKAVGQSGR* |
| Ga0137359_111940361 | 3300012923 | Vadose Zone Soil | MNGFQMFQMLLAVIAVNACVLGVAFFALYQLNKAVSPSGR* |
| Ga0137419_108262381 | 3300012925 | Vadose Zone Soil | MNGLQIVLMVVVVNACVLGVAFFAVYQFNKAVSQSGR* |
| Ga0126369_100563343 | 3300012971 | Tropical Forest Soil | MSSFQMILVVIATNACVLGVAFLALYQLNKAVSECGR* |
| Ga0182030_109515132 | 3300014838 | Bog | LIGERRRMDEFQVFVAVLAINACVLGVALFAVYQFNKVVSRCGR* |
| Ga0137405_13723414 | 3300015053 | Vadose Zone Soil | MDGFQILLVVIAVNGCVLGVAFFALYQLNKAVSRCGR* |
| Ga0182035_117027752 | 3300016341 | Soil | MSGFQILLVVVAVNITVLGIAFLALYQLNRTVGGRGL |
| Ga0187803_101214762 | 3300017934 | Freshwater Sediment | MNGFQMLLMVIAVNACVLGVAFFVLYQFNKAVSRCGR |
| Ga0187819_102898462 | 3300017943 | Freshwater Sediment | MNGFQILLAAIAVNAGVLGIAFLALYQLNKAVSPCGR |
| Ga0187783_100371477 | 3300017970 | Tropical Peatland | MSGFQILVVVVAVNITVLGIALLALYQLNKTVGGRGL |
| Ga0187783_100929062 | 3300017970 | Tropical Peatland | MDGIQTILAVIAVNVCVLGIALFAVYEFNKAVRQSGR |
| Ga0187783_101237373 | 3300017970 | Tropical Peatland | MNGLQIVLMVIAINAGVLGVAFFAVYQFNKAVSQSGR |
| Ga0187783_107675391 | 3300017970 | Tropical Peatland | MNGLQIVLMIIAINAIVLGVAFFAVYRFNKAVSQSGR |
| Ga0187783_112799182 | 3300017970 | Tropical Peatland | MAEFQTVLVVIAVCAGVLGIAFFATYEFNKAVRPSGR |
| Ga0187782_111063541 | 3300017975 | Tropical Peatland | SDQGRGVLMNGLQIVLMSIAINAIVLGVAFFAVYQFNKAVSQSGR |
| Ga0179594_101511032 | 3300020170 | Vadose Zone Soil | MNELQIVLMVVAVNAIVLGVAFFAVYQFNKAVSQSGR |
| Ga0179592_101060022 | 3300020199 | Vadose Zone Soil | MNGLQIILMVVGVNACVLGVAFFALYQFNKAVSQSGR |
| Ga0210403_105854452 | 3300020580 | Soil | MNGFQMLLTVVAVNASVLGVVFFALYQFNKAVTQSGR |
| Ga0210403_109198002 | 3300020580 | Soil | EGCPMNGFQMLLTVVAVNASVLGVVFFALYQFNKAVTQSGR |
| Ga0210399_103846732 | 3300020581 | Soil | MNGFQMLLTVVAVNACVLGVVFFALYQFNKAVSQSGR |
| Ga0210408_107062882 | 3300021178 | Soil | MNGVQTFQMLLAVIAVNACVLGVAFFASYQFNKAVSRSGR |
| Ga0210408_114110422 | 3300021178 | Soil | MNGFQMFQMLLAIIAVNAGVLGVAFLALYQFNKAVSRSGR |
| Ga0210389_100547854 | 3300021404 | Soil | MNGLQVVLMVVALNACVLGAAFFAVYQFNKAVSQSGR |
| Ga0210394_100735791 | 3300021420 | Soil | RWPMNGFQMFLLVIVVNACVLGVGLLAVYQFNKAVSGCGR |
| Ga0187846_101671422 | 3300021476 | Biofilm | MNGLQIVLMVIAVNAVVLGVVFFASYQFNKAVSQSGR |
| Ga0126371_101295783 | 3300021560 | Tropical Forest Soil | MQGVQMLLAIIAVNASVLGVAFFALYQFNKAVRGCGR |
| Ga0126371_115408832 | 3300021560 | Tropical Forest Soil | MNGLQILLAVLVVNAGVLGVAVFALYQFNKAVSRAGR |
| Ga0213853_107966422 | 3300021861 | Watersheds | MDELQMLLAVIAVNASVLGVAFLVLYQFNKAVSGCGR |
| Ga0242655_101141391 | 3300022532 | Soil | WLMSGIQIVLVVIAVNAGVLGVALLIAYQFNKAVSGSGR |
| Ga0242662_101722291 | 3300022533 | Soil | PMNGLQILLMVVVVNAFVLGAAFFALYQFNKAVSQSGR |
| Ga0242657_11784482 | 3300022722 | Soil | MNGFQMLLLVIVVNAFVRGVGLLAVYQFNKAVRPCGR |
| Ga0208193_10266772 | 3300025463 | Peatland | MNGFHMLLMVIAVNACVLGVASFALYQFNKAVRHCGR |
| Ga0209240_11202082 | 3300026304 | Grasslands Soil | MNGLQIILMVVAVNAIVLGVALFAVYQFNKAVSQSGR |
| Ga0209240_11985422 | 3300026304 | Grasslands Soil | MNALQIVLMVVAVNACVLGVAFFALYQFNKAVSQSGR |
| Ga0257151_10002244 | 3300026341 | Soil | MNGFQMFQMLLAIIAVNACVLGVAFLALYQFNKAVSPSGR |
| Ga0257166_10140512 | 3300026358 | Soil | LIGKGCPMNGLQIILMVVGVNACVLGVAFFALYQFNKAVSQSGR |
| Ga0257154_10111232 | 3300026467 | Soil | MNGFQMFQMLLAIIAVNACVLGVAFFALYQLNKAVSPSGR |
| Ga0209648_101486342 | 3300026551 | Grasslands Soil | MNGFQILLAVIAVNACVLGVAFLALYQLDKAVSRCGR |
| Ga0209648_102077381 | 3300026551 | Grasslands Soil | MNGLQIILMVVAVNAIVLGVAFFAVYQFNKAVSQSGR |
| Ga0209220_11040462 | 3300027587 | Forest Soil | MSEFQIVLVVIAVNVCVLGIAFFAAYRFNKAVSQSGR |
| Ga0209799_10309202 | 3300027654 | Tropical Forest Soil | MNGLQIVLMVIAVNAGVLGVAFFVSYQFNKAVSQSGR |
| Ga0209588_10038821 | 3300027671 | Vadose Zone Soil | TIFDWGCPMNELQIVLMVVAVNAIVLGVAFFAVYQFNKAVSQSGR |
| Ga0209118_10475222 | 3300027674 | Forest Soil | MSEFQIVLVVIAVNACVLGIAFFAAYRFNKAVSQSGR |
| Ga0209810_10176125 | 3300027773 | Surface Soil | MHGLEIVLMAIVTNACVLGLAFFTVYQFNKAVSQSGR |
| Ga0209060_1000155120 | 3300027826 | Surface Soil | MNGLQVLLAVVATNAFVLGAAFLTVYHFNKLVSRSGR |
| Ga0209465_100027895 | 3300027874 | Tropical Forest Soil | MSSFQMILVVIATNACVLGVAFLALYQLNKAVSECGR |
| Ga0209465_106621812 | 3300027874 | Tropical Forest Soil | MNGLQIVLMIIGVNASVLGIAFFAVYQFNKAVSRSGR |
| Ga0209283_109267771 | 3300027875 | Vadose Zone Soil | GKGCPMNGLQIILMVVGVNACVLGVAFFALYQFNKAVSQSGR |
| Ga0209068_106069792 | 3300027894 | Watersheds | MNGFQMLLMIVAVNACVLGVAFLALYQFNKAVSQSGR |
| Ga0209488_100611254 | 3300027903 | Vadose Zone Soil | MGKGCLMSGLQIVMMVIAVNACVLGAAFFALYQFNKAVSQSGR |
| Ga0209488_101185122 | 3300027903 | Vadose Zone Soil | MSGLQIVMMIIAVNACVLGAAFFALYQFNKAVSQSGR |
| Ga0209415_103490012 | 3300027905 | Peatlands Soil | MNGFQMLLLVIAVNACVLGVGLLAVYQFNKAVRPCGR |
| Ga0209698_100597302 | 3300027911 | Watersheds | MNGFQILMATLAVNAIVLGAAFLVIYQFNKAVSQCGR |
| Ga0209069_103577022 | 3300027915 | Watersheds | MSGLQMLLAVIGVNAGVLGVAFFAIYRFDKAVRRSGR |
| Ga0209069_106623602 | 3300027915 | Watersheds | MDELQLLLATIAVNASVLGVAFLVLYQFNKAVSGCGR |
| Ga0209526_100649262 | 3300028047 | Forest Soil | MSEFQIVLVVIAVNACVLGVAFFAAYRFNKAVSQSGR |
| Ga0209526_102061243 | 3300028047 | Forest Soil | MNGFQMFQMLLAIIAVNACVLGVAFLALYQFNKAVSRSGR |
| Ga0209526_108414282 | 3300028047 | Forest Soil | MNGFQVFQMLLSIIAVNACVLGVAFFALYQFNKSVSRSGR |
| Ga0137415_104796552 | 3300028536 | Vadose Zone Soil | MSTFQMLLAVIAVNACVLGVAFFALYLFNKAVSQSGR |
| Ga0302234_102355602 | 3300028773 | Palsa | LIGERRRMDEFQVFVAVLAINACVLGVALFAVYQFNKVVSRCGR |
| Ga0311340_100547934 | 3300029943 | Palsa | MDEFQVFVAVLAINACVLGVALFAVYQFNKVVSRCGR |
| Ga0265460_101964712 | 3300030740 | Soil | VNEAQIVLAVIVVNAFVLGIAIMVLYQFNKAVSQSGS |
| Ga0170824_1122673432 | 3300031231 | Forest Soil | MNGFQMLLLVIVVNAFVLGVGLLAVYQFNNAVKPCGR |
| Ga0318572_102978172 | 3300031681 | Soil | MQGFQMLLTVIAVNACVLGVAFFALYQFNKAVRGCGR |
| Ga0310686_1047380572 | 3300031708 | Soil | MNGFHMLLMVVAVNACVLGVASFALYQFNKAVRRCGR |
| Ga0307469_101485012 | 3300031720 | Hardwood Forest Soil | MGGLQMLLTVIAVNASVLGVAFFALYQFNKAVSQCGR |
| Ga0306925_106484672 | 3300031890 | Soil | MSGFQILLVVVATNAVVLGIAFLALYQFNKAVSSCGR |
| Ga0306922_122242612 | 3300032001 | Soil | NGLQIILMIIGVNASVLGIAFFAVYQFNKAVSQSGR |
| Ga0311301_102150774 | 3300032160 | Peatlands Soil | MQGFQILLLVIAVASCVLGVAFLGAYQLNKAVDQCDR |
| Ga0306920_1008859542 | 3300032261 | Soil | MNGLQIVLMIIGVNASVLGIAFFAVYQFNKAVSQSGR |
| Ga0335081_109774812 | 3300032892 | Soil | MNAFQELVTVLAVDACVLGVAIFALYQLNRGVSRCGR |
| ⦗Top⦘ |