| Basic Information | |
|---|---|
| Family ID | F049972 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MIPIHDTAAGVTFAVKVHPRARKNAITGELGDALK |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 62.07 % |
| % of genes near scaffold ends (potentially truncated) | 96.58 % |
| % of genes from short scaffolds (< 2000 bps) | 82.88 % |
| Associated GOLD sequencing projects | 129 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.28 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.890 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.644 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.288 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.521 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 12.70% Coil/Unstructured: 87.30% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF01168 | Ala_racemase_N | 53.42 |
| PF03169 | OPT | 12.33 |
| PF02594 | DUF167 | 2.74 |
| PF14279 | HNH_5 | 1.37 |
| PF13531 | SBP_bac_11 | 0.68 |
| PF13662 | Toprim_4 | 0.68 |
| PF04368 | DUF507 | 0.68 |
| PF13701 | DDE_Tnp_1_4 | 0.68 |
| PF00583 | Acetyltransf_1 | 0.68 |
| PF07676 | PD40 | 0.68 |
| PF13537 | GATase_7 | 0.68 |
| PF13520 | AA_permease_2 | 0.68 |
| PF01844 | HNH | 0.68 |
| PF02910 | Succ_DH_flav_C | 0.68 |
| PF03061 | 4HBT | 0.68 |
| PF00156 | Pribosyltran | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG1297 | Predicted oligopeptide transporter, OPT family | General function prediction only [R] | 12.33 |
| COG1872 | Uncharacterized conserved protein YggU, UPF0235/DUF167 family | Function unknown [S] | 2.74 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.89 % |
| Unclassified | root | N/A | 4.11 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004091|Ga0062387_101495716 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300004633|Ga0066395_10210321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1023 | Open in IMG/M |
| 3300005167|Ga0066672_10323712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1004 | Open in IMG/M |
| 3300005330|Ga0070690_100066828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2328 | Open in IMG/M |
| 3300005454|Ga0066687_10175871 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1151 | Open in IMG/M |
| 3300005534|Ga0070735_10766684 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005566|Ga0066693_10135587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 915 | Open in IMG/M |
| 3300005568|Ga0066703_10156577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1370 | Open in IMG/M |
| 3300005602|Ga0070762_11068844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 555 | Open in IMG/M |
| 3300005764|Ga0066903_101663110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1214 | Open in IMG/M |
| 3300005764|Ga0066903_104409925 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300005764|Ga0066903_108343122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 529 | Open in IMG/M |
| 3300005841|Ga0068863_100165826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2118 | Open in IMG/M |
| 3300006028|Ga0070717_11810950 | Not Available | 552 | Open in IMG/M |
| 3300006052|Ga0075029_100695325 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300006059|Ga0075017_100995215 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300006162|Ga0075030_100130617 | All Organisms → cellular organisms → Bacteria | 2038 | Open in IMG/M |
| 3300006163|Ga0070715_10122083 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300006163|Ga0070715_10835290 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300006806|Ga0079220_11563536 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300006893|Ga0073928_10065811 | All Organisms → cellular organisms → Bacteria | 3170 | Open in IMG/M |
| 3300009623|Ga0116133_1088585 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300009634|Ga0116124_1148343 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis → Candidatus Koribacter versatilis Ellin345 | 656 | Open in IMG/M |
| 3300009643|Ga0116110_1036226 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1825 | Open in IMG/M |
| 3300009646|Ga0116132_1158306 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300009665|Ga0116135_1025164 | All Organisms → cellular organisms → Bacteria | 2036 | Open in IMG/M |
| 3300009665|Ga0116135_1028383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1917 | Open in IMG/M |
| 3300009698|Ga0116216_10275508 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1027 | Open in IMG/M |
| 3300010339|Ga0074046_10159751 | All Organisms → cellular organisms → Bacteria | 1433 | Open in IMG/M |
| 3300010341|Ga0074045_10041488 | All Organisms → cellular organisms → Bacteria | 3385 | Open in IMG/M |
| 3300010358|Ga0126370_11508119 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300010366|Ga0126379_12335585 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300010379|Ga0136449_101443707 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1058 | Open in IMG/M |
| 3300010391|Ga0136847_10088667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300010937|Ga0137776_1012493 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300010937|Ga0137776_1856819 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300011271|Ga0137393_11752416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300012683|Ga0137398_10055289 | All Organisms → cellular organisms → Bacteria | 2368 | Open in IMG/M |
| 3300012923|Ga0137359_11433303 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012925|Ga0137419_10432749 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300012958|Ga0164299_11621891 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300012984|Ga0164309_10352466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1081 | Open in IMG/M |
| 3300012986|Ga0164304_10832832 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300014156|Ga0181518_10054722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2377 | Open in IMG/M |
| 3300014159|Ga0181530_10004306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 15198 | Open in IMG/M |
| 3300014200|Ga0181526_10082066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2055 | Open in IMG/M |
| 3300014325|Ga0163163_12605094 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300014654|Ga0181525_10651225 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300014658|Ga0181519_10454374 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300014968|Ga0157379_12582064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300014969|Ga0157376_10026684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4567 | Open in IMG/M |
| 3300014969|Ga0157376_10990367 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 863 | Open in IMG/M |
| 3300014969|Ga0157376_11954019 | Not Available | 624 | Open in IMG/M |
| 3300015371|Ga0132258_12679770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 1244 | Open in IMG/M |
| 3300015371|Ga0132258_12890004 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
| 3300015373|Ga0132257_102174488 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300016750|Ga0181505_10015848 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
| 3300017934|Ga0187803_10452798 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300017943|Ga0187819_10556934 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300017955|Ga0187817_10052477 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2515 | Open in IMG/M |
| 3300017959|Ga0187779_10679779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300017972|Ga0187781_10394661 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300017975|Ga0187782_10200303 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1493 | Open in IMG/M |
| 3300017996|Ga0187891_1260667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300018020|Ga0187861_10243812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300018020|Ga0187861_10382078 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300018029|Ga0187787_10288039 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300018044|Ga0187890_10862407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300018086|Ga0187769_10138386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1776 | Open in IMG/M |
| 3300018086|Ga0187769_10870544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300018088|Ga0187771_11008269 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300018088|Ga0187771_11054216 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300019880|Ga0193712_1000081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14432 | Open in IMG/M |
| 3300019887|Ga0193729_1012015 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3886 | Open in IMG/M |
| 3300020579|Ga0210407_11459878 | Not Available | 506 | Open in IMG/M |
| 3300020581|Ga0210399_10518809 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300020582|Ga0210395_11255569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300020583|Ga0210401_11319925 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300021171|Ga0210405_10225006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1486 | Open in IMG/M |
| 3300021406|Ga0210386_11196656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300021420|Ga0210394_11559962 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300021433|Ga0210391_10042506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3631 | Open in IMG/M |
| 3300021439|Ga0213879_10281836 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300021475|Ga0210392_10574079 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300021479|Ga0210410_10285367 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300021559|Ga0210409_10679238 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300021560|Ga0126371_11026770 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 965 | Open in IMG/M |
| 3300021560|Ga0126371_12461010 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300022557|Ga0212123_10203170 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300024225|Ga0224572_1005583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2247 | Open in IMG/M |
| 3300024295|Ga0224556_1167311 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300025915|Ga0207693_10159841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1772 | Open in IMG/M |
| 3300025921|Ga0207652_11641903 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300025928|Ga0207700_12043792 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300025939|Ga0207665_11327829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 573 | Open in IMG/M |
| 3300026089|Ga0207648_10120660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2305 | Open in IMG/M |
| 3300026305|Ga0209688_1063583 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300026309|Ga0209055_1113874 | All Organisms → cellular organisms → Bacteria | 1047 | Open in IMG/M |
| 3300026469|Ga0257169_1049430 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300026552|Ga0209577_10681284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300027641|Ga0208827_1077229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
| 3300027667|Ga0209009_1131522 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300027737|Ga0209038_10274962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300027824|Ga0209040_10476843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300027825|Ga0209039_10245675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 716 | Open in IMG/M |
| 3300027842|Ga0209580_10346241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300027846|Ga0209180_10170939 | All Organisms → cellular organisms → Bacteria | 1253 | Open in IMG/M |
| 3300027879|Ga0209169_10719241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300027894|Ga0209068_10461438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300027895|Ga0209624_10517822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300027903|Ga0209488_10055833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2911 | Open in IMG/M |
| 3300027911|Ga0209698_11045373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300028759|Ga0302224_10109835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1065 | Open in IMG/M |
| 3300028774|Ga0302208_10144363 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300029915|Ga0311358_10210464 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1753 | Open in IMG/M |
| 3300029915|Ga0311358_11103835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300030019|Ga0311348_10596810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300030399|Ga0311353_11677228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300030580|Ga0311355_10783312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
| 3300030688|Ga0311345_11005359 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300030706|Ga0310039_10027030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2697 | Open in IMG/M |
| 3300030815|Ga0265746_1026814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300030991|Ga0073994_12201751 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300031712|Ga0265342_10511260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300031715|Ga0307476_10234254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1338 | Open in IMG/M |
| 3300031715|Ga0307476_11065465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300031718|Ga0307474_10122121 | All Organisms → cellular organisms → Bacteria | 1956 | Open in IMG/M |
| 3300031720|Ga0307469_10230049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1474 | Open in IMG/M |
| 3300031753|Ga0307477_10027368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3897 | Open in IMG/M |
| 3300031754|Ga0307475_11213430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300031821|Ga0318567_10897657 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300031823|Ga0307478_10100653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2237 | Open in IMG/M |
| 3300031902|Ga0302322_100218402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2094 | Open in IMG/M |
| 3300031902|Ga0302322_101600348 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300031941|Ga0310912_10457782 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300031945|Ga0310913_11005217 | Not Available | 584 | Open in IMG/M |
| 3300032174|Ga0307470_10524618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300032828|Ga0335080_11172975 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300033158|Ga0335077_10014861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9727 | Open in IMG/M |
| 3300033289|Ga0310914_10232278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1654 | Open in IMG/M |
| 3300033402|Ga0326728_10238292 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1755 | Open in IMG/M |
| 3300033405|Ga0326727_10945498 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300033433|Ga0326726_12092810 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300034065|Ga0334827_003613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 7480 | Open in IMG/M |
| 3300034125|Ga0370484_0215850 | Not Available | 527 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.64% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.48% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.11% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.11% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.11% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.42% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.42% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.74% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.05% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.05% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.05% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 2.05% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 1.37% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.37% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.37% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.37% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.37% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.68% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
| 3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
| 3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028774 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300030019 | II_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034065 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5 | Environmental | Open in IMG/M |
| 3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062387_1014957161 | 3300004091 | Bog Forest Soil | MVVIQKSPNGATFAVKVQPRAKKNAITGEVGDAVKLSLTA |
| Ga0066395_102103212 | 3300004633 | Tropical Forest Soil | MTTIRDSLAGATFSIRLHPRAKKNAITGEVDDGLKVSLTAPP |
| Ga0066672_103237121 | 3300005167 | Soil | MVTIHDTPSAATFVVKVHPRAKKNAITGEIGDALSLTPPPI |
| Ga0070690_1000668281 | 3300005330 | Switchgrass Rhizosphere | VITVHETAEGVTFAVKLQPRARRDAIVGELGGALKLSLTAPP |
| Ga0066687_101758711 | 3300005454 | Soil | VDVLVIPINDSPSGATFAVKVHPRAKKNGITGEIGDALKL |
| Ga0070735_107666841 | 3300005534 | Surface Soil | MFAIHEHDSTITFAVKVHPRAKKNAITGEFRDALKVSLTSPPVE |
| Ga0066693_101355871 | 3300005566 | Soil | MITIHNVPGGASFAIKVHPRAKMNAITGELGNVLKLA |
| Ga0066703_101565771 | 3300005568 | Soil | VIPIHDTAAGATFVVKVHPRAKKNAITGTVGDAIKLALTAPP |
| Ga0070762_110688441 | 3300005602 | Soil | MFRIRERRGGVSLVVRVHPRAKRNAITGEFGDALKVSLTAPA |
| Ga0066903_1016631103 | 3300005764 | Tropical Forest Soil | VIPVKQSASGVTFAVRLHPRARKDQITGQAGDALKLSL |
| Ga0066903_1044099252 | 3300005764 | Tropical Forest Soil | MIPVRDHLDGASFAVKVHPRAKHDRISGAIGDALK |
| Ga0066903_1083431222 | 3300005764 | Tropical Forest Soil | VIPIRESDGGVSFAVKVQARARKNAITGELGDALKLA |
| Ga0068863_1001658261 | 3300005841 | Switchgrass Rhizosphere | MIPIHDTAQGASFAVKVHPRAKKNAITGELGDALKL |
| Ga0070717_118109502 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKVQNGSQGVWFAVRVHPRAKKDAITGELGDALK |
| Ga0075029_1006953252 | 3300006052 | Watersheds | VIPIHDTPAGATFQVKVHPRARKSGITGVVGDVLK |
| Ga0075017_1009952151 | 3300006059 | Watersheds | VIKVQDGSQGVSFAVKVHPRAKKDAITGELGDALKVSLTTP |
| Ga0075030_1001306171 | 3300006162 | Watersheds | MISIHETASGSTFAVKVHPGASKNAITGELGGALKVSLTA |
| Ga0070715_101220833 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPIHESALGATFAVKVHPRARKNAITGESGDALRLSLT |
| Ga0070715_108352901 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | SLIPLQESGGVTFAVKVHPRAKKSEITGELGDALKVSLTAPPNRRQSK* |
| Ga0079220_115635362 | 3300006806 | Agricultural Soil | MIPVRESGVSVSFAVKVQPRARKNAIDGVLGDALKLPVT |
| Ga0073928_100658114 | 3300006893 | Iron-Sulfur Acid Spring | MIPVNDGPGGATFAVKVHPRANKTSITGELGEALKVS |
| Ga0116133_10885852 | 3300009623 | Peatland | LIPIYEAAGGVTFAVKVHPRAKKNAITGELGDALKISLTAA |
| Ga0116124_11483431 | 3300009634 | Peatland | LTSIRDTPGGATFQVKVQPRSKKNAIIGEVGEALKLGLTAP |
| Ga0116110_10362261 | 3300009643 | Peatland | MIPVRDTPSGATFQVKVHPRAKKNSITGEAGDALKLA |
| Ga0116132_11583061 | 3300009646 | Peatland | LIPIRESASGATFAIKVHPRAKKNAITGELDGALKLSLTAP |
| Ga0116135_10251641 | 3300009665 | Peatland | LIPIYEAAGGVTFAVKVHPRAKKNAITGELGDALKIS |
| Ga0116135_10283831 | 3300009665 | Peatland | MMAIQNSPAGATFAVKVHPRAKKNAITGEIGEALKLSLL |
| Ga0116216_102755083 | 3300009698 | Peatlands Soil | MSKVVTVHEGAGGASFVVRVHPRANKNAITGELGDALKVSLT |
| Ga0074046_101597511 | 3300010339 | Bog Forest Soil | MLEFKESPAGTTFALKVHPRAKKNAITGEVGDALKRA |
| Ga0074045_100414883 | 3300010341 | Bog Forest Soil | MVAIQNSPTGVTFAVKVHPRAKKNAITGEVGDALKL |
| Ga0126370_115081192 | 3300010358 | Tropical Forest Soil | MIPLKQTSAGISFTVKVHPRARKNAITGTFGDALKLA |
| Ga0126379_123355852 | 3300010366 | Tropical Forest Soil | MIPLKQTSAGISFAVKVHPRARKNAITGTLGDALK |
| Ga0105239_112771572 | 3300010375 | Corn Rhizosphere | MIPISENDAGVSFAIKVHPRAKKAGIMGELGDALKVSLTA |
| Ga0136449_1014437073 | 3300010379 | Peatlands Soil | MIPVRDTPFGATFQVKVHPRARKNTITGEVADALKLALTAPAT |
| Ga0136847_100886672 | 3300010391 | Freshwater Sediment | MISISDTPSGATFAVRLHPRARKNAITGALGDALKI |
| Ga0137776_10124932 | 3300010937 | Sediment | MIPVRDTASGATFQVKVHPRAKKNAITGEIGDALKV |
| Ga0137776_18568191 | 3300010937 | Sediment | MIPIRENSGAVSFAVKVHPRAKKDAITGELGDALKVALNAP |
| Ga0137393_117524161 | 3300011271 | Vadose Zone Soil | LIPIQESSGSVTFAVKIHPRAKKNAIMGELGDALKLSL |
| Ga0137398_100552891 | 3300012683 | Vadose Zone Soil | MAVVKNSPAGVTFAVKVHPRAKKNAITGQVGDTLKL* |
| Ga0137359_114333031 | 3300012923 | Vadose Zone Soil | MTIPIATSAAGVSFKIKVHPRAKKNAITGTVGDALKVSVTAP |
| Ga0137419_104327491 | 3300012925 | Vadose Zone Soil | MIPIHDTAAGATFVVKVHPHAKKNAITGELGEALKV |
| Ga0164299_116218912 | 3300012958 | Soil | MFSITDGPAGVTFAIKLHPRARKNAITGELGGTLK |
| Ga0164309_103524661 | 3300012984 | Soil | MIPVHETPLGVTFAVKVHPRARKSAITGELGDALKVS |
| Ga0164304_108328322 | 3300012986 | Soil | MLSIEKGPEGITFAVKIHPRARKNAITGELGGALK |
| Ga0181518_100547221 | 3300014156 | Bog | MAAIKNAPNGATFAVKVHPRAKRNAITGEVGDAIK |
| Ga0181530_100043061 | 3300014159 | Bog | VISIRGTPQGATFAIRVQPRARKNAIIGELGDALKLAL |
| Ga0181526_100820663 | 3300014200 | Bog | MIPIHETAGGATLAVKVHPRAKKNAVTGELGDALKLALTAP |
| Ga0163163_126050942 | 3300014325 | Switchgrass Rhizosphere | MFSIRDDSTGVGFAVRVHPRAKKNAITGILGDALK |
| Ga0181525_106512251 | 3300014654 | Bog | MVTMQESERGVTFAVKVHPRAKKNAITGELGGALKV |
| Ga0181519_104543742 | 3300014658 | Bog | MAFIREDEAGATFAIKVHPRAKKNAITGEVGDALK |
| Ga0157379_125820642 | 3300014968 | Switchgrass Rhizosphere | LIKIAETAGCVSFAVKVHPRAKKNAITGEVGEALKVAL |
| Ga0157376_100266841 | 3300014969 | Miscanthus Rhizosphere | MIPIYDTAQGASFAVKVHPGAKKNAITGELGDALKLAL |
| Ga0157376_109903671 | 3300014969 | Miscanthus Rhizosphere | MIPIHDTAQGASFAVKVRPGAKKNAITGELGVALK |
| Ga0157376_119540191 | 3300014969 | Miscanthus Rhizosphere | MIPVRETALGATFAVKVHPRARKTAVTGIFGDGPEAAIKV |
| Ga0132258_126797701 | 3300015371 | Arabidopsis Rhizosphere | MIPVRETALGATFAVKVHPRAKKTAVTGIFGEGPDAA |
| Ga0132258_128900042 | 3300015371 | Arabidopsis Rhizosphere | MLSIERGPEGITFAVKIHPRARKNAITGDLAGALKLSLT |
| Ga0132257_1021744882 | 3300015373 | Arabidopsis Rhizosphere | MLSIERGPEGITFAVKIHPRARKNAIAGDLAGALKLSL |
| Ga0181505_100158485 | 3300016750 | Peatland | MIPIGQTAVGVTFAVKVHPRAKKNAITGEVGNALKLALTAP |
| Ga0187803_104527982 | 3300017934 | Freshwater Sediment | LIPIHESPSGVTFAVKVHPRARKNAIAGELGNALKLSLTSP |
| Ga0187819_105569342 | 3300017943 | Freshwater Sediment | VIPIRDTPQGATFAVHVQPRARKNAIVGELGGALKLA |
| Ga0187817_100524773 | 3300017955 | Freshwater Sediment | MTAIKDSPNGATFAVKVHPRAKKNAITGEVGEALKL |
| Ga0187779_106797792 | 3300017959 | Tropical Peatland | MIPLHVSPDSVSFAVKVQPRARKNGVTGELGDALKLALT |
| Ga0187781_103946613 | 3300017972 | Tropical Peatland | MIPILEHESSVSFGVRVHPRAKKNAITGEVGDALK |
| Ga0187782_102003031 | 3300017975 | Tropical Peatland | MIPVRDTAQGATFAVKVHPRAKKNAIAGEIGDALKLALTAP |
| Ga0187891_12606672 | 3300017996 | Peatland | MAVIQNSANGAAFAVKVHPRAKKNAITGEVGDALKLSLTA |
| Ga0187861_102438121 | 3300018020 | Peatland | MIPVHDSNAGATFAVRVHPRAKKNAITGELDGALK |
| Ga0187861_103820781 | 3300018020 | Peatland | MAAIKNAPNGATFAVKVHPRAKRNAITGEVGDAIKLALTA |
| Ga0187787_102880392 | 3300018029 | Tropical Peatland | MIPIKDTPSGATFSVRVFPRAKRNAITGEIGDALKVSLT |
| Ga0187890_108624072 | 3300018044 | Peatland | VIPIHESGGGVTFAIKVHPRARKNTITGELGDALKLSIT |
| Ga0187769_101383863 | 3300018086 | Tropical Peatland | MIPIHESNAGVRFTVKVHPRAKKNAITGELGDALKVSLT |
| Ga0187769_108705441 | 3300018086 | Tropical Peatland | LILIQESGGGVTFAVKVYPRARKNAITGELGDALK |
| Ga0187771_110082691 | 3300018088 | Tropical Peatland | MISIRENDGAVSFAVRVHPRAKKNAITGQLGDALKVS |
| Ga0187771_110542162 | 3300018088 | Tropical Peatland | MISIQEGNTGVTFAVRVHPRAKKNAITGELGDALKV |
| Ga0193712_10000813 | 3300019880 | Soil | MVSVHDTSAGVTFALKVHPRAKRNAISGEVGDALKSR |
| Ga0193729_10120151 | 3300019887 | Soil | MVAIQNSAKGATFAVKVHPRAKKNAITGEAGDALKLALT |
| Ga0210407_114598781 | 3300020579 | Soil | MIPIRDSASGASFAVRVHPRAKKTAITGILGEGADTTLK |
| Ga0210399_105188092 | 3300020581 | Soil | VISIAESRGAVTFAVKVHPRARKNSITGELGGALKLSLT |
| Ga0210395_112555692 | 3300020582 | Soil | MISLREGGGAVSFSVRVHPRAKKNGITGEMGDALKLSLTTPS |
| Ga0210401_113199251 | 3300020583 | Soil | MFAVAETASCVTFAVKVHPRARKNTITGELGDALKVSLTSP |
| Ga0210405_102250061 | 3300021171 | Soil | MLAIRENADGVSFAVRVHPRAKKNAITGELGDALKV |
| Ga0210386_111966562 | 3300021406 | Soil | MIPLFESDCGTSFAVKVHPRAEKNAITGEFGDALKVSLT |
| Ga0210394_115599621 | 3300021420 | Soil | MFAIQETAGGVTFAVKIHPLAKKNAITGEFGDALKV |
| Ga0210391_100425061 | 3300021433 | Soil | MLLIHESDGGVSFAVKVRPRARKNAITGELGGALKV |
| Ga0213879_102818361 | 3300021439 | Bulk Soil | MIPLHETPAGVTIAVKIQPRAKKNALIGVVGDALKLALTA |
| Ga0210392_105740791 | 3300021475 | Soil | MIPVHDTSAGVAFAVKVQPRARKNTITGTVGDALK |
| Ga0210410_102853672 | 3300021479 | Soil | MIKVQDGNQGVSFAVKVHPRAKKDAITGEFGDALKVSLTT |
| Ga0210409_106792381 | 3300021559 | Soil | MIAINDSPEGVTFAVKIHPRAKKNAVTGTVGDALKLSLIA |
| Ga0126371_110267701 | 3300021560 | Tropical Forest Soil | MILLRQTSSGITFAVKVQPRARKNAITGTLGDALKLALT |
| Ga0126371_124610102 | 3300021560 | Tropical Forest Soil | MLPIHDTPAGATFQVKVQPRARKNAITGALGDALKLALTA |
| Ga0212123_102031701 | 3300022557 | Iron-Sulfur Acid Spring | MIPVNDGPGGATFAVKVHPRANKTSITGELGEALKVSVTSAPAD |
| Ga0224572_10055833 | 3300024225 | Rhizosphere | MIPLHESGGGITFVVKVHPRARKNVITGELGDALKLS |
| Ga0224556_11673112 | 3300024295 | Soil | MVALQSSPSGVTFAVKVHPRAKKNGITGEVGDALK |
| Ga0207693_101598411 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPISENATGVTFAIKVHPRAKRAAITGELGDALKVSLTAPPLE |
| Ga0207652_116419031 | 3300025921 | Corn Rhizosphere | VIPIRESTDGLTFSVRVRPRAKKTAITGEVGDSLKVA |
| Ga0207700_120437922 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LINVIETDDAVSFVVKVHPRAKKNAITGELGDAIKL |
| Ga0207665_113278293 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIPARESDDGVTFFVKVQPRAKRDAIIGELGDALKVALRAPAIE |
| Ga0207648_101206603 | 3300026089 | Miscanthus Rhizosphere | MVAIQELANDVTFGVKVHPRAKKNAITGEIGDSLK |
| Ga0209688_10635831 | 3300026305 | Soil | MITIHNVPGGASFAIKVHPRAKMNAITGELGNVLKLALAA |
| Ga0209055_11138742 | 3300026309 | Soil | MIKVQDGIQGVTFAVKVHPRAKKDAITGELGDALKVSLT |
| Ga0257169_10494302 | 3300026469 | Soil | MVAIQNSANGATFAVKVHPRAKKNAITGELGDALK |
| Ga0209577_106812841 | 3300026552 | Soil | VIPIRQLGGGVTFAVKVHPRAGKNAIIGELGNALKVSLTS |
| Ga0208827_10772291 | 3300027641 | Peatlands Soil | MIPIHDSPAGATFAVKVHPRAKKNAIGGELGDALKLALTAP |
| Ga0209009_11315221 | 3300027667 | Forest Soil | LIPIHESRSGVTFAVKVLSRAKGNAITGELGQALK |
| Ga0209038_102749622 | 3300027737 | Bog Forest Soil | MIPIKESKSGTTFAIKVHPRAKKNAITGIVGDALK |
| Ga0209040_104768431 | 3300027824 | Bog Forest Soil | VIPIRDTEASATFAVKVHPRAKKNAITGEMGDALK |
| Ga0209039_102456751 | 3300027825 | Bog Forest Soil | LIAIQEYGDAVTFAVKVHPRAKKNAITGEFGEALKLSLTS |
| Ga0209580_103462413 | 3300027842 | Surface Soil | LIPVNQTDDGATFAVKAHPRAKKNAITGELGDALKVSLTTP |
| Ga0209180_101709391 | 3300027846 | Vadose Zone Soil | MIPIHDTAAGVTFAVKVHPRARKNAITGELGDALK |
| Ga0209169_107192411 | 3300027879 | Soil | MIPVHEAARGVSFSIRVHPRAKKNAITGEIGDALKISL |
| Ga0209068_104614381 | 3300027894 | Watersheds | MIPIHDTPAGATFEVKVHPRAKKNAITGEFGDALKLAL |
| Ga0209624_105178223 | 3300027895 | Forest Soil | VIPVQDTPGGAFFAVKVHPRARKNAITGELGDVLKVSLTSP |
| Ga0209488_100558331 | 3300027903 | Vadose Zone Soil | MAVVKNSPAGVTFAVKVHPRAKKNAITGQVGDALA |
| Ga0209698_110453731 | 3300027911 | Watersheds | VPPVVKTSMVAIQNSPSGAAFEVKIHPRAKRNAITGEVGDALKL |
| Ga0302224_101098351 | 3300028759 | Palsa | MAAIKDVSNGSTFAVKVHPRARKNAITGAVGEALKV |
| Ga0302208_101443631 | 3300028774 | Fen | MTPIRDTPSGATFQVKVHPRARKNAITGVVGEALK |
| Ga0311358_102104641 | 3300029915 | Bog | MIPMQESRGSVTFAVKVHPRAKNNGITGEIAGTLKLSLTS |
| Ga0311358_111038351 | 3300029915 | Bog | MVAIQSSPTGVTFAVKLHPRAKKNGVTGEVGDALKLSLT |
| Ga0311348_105968103 | 3300030019 | Fen | MIPVRDTPSGATFQVKVHPRARKNAITGVVGEALKLSL |
| Ga0311353_116772281 | 3300030399 | Palsa | VVHLQELDNAVTFCAKVHPRAKKNGITGEIGDALKVSL |
| Ga0311355_107833123 | 3300030580 | Palsa | LIPIHESAGAVTFEVKVHPRARKNAITGELGGALKLS |
| Ga0311345_110053592 | 3300030688 | Bog | MAFIREDEAGATFAIKVHPRAKKNAITGEVGDALKVSLS |
| Ga0310039_100270301 | 3300030706 | Peatlands Soil | VIPLNESSGGVTFAVKVHPRAKKNAITGEFGDALKVS |
| Ga0265746_10268141 | 3300030815 | Soil | LIPIQESNGSVTFAVKVHPRARKNTITGELGNALKV |
| Ga0073994_122017511 | 3300030991 | Soil | LIPVQQTGDGISFAVKIHPRAKKNAITGVLGDALQVSL |
| Ga0265342_105112602 | 3300031712 | Rhizosphere | MIPIRDTPSGATFQVKLHPRAKKNAITGEVGEALKVALTA |
| Ga0307476_102342544 | 3300031715 | Hardwood Forest Soil | LIPFQESNNGVTFAVKVHPRAKKNAITGEVGEALKLSLT |
| Ga0307476_110654651 | 3300031715 | Hardwood Forest Soil | VIPVHDTPDGAFFAIKVHPRARKNAITGELGDALKVSLT |
| Ga0307474_101221211 | 3300031718 | Hardwood Forest Soil | LIPIQKSAEGVTFAVRVHPRARKNAVTGTVGDALKI |
| Ga0307469_102300493 | 3300031720 | Hardwood Forest Soil | MISIHDTPDGATFAIKVHPRARKNAITGELGGALKLSLTAP |
| Ga0307477_100273685 | 3300031753 | Hardwood Forest Soil | LISVTESGGSVAFSVKVHPHARKNAITGELDGALKV |
| Ga0307475_112134301 | 3300031754 | Hardwood Forest Soil | VIPIQESRGSVTFAVKVRPRARKNAITGELGDATNLSLT |
| Ga0318567_108976571 | 3300031821 | Soil | MIPIREDGRGVTFGIKVHPRAKRNAITGELGDALK |
| Ga0307478_101006531 | 3300031823 | Hardwood Forest Soil | MVAIKNSPDGVTFAVKVHPRAKKNAITGEVGDALKLAL |
| Ga0302322_1002184021 | 3300031902 | Fen | MAVIQNSPAGVTFAVKVHPRAKKNAITGEVGDALKLAL |
| Ga0302322_1016003482 | 3300031902 | Fen | MIPIRDTRSGATFQVKVHPRARKNAITGVVGDTLK |
| Ga0310912_104577822 | 3300031941 | Soil | VTLVPIHDTPAGATFQVKVHPRARKNAITGVLGDAIKLALT |
| Ga0310913_110052171 | 3300031945 | Soil | LIPVHDTPAGATCQVKVHPRARKNAITGVLGDALKLALT |
| Ga0307470_105246183 | 3300032174 | Hardwood Forest Soil | MPAIREDASGASIQVRIHPRAKKNGITGDLGDALKVS |
| Ga0335080_111729752 | 3300032828 | Soil | MIPLHESSSVVTFAIKVHPRAKKNGITGEIRDALK |
| Ga0335077_100148611 | 3300033158 | Soil | MIPVRQTAAGVTFSVKIHPRAKKNAVTGELDDALKVSLTAPPTE |
| Ga0310914_102322781 | 3300033289 | Soil | MIKIAESRQGVSFAVKVHPRAKKNAITGELGEALK |
| Ga0326728_102382921 | 3300033402 | Peat Soil | MIPVRQHDSEISFQIRVHPRAKKNAITGEVGDALKLT |
| Ga0326727_109454982 | 3300033405 | Peat Soil | VIPIRDTAQGATFAVKVHPRAKKNAVSGEVGEALKVSLTAPP |
| Ga0326726_120928102 | 3300033433 | Peat Soil | VVPINDTPSGATFTVRLHPRAKKNAITGTLGDALKISL |
| Ga0334827_003613_3_107 | 3300034065 | Soil | MIAIQSSPGGATFAVKVHPRAKKNAITGEVGDALK |
| Ga0370484_0215850_3_107 | 3300034125 | Untreated Peat Soil | MIAIQENDGGVSFAVRVHPRAKKNAITGELGDALK |
| ⦗Top⦘ |