Basic Information | |
---|---|
Family ID | F049967 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 146 |
Average Sequence Length | 43 residues |
Representative Sequence | VQSTLLASGLGFPEGPAIMGDGRIVLCDGNTGELLAY |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 146 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.58 % |
% of genes near scaffold ends (potentially truncated) | 94.52 % |
% of genes from short scaffolds (< 2000 bps) | 87.67 % |
Associated GOLD sequencing projects | 122 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (60.274 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (17.808 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.082 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (43.836 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 20.00% Coil/Unstructured: 80.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 146 Family Scaffolds |
---|---|---|
PF00496 | SBP_bac_5 | 50.68 |
PF13417 | GST_N_3 | 1.37 |
PF01522 | Polysacc_deac_1 | 0.68 |
PF08240 | ADH_N | 0.68 |
PF13360 | PQQ_2 | 0.68 |
PF01979 | Amidohydro_1 | 0.68 |
PF08450 | SGL | 0.68 |
PF04463 | 2-thiour_desulf | 0.68 |
PF12679 | ABC2_membrane_2 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
---|---|---|---|
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
COG1683 | Uncharacterized conserved protein YbbK, DUF523 family | Function unknown [S] | 0.68 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.68 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.64 % |
Unclassified | root | N/A | 38.36 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573002|GZIGXIF01AMZXT | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300002906|JGI25614J43888_10034838 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
3300002917|JGI25616J43925_10256957 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300004479|Ga0062595_101102925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 694 | Open in IMG/M |
3300005332|Ga0066388_104128798 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
3300005434|Ga0070709_10181985 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
3300005436|Ga0070713_100279436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1531 | Open in IMG/M |
3300005437|Ga0070710_10274986 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1091 | Open in IMG/M |
3300005437|Ga0070710_10916845 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300005447|Ga0066689_10644455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 666 | Open in IMG/M |
3300005554|Ga0066661_10403000 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300005574|Ga0066694_10506338 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
3300005713|Ga0066905_100164554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1616 | Open in IMG/M |
3300005764|Ga0066903_101841192 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
3300005834|Ga0068851_10103203 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
3300005905|Ga0075269_10070142 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300006028|Ga0070717_11509318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
3300006032|Ga0066696_10989957 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
3300006163|Ga0070715_10354933 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
3300006577|Ga0074050_12045691 | All Organisms → cellular organisms → Bacteria | 1016 | Open in IMG/M |
3300006804|Ga0079221_10311473 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
3300006806|Ga0079220_10212385 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300006854|Ga0075425_100863355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1035 | Open in IMG/M |
3300006854|Ga0075425_102019464 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300006854|Ga0075425_102914589 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
3300006871|Ga0075434_100956052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
3300006871|Ga0075434_102342040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
3300006903|Ga0075426_10584677 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
3300007788|Ga0099795_10051476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1501 | Open in IMG/M |
3300009088|Ga0099830_10523478 | Not Available | 969 | Open in IMG/M |
3300009137|Ga0066709_100472858 | Not Available | 1759 | Open in IMG/M |
3300009143|Ga0099792_10040664 | Not Available | 2215 | Open in IMG/M |
3300009545|Ga0105237_10870217 | Not Available | 908 | Open in IMG/M |
3300009545|Ga0105237_12060246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 579 | Open in IMG/M |
3300009551|Ga0105238_11032470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 843 | Open in IMG/M |
3300009792|Ga0126374_11531530 | Not Available | 548 | Open in IMG/M |
3300010046|Ga0126384_10104266 | Not Available | 2100 | Open in IMG/M |
3300010046|Ga0126384_11676512 | Not Available | 600 | Open in IMG/M |
3300010048|Ga0126373_10661084 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
3300010048|Ga0126373_11050204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 880 | Open in IMG/M |
3300010048|Ga0126373_12519441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
3300010359|Ga0126376_11172688 | Not Available | 781 | Open in IMG/M |
3300010359|Ga0126376_12622996 | Not Available | 553 | Open in IMG/M |
3300010362|Ga0126377_12936631 | Not Available | 550 | Open in IMG/M |
3300010373|Ga0134128_10130426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2848 | Open in IMG/M |
3300010400|Ga0134122_10020171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans | 5003 | Open in IMG/M |
3300011270|Ga0137391_11358393 | Not Available | 557 | Open in IMG/M |
3300012189|Ga0137388_10694455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
3300012206|Ga0137380_11726182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 510 | Open in IMG/M |
3300012210|Ga0137378_11672983 | Not Available | 543 | Open in IMG/M |
3300012211|Ga0137377_11959473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
3300012356|Ga0137371_10472863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 969 | Open in IMG/M |
3300012357|Ga0137384_11480259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
3300012358|Ga0137368_10848569 | Not Available | 561 | Open in IMG/M |
3300012361|Ga0137360_11568041 | Not Available | 563 | Open in IMG/M |
3300012363|Ga0137390_10668635 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300012474|Ga0157356_1003646 | Not Available | 806 | Open in IMG/M |
3300012499|Ga0157350_1042790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
3300012917|Ga0137395_10512565 | Not Available | 864 | Open in IMG/M |
3300012918|Ga0137396_10187196 | Not Available | 1519 | Open in IMG/M |
3300012924|Ga0137413_11380845 | Not Available | 568 | Open in IMG/M |
3300012948|Ga0126375_12085431 | Not Available | 503 | Open in IMG/M |
3300012951|Ga0164300_10477424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
3300012957|Ga0164303_10189613 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1128 | Open in IMG/M |
3300012984|Ga0164309_11586116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 561 | Open in IMG/M |
3300012984|Ga0164309_11835684 | Not Available | 520 | Open in IMG/M |
3300013307|Ga0157372_11655685 | Not Available | 736 | Open in IMG/M |
3300015241|Ga0137418_11288487 | Not Available | 510 | Open in IMG/M |
3300015245|Ga0137409_10239238 | Not Available | 1617 | Open in IMG/M |
3300016270|Ga0182036_10368492 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
3300016341|Ga0182035_10091202 | Not Available | 2206 | Open in IMG/M |
3300016357|Ga0182032_11021584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
3300016357|Ga0182032_11927758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 518 | Open in IMG/M |
3300016371|Ga0182034_11719871 | Not Available | 552 | Open in IMG/M |
3300016445|Ga0182038_11748869 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
3300017970|Ga0187783_10098919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2150 | Open in IMG/M |
3300017975|Ga0187782_11086123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
3300018064|Ga0187773_10226090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1010 | Open in IMG/M |
3300018468|Ga0066662_12896323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 509 | Open in IMG/M |
3300020080|Ga0206350_10253160 | Not Available | 701 | Open in IMG/M |
3300020583|Ga0210401_11499821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 531 | Open in IMG/M |
3300021178|Ga0210408_11426680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 521 | Open in IMG/M |
3300021374|Ga0213881_10268488 | Not Available | 759 | Open in IMG/M |
3300021406|Ga0210386_11740615 | Not Available | 514 | Open in IMG/M |
3300024347|Ga0179591_1007241 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
3300025885|Ga0207653_10380847 | Not Available | 552 | Open in IMG/M |
3300025898|Ga0207692_10032720 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
3300025905|Ga0207685_10086887 | Not Available | 1308 | Open in IMG/M |
3300025910|Ga0207684_10379694 | Not Available | 1215 | Open in IMG/M |
3300025917|Ga0207660_10475703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1012 | Open in IMG/M |
3300025918|Ga0207662_10980604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
3300025921|Ga0207652_11845449 | Not Available | 510 | Open in IMG/M |
3300025929|Ga0207664_10416570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1196 | Open in IMG/M |
3300025934|Ga0207686_11592518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
3300025935|Ga0207709_11350378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 590 | Open in IMG/M |
3300025938|Ga0207704_10404544 | Not Available | 1078 | Open in IMG/M |
3300025939|Ga0207665_10028653 | All Organisms → cellular organisms → Bacteria | 3679 | Open in IMG/M |
3300025949|Ga0207667_12148318 | Not Available | 516 | Open in IMG/M |
3300026035|Ga0207703_11393960 | Not Available | 674 | Open in IMG/M |
3300026075|Ga0207708_10122878 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2024 | Open in IMG/M |
3300026075|Ga0207708_10171538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1718 | Open in IMG/M |
3300026285|Ga0209438_1144942 | Not Available | 627 | Open in IMG/M |
3300026341|Ga0257151_1038196 | Not Available | 519 | Open in IMG/M |
3300026475|Ga0257147_1050174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 622 | Open in IMG/M |
3300026524|Ga0209690_1285899 | Not Available | 521 | Open in IMG/M |
3300026911|Ga0209620_1000632 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
3300027071|Ga0209214_1046717 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
3300027725|Ga0209178_1289568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 600 | Open in IMG/M |
3300027787|Ga0209074_10046502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1311 | Open in IMG/M |
3300027787|Ga0209074_10456372 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 547 | Open in IMG/M |
3300027787|Ga0209074_10531238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 515 | Open in IMG/M |
3300027862|Ga0209701_10365535 | Not Available | 813 | Open in IMG/M |
3300027862|Ga0209701_10367585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 810 | Open in IMG/M |
3300027874|Ga0209465_10048988 | Not Available | 2019 | Open in IMG/M |
3300027875|Ga0209283_10903982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300027903|Ga0209488_10277136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1255 | Open in IMG/M |
3300027903|Ga0209488_11202501 | Not Available | 510 | Open in IMG/M |
3300028791|Ga0307290_10113538 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 990 | Open in IMG/M |
3300028828|Ga0307312_10292298 | Not Available | 1060 | Open in IMG/M |
3300028828|Ga0307312_10817836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 617 | Open in IMG/M |
3300030511|Ga0268241_10062510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 816 | Open in IMG/M |
3300030815|Ga0265746_1006404 | Not Available | 1239 | Open in IMG/M |
3300031170|Ga0307498_10141475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 789 | Open in IMG/M |
3300031640|Ga0318555_10370058 | Not Available | 776 | Open in IMG/M |
3300031713|Ga0318496_10289179 | Not Available | 904 | Open in IMG/M |
3300031718|Ga0307474_11190087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 603 | Open in IMG/M |
3300031723|Ga0318493_10153336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1193 | Open in IMG/M |
3300031723|Ga0318493_10745071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 550 | Open in IMG/M |
3300031724|Ga0318500_10051458 | Not Available | 1750 | Open in IMG/M |
3300031751|Ga0318494_10424041 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 773 | Open in IMG/M |
3300031779|Ga0318566_10181546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1044 | Open in IMG/M |
3300031893|Ga0318536_10642599 | Not Available | 529 | Open in IMG/M |
3300031954|Ga0306926_12721802 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 536 | Open in IMG/M |
3300032001|Ga0306922_11761048 | Not Available | 611 | Open in IMG/M |
3300032054|Ga0318570_10564835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 519 | Open in IMG/M |
3300032054|Ga0318570_10568006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 517 | Open in IMG/M |
3300032064|Ga0318510_10230942 | Not Available | 755 | Open in IMG/M |
3300032067|Ga0318524_10653737 | Not Available | 554 | Open in IMG/M |
3300032094|Ga0318540_10636519 | Not Available | 514 | Open in IMG/M |
3300032783|Ga0335079_10632587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1125 | Open in IMG/M |
3300033433|Ga0326726_10129536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2285 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.33% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.16% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.48% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.79% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.11% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.74% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.05% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.05% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.37% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.37% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.37% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.37% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.37% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.37% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.68% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.68% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.68% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.68% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573002 | Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005905 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105 | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012474 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610 | Environmental | Open in IMG/M |
3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026341 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A | Environmental | Open in IMG/M |
3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300030511 | Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2) | Environmental | Open in IMG/M |
3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FE1_06742230 | 2189573002 | Grass Soil | LPDRRKDLKVQSTLLASALGFPEGPTILGDGRIVLCDGNTGELLVYDNGAISAYARTG |
JGI25614J43888_100348381 | 3300002906 | Grasslands Soil | MESSLLASGLGFPEGPTVLGDGRIVLCDGNTGELLAYQDGNMS |
JGI25616J43925_102569572 | 3300002917 | Grasslands Soil | MESSLLASGLGFPEGPTVLGDGRIVLCDGNTGELLAYQDGNMSLFARTGGS |
Ga0062595_1011029251 | 3300004479 | Soil | VQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYRNGDVSTYARTGGSPW |
Ga0066388_1041287982 | 3300005332 | Tropical Forest Soil | VQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAYHDG |
Ga0070709_101819852 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | VQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELLVYDNGAIS |
Ga0070713_1002794362 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LPDRRKDLKVQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELLVY |
Ga0070710_102749861 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VHGTLLAPKVGFAEGPVVMPDGAVVFCDGNTGELLRWHDG |
Ga0070710_109168451 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | LPDRRKDLKVQSTLLASGLGFPEGPTILGDGRIVLCDGNT |
Ga0066689_106444551 | 3300005447 | Soil | VQSTLLASGLGFPEGPTILGDGRVVLCDGNTGELLVYDNGAVSAYART |
Ga0070681_117619741 | 3300005458 | Corn Rhizosphere | MDARLLAAGLGFPEGPTVMPDGRLVFCDGNIGELSIYADG |
Ga0066661_104030001 | 3300005554 | Soil | LQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNGTISTYAR |
Ga0066694_105063382 | 3300005574 | Soil | VQSTLLASGLGFPEGPTILGDGRVVLCDGNTGELLVYDNGA |
Ga0066708_105290272 | 3300005576 | Soil | MNTRLLASDLGFPEGPVVLPDDRLVFCDGNIGELS |
Ga0066905_1001645541 | 3300005713 | Tropical Forest Soil | VQSTLLASGLGFPEGPAIMGDGRIVLCDGNTGELLAY |
Ga0066903_1018411921 | 3300005764 | Tropical Forest Soil | VQSTLLASGLGFPEGPAILGDGRIVLCDGNTGELLA |
Ga0068851_101032032 | 3300005834 | Corn Rhizosphere | VDATLLAPDLGFPEGPVVMPDGAIVFCDGNTGELRSWK |
Ga0075269_100701421 | 3300005905 | Rice Paddy Soil | MLGTLLASGLGFPEGPTVLPDGRIVLCDGNTGELLAWAD |
Ga0070717_115093181 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LQSTLLASGLGFTEGPTILGDGRIVLCDGNTGELLVYDSDAVS |
Ga0066696_109899572 | 3300006032 | Soil | VESTLLASGLGFPEGPAVLGDGRIVLCDGNTGELLAYADG |
Ga0070715_103549331 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MPMPSVQLASGLGFPEGPAIMGDGRIVICDGNTGELLAYQDGA |
Ga0074050_120456911 | 3300006577 | Soil | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYANGA |
Ga0079221_103114731 | 3300006804 | Agricultural Soil | LESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADGSVST |
Ga0079220_102123852 | 3300006806 | Agricultural Soil | LDSTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADG |
Ga0075425_1008633552 | 3300006854 | Populus Rhizosphere | LQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNGAISTYAR |
Ga0075425_1020194642 | 3300006854 | Populus Rhizosphere | LQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELL |
Ga0075425_1029145891 | 3300006854 | Populus Rhizosphere | MNGRLLASDLGFPEGPVVMPDGRLVFCDGNIGQLLAW |
Ga0075434_1009560522 | 3300006871 | Populus Rhizosphere | VEATLLAAGLGFPEGPVVLGDGGIVFCDGNVGELLVYKDGAAAT |
Ga0075434_1023420402 | 3300006871 | Populus Rhizosphere | LQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNGAISAYARTGGSPWGT |
Ga0075426_105846771 | 3300006903 | Populus Rhizosphere | MATTLLASDLGFPEGPVVLPDGRLIFCDGNVGELLI |
Ga0099795_100514762 | 3300007788 | Vadose Zone Soil | LPDRRKDLKVQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELLVYDNGAVSAY |
Ga0099830_105234781 | 3300009088 | Vadose Zone Soil | MSMKYSLLASSLGFPEGPAIMGNGRIVLCDGNTGELLANDDGKVSRYAFTGGSPW |
Ga0066709_1004728582 | 3300009137 | Grasslands Soil | MKANLLASDLGFPEGPVVMLDGRIVFCDGNVGELLAYESGR |
Ga0099792_100406641 | 3300009143 | Vadose Zone Soil | MESSLLASGLGFPEGPTVLGDGRIVLCDGNTGELLAYQDGNMSLFART |
Ga0075423_101703891 | 3300009162 | Populus Rhizosphere | VESRQLAAGLGFPEGPTVLSDGRLVFCDGNIGELSLYADGAVS |
Ga0105237_108702171 | 3300009545 | Corn Rhizosphere | VQGRQLASGLGFPEGPVDMGDGRIVFCDGNTGEMLVWDGTK |
Ga0105237_120602462 | 3300009545 | Corn Rhizosphere | VDATLLAPDLGFPEGPVVLPDGAIVFCDGNTGELRSW |
Ga0105238_110324701 | 3300009551 | Corn Rhizosphere | VQGTRLASDLGFPEGPVVMPDGGIVFCDGNTGELL |
Ga0126374_115315301 | 3300009792 | Tropical Forest Soil | VQSTLLASGLGFPEGPTILGDGRVVLCDGNTGELLVYDNG |
Ga0126384_101042663 | 3300010046 | Tropical Forest Soil | MTHKADLLASGLGFPERPVVMGDGRIVLCDGNTG* |
Ga0126384_116765121 | 3300010046 | Tropical Forest Soil | VESTLLASGLGFPEGPAVLDDERLVLCDGNTGELLVYRNGTTSTYA |
Ga0126373_106610841 | 3300010048 | Tropical Forest Soil | VQSTLLASALGFPEGPAIMGDGRVVLCDGNTGELLAYHDGDV |
Ga0126373_110502042 | 3300010048 | Tropical Forest Soil | MRSTLLASGLGFPEGPAVLAGGRIVLCDGNVGELLEYADGRTT |
Ga0126373_125194411 | 3300010048 | Tropical Forest Soil | LESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYADG |
Ga0126376_111726881 | 3300010359 | Tropical Forest Soil | MKSTLLASGLGFPEGPVVMGDGRIVLSDGNTGELLVYAAGTVSTYAHTGGS |
Ga0126376_126229962 | 3300010359 | Tropical Forest Soil | LQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNGAISAYARTGGSPW |
Ga0126377_129366311 | 3300010362 | Tropical Forest Soil | MLASGLGFPEGPAVMGDGRLVFCDGNTGELLVYASGEVSTYARTGGSP |
Ga0134128_101304265 | 3300010373 | Terrestrial Soil | VQGRQLASGLGFPEGPVDMGDGRIVCCDGNTGEMLVWDGTGV* |
Ga0134122_100201715 | 3300010400 | Terrestrial Soil | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYD |
Ga0137391_113583932 | 3300011270 | Vadose Zone Soil | LDASLLASGLGFPEGPTLMPDGRIVLCDGNTGELFAYH |
Ga0137388_106944552 | 3300012189 | Vadose Zone Soil | VQPTLLASDLGFPEGPVIMRDGAVVFCDGNTGELR |
Ga0137380_117261822 | 3300012206 | Vadose Zone Soil | VEATLLASGLGFPEGPVVLPDGGIVFCDGNIGELSVYGDG |
Ga0137378_116729831 | 3300012210 | Vadose Zone Soil | VQSTLLASGLGFPEGPTILGDGRVVLCDGNTGELLVYDNGAVSAYAR |
Ga0137377_119594732 | 3300012211 | Vadose Zone Soil | LESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYADGRVSTYA |
Ga0137371_104728631 | 3300012356 | Vadose Zone Soil | VQSTTLLASGLGFPEGPAIMGDGRIVLCDGNTGELLAYQDGDVSTYARTGGS |
Ga0137384_114802591 | 3300012357 | Vadose Zone Soil | MNARLLASDLGFPEGPVVFADGRLVFCDGNIGELS |
Ga0137368_108485691 | 3300012358 | Vadose Zone Soil | VKASLLADGLGFPEGPVVMGDGRLVLCDGNVGELLSY |
Ga0137360_115680412 | 3300012361 | Vadose Zone Soil | MPTKSIQLASGLGFPEGPAVMGDGRIVLCDGNTGELLAY |
Ga0137390_106686352 | 3300012363 | Vadose Zone Soil | MSMQYSLLASGLGFPEGPAIMGDGRIVLCDGNTGELLAYDDGKVSRYAFTGGSP |
Ga0157356_10036461 | 3300012474 | Unplanted Soil | VQSTLLASGLGFPEGPTILADGRVVLCDGNTGELLV |
Ga0157350_10427901 | 3300012499 | Unplanted Soil | VESTLLASGLGFPEGPAVLGDGRIVLCDGNTGELL |
Ga0137395_105125652 | 3300012917 | Vadose Zone Soil | MSMQYSLLASGLGFPEGPAIMGDGRIVLCDGNTGELLAYD |
Ga0137396_101871962 | 3300012918 | Vadose Zone Soil | MEATLLASGLGFPEGPVVMPDGRIVFCDGNVGELLVYQ |
Ga0137394_114462861 | 3300012922 | Vadose Zone Soil | MNGRLLASDLGFPEGPVVLPDGRLVFCDGNIGELSVY |
Ga0137413_113808452 | 3300012924 | Vadose Zone Soil | VQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELLVYDNGAISAYARTGG |
Ga0137407_104655872 | 3300012930 | Vadose Zone Soil | MNGRLLASDLGFPEGPVVLPDGRLVFCDGNIGELCV |
Ga0126375_120854312 | 3300012948 | Tropical Forest Soil | MQTSLLASGLGFPEGPTVLGDGRIVLCGGNTGELLAYSGGAMSLFALTGGSPWGT |
Ga0164300_104774241 | 3300012951 | Soil | VDATLLASDLGFPEGPVVMPDGSIVLCDGNTGELRSWKDGA |
Ga0164303_101896131 | 3300012957 | Soil | VQGTLLRSGLGFPEGPVVMPDASIVFCDGNTGELLRYAG |
Ga0164309_115861161 | 3300012984 | Soil | VNATLLASDLGFPEGPVVMPDGAIVFCDGNTGELL |
Ga0164309_118356841 | 3300012984 | Soil | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLV |
Ga0157372_116556852 | 3300013307 | Corn Rhizosphere | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVY |
Ga0137418_112884872 | 3300015241 | Vadose Zone Soil | MESSLLASGLGFPEGPTVLGDGRIVLCDGNTGELLAYQDGNM |
Ga0137409_102392382 | 3300015245 | Vadose Zone Soil | VQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELL |
Ga0182036_103684921 | 3300016270 | Soil | VQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGGVSTYARTGGSPW |
Ga0182035_100912021 | 3300016341 | Soil | VQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGGVSTYARTG |
Ga0182032_110215842 | 3300016357 | Soil | LESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADGG |
Ga0182032_119277582 | 3300016357 | Soil | VQSTLLAASLGFPEGPAIMGDGRVVLCDGNTGELLAYQ |
Ga0182034_117198711 | 3300016371 | Soil | VQSTLLASSLGFPEGPAVMGDGRVVLCDGNTGELLAYQDGGVSTYARTGGSPW |
Ga0182038_117488692 | 3300016445 | Soil | VQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAYRDGDVSTYARTGGSPW |
Ga0187783_100989193 | 3300017970 | Tropical Peatland | MQSTRLASGLGFPEGPAIMGDGRIVLCDGNTGELLAYRSGTVSTYAHT |
Ga0187782_110861232 | 3300017975 | Tropical Peatland | MPVTATLLASGLGFPEGPVIVTDGRVVFCEGTTGELLI |
Ga0187773_102260901 | 3300018064 | Tropical Peatland | LESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELL |
Ga0066662_128963232 | 3300018468 | Grasslands Soil | VEATQLASGLGFPEGPVVMPDGSIVFCDGNTGQMLRWAD |
Ga0206350_102531602 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNG |
Ga0210401_114998211 | 3300020583 | Soil | LYANATLLASGLGFPEGPAVMGDGRVVFCDGNTGELLVRADGSVSTYARTG |
Ga0210408_114266802 | 3300021178 | Soil | LESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELL |
Ga0213881_102684881 | 3300021374 | Exposed Rock | MPHKADLLASGLGFPEGPVVMGDGRIVLCDGNTGELLAYSGGTVSSFA |
Ga0210386_117406152 | 3300021406 | Soil | LQSDLLASGLGFPEGPAVLGDGRIVLCDGNTGELLAYRD |
Ga0179591_10072411 | 3300024347 | Vadose Zone Soil | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDSGAV |
Ga0207653_103808471 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSTLLASGLGFPEGPVVMSDGRIVLCDGNTGQLLVYQGGTVSSHAHT |
Ga0207692_100327201 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNG |
Ga0207685_100868872 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAV |
Ga0207684_103796942 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MKSTLLASGLGFPEGPVVMSDGRIVLCDGNTGELLVYQGGT |
Ga0207660_104757031 | 3300025917 | Corn Rhizosphere | LESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADGSVSTYAHTG |
Ga0207662_109806041 | 3300025918 | Switchgrass Rhizosphere | LESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADGSV |
Ga0207652_118454491 | 3300025921 | Corn Rhizosphere | MESSLLASGLGFPEGPTVLGDGRIVLCDANTGELLAYRDGSLSLFARTGGS |
Ga0207664_104165702 | 3300025929 | Agricultural Soil | VQGTLLASNLGFPEGPVVMPDGAIVLCDGNTGELLV |
Ga0207686_115925181 | 3300025934 | Miscanthus Rhizosphere | VQGTRLASDLGFPEGPVVMPDGGIVFCDGNTGELLQWKG |
Ga0207709_113503781 | 3300025935 | Miscanthus Rhizosphere | VQGTLLASNLGFPEGPVVMPDGAIVLCDGNTGEMKVW |
Ga0207704_104045441 | 3300025938 | Miscanthus Rhizosphere | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSAYA |
Ga0207665_100286534 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNGAISTYTRTGGS |
Ga0207667_121483181 | 3300025949 | Corn Rhizosphere | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSAY |
Ga0207703_113939601 | 3300026035 | Switchgrass Rhizosphere | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSAYAR |
Ga0207708_101228782 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSAYARP |
Ga0207708_101715382 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | VQRTLLASNLGFPEGPVVMPDGAIVLCDGNTGELLVWKD |
Ga0209438_11449421 | 3300026285 | Grasslands Soil | MESSLLASGLGFPEGPTVLGDGRIVLCDGNTGELLAYQDGNMSLFASTG |
Ga0257151_10381961 | 3300026341 | Soil | MSMQYSLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYA |
Ga0257147_10501741 | 3300026475 | Soil | LESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADGSVSTYAHT |
Ga0209690_12858991 | 3300026524 | Soil | MKANLLASDLGFPEGPVVMLDGRIVFCDGNVGELLAYES |
Ga0209620_10006323 | 3300026911 | Forest Soil | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSAYARTG |
Ga0209214_10467172 | 3300027071 | Forest Soil | LESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADG |
Ga0209178_12895682 | 3300027725 | Agricultural Soil | VQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELLVY |
Ga0209074_100465022 | 3300027787 | Agricultural Soil | VQSTLLASGLGFPEGPTILSDGRIVLCDGNTGELLVYDNGAISAYARTG |
Ga0209074_104563722 | 3300027787 | Agricultural Soil | VDATLLAPDLGFPEGPVVMPDGAIVFCDGNTGELRS |
Ga0209074_105312381 | 3300027787 | Agricultural Soil | MQTSLLASGLGFPEGPTVLGDGRIVLCDANTGELLAYQEGGLSL |
Ga0209701_103655352 | 3300027862 | Vadose Zone Soil | VQSTLLASGLGFPEGPAVLGDGRIVLCDGNVGELLAYEDGSTSTYARTG |
Ga0209701_103675851 | 3300027862 | Vadose Zone Soil | MEATLLASGLGFPEGPLVMPDGRIVFCDGNVGELLV |
Ga0209465_100489881 | 3300027874 | Tropical Forest Soil | VQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGGVSTYARTGG |
Ga0209283_109039822 | 3300027875 | Vadose Zone Soil | LQSTLLASGLGFAEGPTILGDGRIVLCDGNTGELLVYDSDAVSTYARTGGSPWGTVLG |
Ga0209488_102771361 | 3300027903 | Vadose Zone Soil | VQGTLLRLGLGFPEGPVVMPDGSIVICDGNTGELLRYSEG |
Ga0209488_112025011 | 3300027903 | Vadose Zone Soil | LQSTLLASGLGFAEGPAILGDGRIVLCDGNTGELLVHENGAVSTYARTGGS |
Ga0307290_101135381 | 3300028791 | Soil | VQGTLLRSDLGFPEGPVVMPDGTIVFCDGNTGELLRY |
Ga0307312_102922982 | 3300028828 | Soil | VQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSSY |
Ga0307312_108178362 | 3300028828 | Soil | VQGTLLRSDLGFPEGPVVMPDGAIVFCDGNTGELLRY |
Ga0268241_100625101 | 3300030511 | Soil | MQSTQLASGLGFPEGPTVLADGRIVLCDGNTGELLVWADGAM |
Ga0265746_10064042 | 3300030815 | Soil | MDASLQLSGLGFPEGPVVMGDRRLVFCDGNVGELLVYRDGEAA |
Ga0307498_101414752 | 3300031170 | Soil | LESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLA |
Ga0318555_103700582 | 3300031640 | Soil | VQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAY |
Ga0318496_102891792 | 3300031713 | Soil | LITERTLICVQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYQ |
Ga0307474_111900873 | 3300031718 | Hardwood Forest Soil | LYANATLLASGLGFPEGPAVMGDGRVVFCDGNTGELLV |
Ga0318493_101533362 | 3300031723 | Soil | LESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYAGGS |
Ga0318493_107450711 | 3300031723 | Soil | VQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGDVSTYAHTG |
Ga0318500_100514581 | 3300031724 | Soil | LQSTLLASGLGFPEGPAILGDGRIVLCDGNTGELLAYENGTIST |
Ga0318494_104240412 | 3300031751 | Soil | LESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYAGGSVSTYA |
Ga0318566_101815461 | 3300031779 | Soil | VQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGDVSTYAHT |
Ga0318536_106425992 | 3300031893 | Soil | VQSTLLASGLGFPEGPAIMGDGRIVFCDGNIGELLAYKDGDISTYARTGGSP |
Ga0306926_127218022 | 3300031954 | Soil | VQSTLLAASLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGDVST |
Ga0306922_117610481 | 3300032001 | Soil | VQSTLLASGLGFPEGPAIMGDGRIVFCDGNIGELLAYK |
Ga0318570_105648352 | 3300032054 | Soil | VQSELLASGLGFPEGPAVMGDGRIVLCDGNTGELLAY |
Ga0318570_105680061 | 3300032054 | Soil | LESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYAGGSVSTYAR |
Ga0318510_102309421 | 3300032064 | Soil | VQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGGVSTYARTGGSPWG |
Ga0318524_106537372 | 3300032067 | Soil | LESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYAGGSVS |
Ga0318540_106365191 | 3300032094 | Soil | VQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAYHDGDVSTYARTGGSPW |
Ga0335079_106325871 | 3300032783 | Soil | VESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYAG |
Ga0326726_101295361 | 3300033433 | Peat Soil | VEGTLLASNLGFPEGPVVTPDGSIVICDGNIGELLRWD |
⦗Top⦘ |