NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049967

Metagenome / Metatranscriptome Family F049967

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049967
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 43 residues
Representative Sequence VQSTLLASGLGFPEGPAIMGDGRIVLCDGNTGELLAY
Number of Associated Samples 127
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.58 %
% of genes near scaffold ends (potentially truncated) 94.52 %
% of genes from short scaffolds (< 2000 bps) 87.67 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.274 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(17.808 % of family members)
Environment Ontology (ENVO) Unclassified
(28.082 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(43.836 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 20.00%    Coil/Unstructured: 80.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF00496SBP_bac_5 50.68
PF13417GST_N_3 1.37
PF01522Polysacc_deac_1 0.68
PF08240ADH_N 0.68
PF13360PQQ_2 0.68
PF01979Amidohydro_1 0.68
PF08450SGL 0.68
PF044632-thiour_desulf 0.68
PF12679ABC2_membrane_2 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG0726Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 familyCell wall/membrane/envelope biogenesis [M] 0.68
COG1683Uncharacterized conserved protein YbbK, DUF523 familyFunction unknown [S] 0.68
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.68
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.64 %
UnclassifiedrootN/A38.36 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573002|GZIGXIF01AMZXTAll Organisms → cellular organisms → Bacteria → Terrabacteria group503Open in IMG/M
3300002906|JGI25614J43888_10034838All Organisms → cellular organisms → Bacteria1576Open in IMG/M
3300002917|JGI25616J43925_10256957All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300004479|Ga0062595_101102925All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria694Open in IMG/M
3300005332|Ga0066388_104128798All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300005434|Ga0070709_10181985All Organisms → cellular organisms → Bacteria1476Open in IMG/M
3300005436|Ga0070713_100279436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1531Open in IMG/M
3300005437|Ga0070710_10274986All Organisms → cellular organisms → Bacteria → Proteobacteria1091Open in IMG/M
3300005437|Ga0070710_10916845All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005447|Ga0066689_10644455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300005554|Ga0066661_10403000All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300005574|Ga0066694_10506338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300005713|Ga0066905_100164554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1616Open in IMG/M
3300005764|Ga0066903_101841192All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300005834|Ga0068851_10103203All Organisms → cellular organisms → Bacteria1515Open in IMG/M
3300005905|Ga0075269_10070142All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300006028|Ga0070717_11509318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300006032|Ga0066696_10989957All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300006163|Ga0070715_10354933All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300006577|Ga0074050_12045691All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300006804|Ga0079221_10311473All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300006806|Ga0079220_10212385All Organisms → cellular organisms → Bacteria1127Open in IMG/M
3300006854|Ga0075425_100863355All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1035Open in IMG/M
3300006854|Ga0075425_102019464All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300006854|Ga0075425_102914589All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300006871|Ga0075434_100956052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria871Open in IMG/M
3300006871|Ga0075434_102342040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria537Open in IMG/M
3300006903|Ga0075426_10584677All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300007788|Ga0099795_10051476All Organisms → cellular organisms → Bacteria → Terrabacteria group1501Open in IMG/M
3300009088|Ga0099830_10523478Not Available969Open in IMG/M
3300009137|Ga0066709_100472858Not Available1759Open in IMG/M
3300009143|Ga0099792_10040664Not Available2215Open in IMG/M
3300009545|Ga0105237_10870217Not Available908Open in IMG/M
3300009545|Ga0105237_12060246All Organisms → cellular organisms → Bacteria → Terrabacteria group579Open in IMG/M
3300009551|Ga0105238_11032470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium843Open in IMG/M
3300009792|Ga0126374_11531530Not Available548Open in IMG/M
3300010046|Ga0126384_10104266Not Available2100Open in IMG/M
3300010046|Ga0126384_11676512Not Available600Open in IMG/M
3300010048|Ga0126373_10661084All Organisms → Viruses → Predicted Viral1101Open in IMG/M
3300010048|Ga0126373_11050204All Organisms → cellular organisms → Bacteria → Terrabacteria group880Open in IMG/M
3300010048|Ga0126373_12519441All Organisms → cellular organisms → Bacteria → Terrabacteria group573Open in IMG/M
3300010359|Ga0126376_11172688Not Available781Open in IMG/M
3300010359|Ga0126376_12622996Not Available553Open in IMG/M
3300010362|Ga0126377_12936631Not Available550Open in IMG/M
3300010373|Ga0134128_10130426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2848Open in IMG/M
3300010400|Ga0134122_10020171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → Acidithrix → Acidithrix ferrooxidans5003Open in IMG/M
3300011270|Ga0137391_11358393Not Available557Open in IMG/M
3300012189|Ga0137388_10694455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium945Open in IMG/M
3300012206|Ga0137380_11726182All Organisms → cellular organisms → Bacteria → Terrabacteria group510Open in IMG/M
3300012210|Ga0137378_11672983Not Available543Open in IMG/M
3300012211|Ga0137377_11959473All Organisms → cellular organisms → Bacteria → Terrabacteria group502Open in IMG/M
3300012356|Ga0137371_10472863All Organisms → cellular organisms → Bacteria → Terrabacteria group969Open in IMG/M
3300012357|Ga0137384_11480259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria528Open in IMG/M
3300012358|Ga0137368_10848569Not Available561Open in IMG/M
3300012361|Ga0137360_11568041Not Available563Open in IMG/M
3300012363|Ga0137390_10668635All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300012474|Ga0157356_1003646Not Available806Open in IMG/M
3300012499|Ga0157350_1042790All Organisms → cellular organisms → Bacteria → Terrabacteria group548Open in IMG/M
3300012917|Ga0137395_10512565Not Available864Open in IMG/M
3300012918|Ga0137396_10187196Not Available1519Open in IMG/M
3300012924|Ga0137413_11380845Not Available568Open in IMG/M
3300012948|Ga0126375_12085431Not Available503Open in IMG/M
3300012951|Ga0164300_10477424All Organisms → cellular organisms → Bacteria → Terrabacteria group707Open in IMG/M
3300012957|Ga0164303_10189613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1128Open in IMG/M
3300012984|Ga0164309_11586116All Organisms → cellular organisms → Bacteria → Terrabacteria group561Open in IMG/M
3300012984|Ga0164309_11835684Not Available520Open in IMG/M
3300013307|Ga0157372_11655685Not Available736Open in IMG/M
3300015241|Ga0137418_11288487Not Available510Open in IMG/M
3300015245|Ga0137409_10239238Not Available1617Open in IMG/M
3300016270|Ga0182036_10368492All Organisms → Viruses → Predicted Viral1111Open in IMG/M
3300016341|Ga0182035_10091202Not Available2206Open in IMG/M
3300016357|Ga0182032_11021584All Organisms → cellular organisms → Bacteria → Terrabacteria group707Open in IMG/M
3300016357|Ga0182032_11927758All Organisms → cellular organisms → Bacteria → Terrabacteria group518Open in IMG/M
3300016371|Ga0182034_11719871Not Available552Open in IMG/M
3300016445|Ga0182038_11748869All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300017970|Ga0187783_10098919All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2150Open in IMG/M
3300017975|Ga0187782_11086123All Organisms → cellular organisms → Bacteria → Terrabacteria group624Open in IMG/M
3300018064|Ga0187773_10226090All Organisms → cellular organisms → Bacteria → Terrabacteria group1010Open in IMG/M
3300018468|Ga0066662_12896323All Organisms → cellular organisms → Bacteria → Terrabacteria group509Open in IMG/M
3300020080|Ga0206350_10253160Not Available701Open in IMG/M
3300020583|Ga0210401_11499821All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300021178|Ga0210408_11426680All Organisms → cellular organisms → Bacteria → Terrabacteria group521Open in IMG/M
3300021374|Ga0213881_10268488Not Available759Open in IMG/M
3300021406|Ga0210386_11740615Not Available514Open in IMG/M
3300024347|Ga0179591_1007241All Organisms → cellular organisms → Bacteria2191Open in IMG/M
3300025885|Ga0207653_10380847Not Available552Open in IMG/M
3300025898|Ga0207692_10032720All Organisms → cellular organisms → Bacteria2501Open in IMG/M
3300025905|Ga0207685_10086887Not Available1308Open in IMG/M
3300025910|Ga0207684_10379694Not Available1215Open in IMG/M
3300025917|Ga0207660_10475703All Organisms → cellular organisms → Bacteria → Terrabacteria group1012Open in IMG/M
3300025918|Ga0207662_10980604All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300025921|Ga0207652_11845449Not Available510Open in IMG/M
3300025929|Ga0207664_10416570All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1196Open in IMG/M
3300025934|Ga0207686_11592518All Organisms → cellular organisms → Bacteria → Terrabacteria group539Open in IMG/M
3300025935|Ga0207709_11350378All Organisms → cellular organisms → Bacteria → Terrabacteria group590Open in IMG/M
3300025938|Ga0207704_10404544Not Available1078Open in IMG/M
3300025939|Ga0207665_10028653All Organisms → cellular organisms → Bacteria3679Open in IMG/M
3300025949|Ga0207667_12148318Not Available516Open in IMG/M
3300026035|Ga0207703_11393960Not Available674Open in IMG/M
3300026075|Ga0207708_10122878All Organisms → cellular organisms → Bacteria → Proteobacteria2024Open in IMG/M
3300026075|Ga0207708_10171538All Organisms → cellular organisms → Bacteria → Terrabacteria group1718Open in IMG/M
3300026285|Ga0209438_1144942Not Available627Open in IMG/M
3300026341|Ga0257151_1038196Not Available519Open in IMG/M
3300026475|Ga0257147_1050174All Organisms → cellular organisms → Bacteria → Terrabacteria group622Open in IMG/M
3300026524|Ga0209690_1285899Not Available521Open in IMG/M
3300026911|Ga0209620_1000632All Organisms → cellular organisms → Bacteria2169Open in IMG/M
3300027071|Ga0209214_1046717All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300027725|Ga0209178_1289568All Organisms → cellular organisms → Bacteria → Terrabacteria group600Open in IMG/M
3300027787|Ga0209074_10046502All Organisms → cellular organisms → Bacteria → Terrabacteria group1311Open in IMG/M
3300027787|Ga0209074_10456372All Organisms → cellular organisms → Bacteria → Terrabacteria group547Open in IMG/M
3300027787|Ga0209074_10531238All Organisms → cellular organisms → Bacteria → Terrabacteria group515Open in IMG/M
3300027862|Ga0209701_10365535Not Available813Open in IMG/M
3300027862|Ga0209701_10367585All Organisms → cellular organisms → Bacteria → Terrabacteria group810Open in IMG/M
3300027874|Ga0209465_10048988Not Available2019Open in IMG/M
3300027875|Ga0209283_10903982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300027903|Ga0209488_10277136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1255Open in IMG/M
3300027903|Ga0209488_11202501Not Available510Open in IMG/M
3300028791|Ga0307290_10113538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium990Open in IMG/M
3300028828|Ga0307312_10292298Not Available1060Open in IMG/M
3300028828|Ga0307312_10817836All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium617Open in IMG/M
3300030511|Ga0268241_10062510All Organisms → cellular organisms → Bacteria → Terrabacteria group816Open in IMG/M
3300030815|Ga0265746_1006404Not Available1239Open in IMG/M
3300031170|Ga0307498_10141475All Organisms → cellular organisms → Bacteria → Terrabacteria group789Open in IMG/M
3300031640|Ga0318555_10370058Not Available776Open in IMG/M
3300031713|Ga0318496_10289179Not Available904Open in IMG/M
3300031718|Ga0307474_11190087All Organisms → cellular organisms → Bacteria → Terrabacteria group603Open in IMG/M
3300031723|Ga0318493_10153336All Organisms → cellular organisms → Bacteria → Terrabacteria group1193Open in IMG/M
3300031723|Ga0318493_10745071All Organisms → cellular organisms → Bacteria → Terrabacteria group550Open in IMG/M
3300031724|Ga0318500_10051458Not Available1750Open in IMG/M
3300031751|Ga0318494_10424041All Organisms → cellular organisms → Bacteria → Terrabacteria group773Open in IMG/M
3300031779|Ga0318566_10181546All Organisms → cellular organisms → Bacteria → Terrabacteria group1044Open in IMG/M
3300031893|Ga0318536_10642599Not Available529Open in IMG/M
3300031954|Ga0306926_12721802All Organisms → cellular organisms → Bacteria → Terrabacteria group536Open in IMG/M
3300032001|Ga0306922_11761048Not Available611Open in IMG/M
3300032054|Ga0318570_10564835All Organisms → cellular organisms → Bacteria → Terrabacteria group519Open in IMG/M
3300032054|Ga0318570_10568006All Organisms → cellular organisms → Bacteria → Terrabacteria group517Open in IMG/M
3300032064|Ga0318510_10230942Not Available755Open in IMG/M
3300032067|Ga0318524_10653737Not Available554Open in IMG/M
3300032094|Ga0318540_10636519Not Available514Open in IMG/M
3300032783|Ga0335079_10632587All Organisms → cellular organisms → Bacteria → Terrabacteria group1125Open in IMG/M
3300033433|Ga0326726_10129536All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2285Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil17.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.33%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.16%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.48%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.11%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.74%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.05%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.05%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.37%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.37%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil1.37%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.37%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.37%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.68%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.68%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.68%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573002Grass soil microbial communities from Rothamsted Park, UK - FE1 (NaCl 30g/L 5ml)EnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005574Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005905Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_105EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012474Unplanted soil (control) microbial communities from North Carolina - M.Soil.3.yng.040610EnvironmentalOpen in IMG/M
3300012499Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610EnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020080Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021374Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08EnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025885Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026341Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-AEnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026524Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes)EnvironmentalOpen in IMG/M
3300026911Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027071Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300030815Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FE1_067422302189573002Grass SoilLPDRRKDLKVQSTLLASALGFPEGPTILGDGRIVLCDGNTGELLVYDNGAISAYARTG
JGI25614J43888_1003483813300002906Grasslands SoilMESSLLASGLGFPEGPTVLGDGRIVLCDGNTGELLAYQDGNMS
JGI25616J43925_1025695723300002917Grasslands SoilMESSLLASGLGFPEGPTVLGDGRIVLCDGNTGELLAYQDGNMSLFARTGGS
Ga0062595_10110292513300004479SoilVQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYRNGDVSTYARTGGSPW
Ga0066388_10412879823300005332Tropical Forest SoilVQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAYHDG
Ga0070709_1018198523300005434Corn, Switchgrass And Miscanthus RhizosphereVQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELLVYDNGAIS
Ga0070713_10027943623300005436Corn, Switchgrass And Miscanthus RhizosphereLPDRRKDLKVQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELLVY
Ga0070710_1027498613300005437Corn, Switchgrass And Miscanthus RhizosphereVHGTLLAPKVGFAEGPVVMPDGAVVFCDGNTGELLRWHDG
Ga0070710_1091684513300005437Corn, Switchgrass And Miscanthus RhizosphereLPDRRKDLKVQSTLLASGLGFPEGPTILGDGRIVLCDGNT
Ga0066689_1064445513300005447SoilVQSTLLASGLGFPEGPTILGDGRVVLCDGNTGELLVYDNGAVSAYART
Ga0070681_1176197413300005458Corn RhizosphereMDARLLAAGLGFPEGPTVMPDGRLVFCDGNIGELSIYADG
Ga0066661_1040300013300005554SoilLQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNGTISTYAR
Ga0066694_1050633823300005574SoilVQSTLLASGLGFPEGPTILGDGRVVLCDGNTGELLVYDNGA
Ga0066708_1052902723300005576SoilMNTRLLASDLGFPEGPVVLPDDRLVFCDGNIGELS
Ga0066905_10016455413300005713Tropical Forest SoilVQSTLLASGLGFPEGPAIMGDGRIVLCDGNTGELLAY
Ga0066903_10184119213300005764Tropical Forest SoilVQSTLLASGLGFPEGPAILGDGRIVLCDGNTGELLA
Ga0068851_1010320323300005834Corn RhizosphereVDATLLAPDLGFPEGPVVMPDGAIVFCDGNTGELRSWK
Ga0075269_1007014213300005905Rice Paddy SoilMLGTLLASGLGFPEGPTVLPDGRIVLCDGNTGELLAWAD
Ga0070717_1150931813300006028Corn, Switchgrass And Miscanthus RhizosphereLQSTLLASGLGFTEGPTILGDGRIVLCDGNTGELLVYDSDAVS
Ga0066696_1098995723300006032SoilVESTLLASGLGFPEGPAVLGDGRIVLCDGNTGELLAYADG
Ga0070715_1035493313300006163Corn, Switchgrass And Miscanthus RhizosphereMPMPSVQLASGLGFPEGPAIMGDGRIVICDGNTGELLAYQDGA
Ga0074050_1204569113300006577SoilVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYANGA
Ga0079221_1031147313300006804Agricultural SoilLESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADGSVST
Ga0079220_1021238523300006806Agricultural SoilLDSTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADG
Ga0075425_10086335523300006854Populus RhizosphereLQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNGAISTYAR
Ga0075425_10201946423300006854Populus RhizosphereLQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELL
Ga0075425_10291458913300006854Populus RhizosphereMNGRLLASDLGFPEGPVVMPDGRLVFCDGNIGQLLAW
Ga0075434_10095605223300006871Populus RhizosphereVEATLLAAGLGFPEGPVVLGDGGIVFCDGNVGELLVYKDGAAAT
Ga0075434_10234204023300006871Populus RhizosphereLQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNGAISAYARTGGSPWGT
Ga0075426_1058467713300006903Populus RhizosphereMATTLLASDLGFPEGPVVLPDGRLIFCDGNVGELLI
Ga0099795_1005147623300007788Vadose Zone SoilLPDRRKDLKVQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELLVYDNGAVSAY
Ga0099830_1052347813300009088Vadose Zone SoilMSMKYSLLASSLGFPEGPAIMGNGRIVLCDGNTGELLANDDGKVSRYAFTGGSPW
Ga0066709_10047285823300009137Grasslands SoilMKANLLASDLGFPEGPVVMLDGRIVFCDGNVGELLAYESGR
Ga0099792_1004066413300009143Vadose Zone SoilMESSLLASGLGFPEGPTVLGDGRIVLCDGNTGELLAYQDGNMSLFART
Ga0075423_1017038913300009162Populus RhizosphereVESRQLAAGLGFPEGPTVLSDGRLVFCDGNIGELSLYADGAVS
Ga0105237_1087021713300009545Corn RhizosphereVQGRQLASGLGFPEGPVDMGDGRIVFCDGNTGEMLVWDGTK
Ga0105237_1206024623300009545Corn RhizosphereVDATLLAPDLGFPEGPVVLPDGAIVFCDGNTGELRSW
Ga0105238_1103247013300009551Corn RhizosphereVQGTRLASDLGFPEGPVVMPDGGIVFCDGNTGELL
Ga0126374_1153153013300009792Tropical Forest SoilVQSTLLASGLGFPEGPTILGDGRVVLCDGNTGELLVYDNG
Ga0126384_1010426633300010046Tropical Forest SoilMTHKADLLASGLGFPERPVVMGDGRIVLCDGNTG*
Ga0126384_1167651213300010046Tropical Forest SoilVESTLLASGLGFPEGPAVLDDERLVLCDGNTGELLVYRNGTTSTYA
Ga0126373_1066108413300010048Tropical Forest SoilVQSTLLASALGFPEGPAIMGDGRVVLCDGNTGELLAYHDGDV
Ga0126373_1105020423300010048Tropical Forest SoilMRSTLLASGLGFPEGPAVLAGGRIVLCDGNVGELLEYADGRTT
Ga0126373_1251944113300010048Tropical Forest SoilLESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYADG
Ga0126376_1117268813300010359Tropical Forest SoilMKSTLLASGLGFPEGPVVMGDGRIVLSDGNTGELLVYAAGTVSTYAHTGGS
Ga0126376_1262299623300010359Tropical Forest SoilLQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNGAISAYARTGGSPW
Ga0126377_1293663113300010362Tropical Forest SoilMLASGLGFPEGPAVMGDGRLVFCDGNTGELLVYASGEVSTYARTGGSP
Ga0134128_1013042653300010373Terrestrial SoilVQGRQLASGLGFPEGPVDMGDGRIVCCDGNTGEMLVWDGTGV*
Ga0134122_1002017153300010400Terrestrial SoilVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYD
Ga0137391_1135839323300011270Vadose Zone SoilLDASLLASGLGFPEGPTLMPDGRIVLCDGNTGELFAYH
Ga0137388_1069445523300012189Vadose Zone SoilVQPTLLASDLGFPEGPVIMRDGAVVFCDGNTGELR
Ga0137380_1172618223300012206Vadose Zone SoilVEATLLASGLGFPEGPVVLPDGGIVFCDGNIGELSVYGDG
Ga0137378_1167298313300012210Vadose Zone SoilVQSTLLASGLGFPEGPTILGDGRVVLCDGNTGELLVYDNGAVSAYAR
Ga0137377_1195947323300012211Vadose Zone SoilLESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYADGRVSTYA
Ga0137371_1047286313300012356Vadose Zone SoilVQSTTLLASGLGFPEGPAIMGDGRIVLCDGNTGELLAYQDGDVSTYARTGGS
Ga0137384_1148025913300012357Vadose Zone SoilMNARLLASDLGFPEGPVVFADGRLVFCDGNIGELS
Ga0137368_1084856913300012358Vadose Zone SoilVKASLLADGLGFPEGPVVMGDGRLVLCDGNVGELLSY
Ga0137360_1156804123300012361Vadose Zone SoilMPTKSIQLASGLGFPEGPAVMGDGRIVLCDGNTGELLAY
Ga0137390_1066863523300012363Vadose Zone SoilMSMQYSLLASGLGFPEGPAIMGDGRIVLCDGNTGELLAYDDGKVSRYAFTGGSP
Ga0157356_100364613300012474Unplanted SoilVQSTLLASGLGFPEGPTILADGRVVLCDGNTGELLV
Ga0157350_104279013300012499Unplanted SoilVESTLLASGLGFPEGPAVLGDGRIVLCDGNTGELL
Ga0137395_1051256523300012917Vadose Zone SoilMSMQYSLLASGLGFPEGPAIMGDGRIVLCDGNTGELLAYD
Ga0137396_1018719623300012918Vadose Zone SoilMEATLLASGLGFPEGPVVMPDGRIVFCDGNVGELLVYQ
Ga0137394_1144628613300012922Vadose Zone SoilMNGRLLASDLGFPEGPVVLPDGRLVFCDGNIGELSVY
Ga0137413_1138084523300012924Vadose Zone SoilVQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELLVYDNGAISAYARTGG
Ga0137407_1046558723300012930Vadose Zone SoilMNGRLLASDLGFPEGPVVLPDGRLVFCDGNIGELCV
Ga0126375_1208543123300012948Tropical Forest SoilMQTSLLASGLGFPEGPTVLGDGRIVLCGGNTGELLAYSGGAMSLFALTGGSPWGT
Ga0164300_1047742413300012951SoilVDATLLASDLGFPEGPVVMPDGSIVLCDGNTGELRSWKDGA
Ga0164303_1018961313300012957SoilVQGTLLRSGLGFPEGPVVMPDASIVFCDGNTGELLRYAG
Ga0164309_1158611613300012984SoilVNATLLASDLGFPEGPVVMPDGAIVFCDGNTGELL
Ga0164309_1183568413300012984SoilVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLV
Ga0157372_1165568523300013307Corn RhizosphereVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVY
Ga0137418_1128848723300015241Vadose Zone SoilMESSLLASGLGFPEGPTVLGDGRIVLCDGNTGELLAYQDGNM
Ga0137409_1023923823300015245Vadose Zone SoilVQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELL
Ga0182036_1036849213300016270SoilVQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGGVSTYARTGGSPW
Ga0182035_1009120213300016341SoilVQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGGVSTYARTG
Ga0182032_1102158423300016357SoilLESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADGG
Ga0182032_1192775823300016357SoilVQSTLLAASLGFPEGPAIMGDGRVVLCDGNTGELLAYQ
Ga0182034_1171987113300016371SoilVQSTLLASSLGFPEGPAVMGDGRVVLCDGNTGELLAYQDGGVSTYARTGGSPW
Ga0182038_1174886923300016445SoilVQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAYRDGDVSTYARTGGSPW
Ga0187783_1009891933300017970Tropical PeatlandMQSTRLASGLGFPEGPAIMGDGRIVLCDGNTGELLAYRSGTVSTYAHT
Ga0187782_1108612323300017975Tropical PeatlandMPVTATLLASGLGFPEGPVIVTDGRVVFCEGTTGELLI
Ga0187773_1022609013300018064Tropical PeatlandLESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELL
Ga0066662_1289632323300018468Grasslands SoilVEATQLASGLGFPEGPVVMPDGSIVFCDGNTGQMLRWAD
Ga0206350_1025316023300020080Corn, Switchgrass And Miscanthus RhizosphereVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNG
Ga0210401_1149982113300020583SoilLYANATLLASGLGFPEGPAVMGDGRVVFCDGNTGELLVRADGSVSTYARTG
Ga0210408_1142668023300021178SoilLESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELL
Ga0213881_1026848813300021374Exposed RockMPHKADLLASGLGFPEGPVVMGDGRIVLCDGNTGELLAYSGGTVSSFA
Ga0210386_1174061523300021406SoilLQSDLLASGLGFPEGPAVLGDGRIVLCDGNTGELLAYRD
Ga0179591_100724113300024347Vadose Zone SoilVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDSGAV
Ga0207653_1038084713300025885Corn, Switchgrass And Miscanthus RhizosphereMKSTLLASGLGFPEGPVVMSDGRIVLCDGNTGQLLVYQGGTVSSHAHT
Ga0207692_1003272013300025898Corn, Switchgrass And Miscanthus RhizosphereLQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNG
Ga0207685_1008688723300025905Corn, Switchgrass And Miscanthus RhizosphereVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAV
Ga0207684_1037969423300025910Corn, Switchgrass And Miscanthus RhizosphereMKSTLLASGLGFPEGPVVMSDGRIVLCDGNTGELLVYQGGT
Ga0207660_1047570313300025917Corn RhizosphereLESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADGSVSTYAHTG
Ga0207662_1098060413300025918Switchgrass RhizosphereLESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADGSV
Ga0207652_1184544913300025921Corn RhizosphereMESSLLASGLGFPEGPTVLGDGRIVLCDANTGELLAYRDGSLSLFARTGGS
Ga0207664_1041657023300025929Agricultural SoilVQGTLLASNLGFPEGPVVMPDGAIVLCDGNTGELLV
Ga0207686_1159251813300025934Miscanthus RhizosphereVQGTRLASDLGFPEGPVVMPDGGIVFCDGNTGELLQWKG
Ga0207709_1135037813300025935Miscanthus RhizosphereVQGTLLASNLGFPEGPVVMPDGAIVLCDGNTGEMKVW
Ga0207704_1040454413300025938Miscanthus RhizosphereVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSAYA
Ga0207665_1002865343300025939Corn, Switchgrass And Miscanthus RhizosphereLQSTLLASGLGFPEGPTILGGGRVVLCDGNTGELLLYDNGAISTYTRTGGS
Ga0207667_1214831813300025949Corn RhizosphereVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSAY
Ga0207703_1139396013300026035Switchgrass RhizosphereVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSAYAR
Ga0207708_1012287823300026075Corn, Switchgrass And Miscanthus RhizosphereVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSAYARP
Ga0207708_1017153823300026075Corn, Switchgrass And Miscanthus RhizosphereVQRTLLASNLGFPEGPVVMPDGAIVLCDGNTGELLVWKD
Ga0209438_114494213300026285Grasslands SoilMESSLLASGLGFPEGPTVLGDGRIVLCDGNTGELLAYQDGNMSLFASTG
Ga0257151_103819613300026341SoilMSMQYSLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYA
Ga0257147_105017413300026475SoilLESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADGSVSTYAHT
Ga0209690_128589913300026524SoilMKANLLASDLGFPEGPVVMLDGRIVFCDGNVGELLAYES
Ga0209620_100063233300026911Forest SoilVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSAYARTG
Ga0209214_104671723300027071Forest SoilLESTLLASGLGFPEGPAVMGDGRIVLCDGNTGELLAYADG
Ga0209178_128956823300027725Agricultural SoilVQSTLLASGLGFPEGPTILGDGRIVLCDGNTGELLVY
Ga0209074_1004650223300027787Agricultural SoilVQSTLLASGLGFPEGPTILSDGRIVLCDGNTGELLVYDNGAISAYARTG
Ga0209074_1045637223300027787Agricultural SoilVDATLLAPDLGFPEGPVVMPDGAIVFCDGNTGELRS
Ga0209074_1053123813300027787Agricultural SoilMQTSLLASGLGFPEGPTVLGDGRIVLCDANTGELLAYQEGGLSL
Ga0209701_1036553523300027862Vadose Zone SoilVQSTLLASGLGFPEGPAVLGDGRIVLCDGNVGELLAYEDGSTSTYARTG
Ga0209701_1036758513300027862Vadose Zone SoilMEATLLASGLGFPEGPLVMPDGRIVFCDGNVGELLV
Ga0209465_1004898813300027874Tropical Forest SoilVQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGGVSTYARTGG
Ga0209283_1090398223300027875Vadose Zone SoilLQSTLLASGLGFAEGPTILGDGRIVLCDGNTGELLVYDSDAVSTYARTGGSPWGTVLG
Ga0209488_1027713613300027903Vadose Zone SoilVQGTLLRLGLGFPEGPVVMPDGSIVICDGNTGELLRYSEG
Ga0209488_1120250113300027903Vadose Zone SoilLQSTLLASGLGFAEGPAILGDGRIVLCDGNTGELLVHENGAVSTYARTGGS
Ga0307290_1011353813300028791SoilVQGTLLRSDLGFPEGPVVMPDGTIVFCDGNTGELLRY
Ga0307312_1029229823300028828SoilVQSTLLASGLGFPEGPTILDDGRVVLCDGNTGELLVYDNGAVSSY
Ga0307312_1081783623300028828SoilVQGTLLRSDLGFPEGPVVMPDGAIVFCDGNTGELLRY
Ga0268241_1006251013300030511SoilMQSTQLASGLGFPEGPTVLADGRIVLCDGNTGELLVWADGAM
Ga0265746_100640423300030815SoilMDASLQLSGLGFPEGPVVMGDRRLVFCDGNVGELLVYRDGEAA
Ga0307498_1014147523300031170SoilLESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLA
Ga0318555_1037005823300031640SoilVQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAY
Ga0318496_1028917923300031713SoilLITERTLICVQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYQ
Ga0307474_1119008733300031718Hardwood Forest SoilLYANATLLASGLGFPEGPAVMGDGRVVFCDGNTGELLV
Ga0318493_1015333623300031723SoilLESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYAGGS
Ga0318493_1074507113300031723SoilVQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGDVSTYAHTG
Ga0318500_1005145813300031724SoilLQSTLLASGLGFPEGPAILGDGRIVLCDGNTGELLAYENGTIST
Ga0318494_1042404123300031751SoilLESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYAGGSVSTYA
Ga0318566_1018154613300031779SoilVQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGDVSTYAHT
Ga0318536_1064259923300031893SoilVQSTLLASGLGFPEGPAIMGDGRIVFCDGNIGELLAYKDGDISTYARTGGSP
Ga0306926_1272180223300031954SoilVQSTLLAASLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGDVST
Ga0306922_1176104813300032001SoilVQSTLLASGLGFPEGPAIMGDGRIVFCDGNIGELLAYK
Ga0318570_1056483523300032054SoilVQSELLASGLGFPEGPAVMGDGRIVLCDGNTGELLAY
Ga0318570_1056800613300032054SoilLESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYAGGSVSTYAR
Ga0318510_1023094213300032064SoilVQSTLLASSLGFPEGPAIMGDGRVVLCDGNTGELLAYQDGGVSTYARTGGSPWG
Ga0318524_1065373723300032067SoilLESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYAGGSVS
Ga0318540_1063651913300032094SoilVQSTLLASGLGFPEGPAIMGDGRVVLCDGNTGELLAYHDGDVSTYARTGGSPW
Ga0335079_1063258713300032783SoilVESTLLASGLGFPEGPAVMGDGRLVLCDGNTGELLAYAG
Ga0326726_1012953613300033433Peat SoilVEGTLLASNLGFPEGPVVTPDGSIVICDGNIGELLRWD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.