| Basic Information | |
|---|---|
| Family ID | F049923 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 51 residues |
| Representative Sequence | MLWWIGSGLILLWVVLQLLAPRGWVPMLLIAGITILIIQTAAYRKQKATDKHR |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.39 % |
| % of genes near scaffold ends (potentially truncated) | 24.66 % |
| % of genes from short scaffolds (< 2000 bps) | 59.59 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (62.329 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (10.274 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.890 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (65.068 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.56% β-sheet: 0.00% Coil/Unstructured: 44.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF00486 | Trans_reg_C | 70.55 |
| PF00664 | ABC_membrane | 3.42 |
| PF02954 | HTH_8 | 2.05 |
| PF00691 | OmpA | 2.05 |
| PF14346 | DUF4398 | 0.68 |
| PF02518 | HATPase_c | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 62.33 % |
| Unclassified | root | N/A | 37.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003324|soilH2_10181081 | All Organisms → cellular organisms → Bacteria | 2018 | Open in IMG/M |
| 3300004157|Ga0062590_102841633 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300004643|Ga0062591_101073830 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300005093|Ga0062594_103255173 | Not Available | 510 | Open in IMG/M |
| 3300005171|Ga0066677_10463647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 726 | Open in IMG/M |
| 3300005289|Ga0065704_10843852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300005293|Ga0065715_10238109 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300005331|Ga0070670_101387660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300005334|Ga0068869_100059706 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2793 | Open in IMG/M |
| 3300005334|Ga0068869_100399915 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300005334|Ga0068869_101806483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300005340|Ga0070689_100001847 | All Organisms → cellular organisms → Bacteria | 13635 | Open in IMG/M |
| 3300005345|Ga0070692_11396151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300005365|Ga0070688_101083340 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300005438|Ga0070701_11030027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300005440|Ga0070705_100423463 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300005441|Ga0070700_100000278 | All Organisms → cellular organisms → Bacteria | 27369 | Open in IMG/M |
| 3300005457|Ga0070662_101820421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300005458|Ga0070681_10466655 | Not Available | 1175 | Open in IMG/M |
| 3300005536|Ga0070697_100058347 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3141 | Open in IMG/M |
| 3300005549|Ga0070704_100238122 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
| 3300005560|Ga0066670_10427806 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300005564|Ga0070664_101183201 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 721 | Open in IMG/M |
| 3300005577|Ga0068857_100270731 | All Organisms → cellular organisms → Bacteria | 1561 | Open in IMG/M |
| 3300005615|Ga0070702_100107349 | All Organisms → cellular organisms → Bacteria | 1724 | Open in IMG/M |
| 3300005617|Ga0068859_101188945 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300005618|Ga0068864_100020919 | All Organisms → cellular organisms → Bacteria | 5477 | Open in IMG/M |
| 3300005618|Ga0068864_102674788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300005842|Ga0068858_101096229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
| 3300005843|Ga0068860_101575581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300005844|Ga0068862_100517954 | Not Available | 1134 | Open in IMG/M |
| 3300005844|Ga0068862_100738787 | All Organisms → cellular organisms → Bacteria | 956 | Open in IMG/M |
| 3300006755|Ga0079222_10828462 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300006755|Ga0079222_12648607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300006804|Ga0079221_10046239 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300006804|Ga0079221_11677440 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006844|Ga0075428_101626791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300006845|Ga0075421_100026397 | All Organisms → cellular organisms → Bacteria | 7326 | Open in IMG/M |
| 3300006854|Ga0075425_101936383 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300006954|Ga0079219_10162677 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300006954|Ga0079219_10517948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 842 | Open in IMG/M |
| 3300006954|Ga0079219_11058284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300009148|Ga0105243_11189556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 775 | Open in IMG/M |
| 3300009148|Ga0105243_12521767 | Not Available | 553 | Open in IMG/M |
| 3300009162|Ga0075423_11331410 | Not Available | 768 | Open in IMG/M |
| 3300009174|Ga0105241_12296141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300009176|Ga0105242_11225583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300009177|Ga0105248_10833107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1041 | Open in IMG/M |
| 3300010036|Ga0126305_10277605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1083 | Open in IMG/M |
| 3300010038|Ga0126315_10308643 | Not Available | 978 | Open in IMG/M |
| 3300010038|Ga0126315_10572055 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300010041|Ga0126312_10802793 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300010046|Ga0126384_12319575 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010047|Ga0126382_10194907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1435 | Open in IMG/M |
| 3300010359|Ga0126376_11276915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 753 | Open in IMG/M |
| 3300010373|Ga0134128_10956132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 947 | Open in IMG/M |
| 3300010373|Ga0134128_11282122 | Not Available | 808 | Open in IMG/M |
| 3300010375|Ga0105239_11111240 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300010396|Ga0134126_12765657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300010397|Ga0134124_10208775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1777 | Open in IMG/M |
| 3300010397|Ga0134124_10255648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1613 | Open in IMG/M |
| 3300010397|Ga0134124_10978122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 857 | Open in IMG/M |
| 3300010399|Ga0134127_11370008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 778 | Open in IMG/M |
| 3300010400|Ga0134122_10674579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 967 | Open in IMG/M |
| 3300010401|Ga0134121_13061490 | Not Available | 515 | Open in IMG/M |
| 3300011119|Ga0105246_10794215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 839 | Open in IMG/M |
| 3300011119|Ga0105246_11575551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300012951|Ga0164300_10929182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300014325|Ga0163163_12239838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300014326|Ga0157380_10754534 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 985 | Open in IMG/M |
| 3300015265|Ga0182005_1050987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1125 | Open in IMG/M |
| 3300018476|Ga0190274_13306141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300021445|Ga0182009_10012017 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3041 | Open in IMG/M |
| 3300021445|Ga0182009_10250272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 879 | Open in IMG/M |
| 3300025908|Ga0207643_10034625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2830 | Open in IMG/M |
| 3300025911|Ga0207654_10516275 | Not Available | 845 | Open in IMG/M |
| 3300025913|Ga0207695_10388158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1281 | Open in IMG/M |
| 3300025925|Ga0207650_11475122 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 578 | Open in IMG/M |
| 3300025930|Ga0207701_10585307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 951 | Open in IMG/M |
| 3300025936|Ga0207670_10000488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 21872 | Open in IMG/M |
| 3300025940|Ga0207691_11514210 | Not Available | 548 | Open in IMG/M |
| 3300025945|Ga0207679_10650889 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300025949|Ga0207667_11503011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300026035|Ga0207703_10723308 | Not Available | 947 | Open in IMG/M |
| 3300026075|Ga0207708_10000807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 23594 | Open in IMG/M |
| 3300026089|Ga0207648_10128729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2228 | Open in IMG/M |
| 3300026089|Ga0207648_11023727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 774 | Open in IMG/M |
| 3300026116|Ga0207674_12300852 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300026300|Ga0209027_1260475 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300027266|Ga0209215_1000078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 61369 | Open in IMG/M |
| 3300027326|Ga0209731_1044801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 663 | Open in IMG/M |
| 3300027775|Ga0209177_10383660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300027909|Ga0209382_10049187 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 5028 | Open in IMG/M |
| 3300028380|Ga0268265_11257152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 739 | Open in IMG/M |
| 3300028381|Ga0268264_12242322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300031716|Ga0310813_10596966 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 976 | Open in IMG/M |
| 3300031716|Ga0310813_11530306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300031824|Ga0307413_11418050 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300032000|Ga0310903_10634156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300032005|Ga0307411_10082321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 2219 | Open in IMG/M |
| 3300032005|Ga0307411_10562714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 974 | Open in IMG/M |
| 3300033412|Ga0310810_11190494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 10.27% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 9.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.22% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 7.53% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 6.16% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.48% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.11% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.11% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.74% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.05% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.37% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.37% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.68% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001116 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027266 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027326 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12627J13344_1008933 | 3300001116 | Forest Soil | MLWWIGAGLVAAWVVLELFRPRGWTPMLVIAGITILIIQIAAYRKQKAVEKR* |
| soilH2_101810812 | 3300003324 | Sugarcane Root And Bulk Soil | MLWWIGAGLVVLWGVLQLFAPRGWVPMLLIAGASLLIIQTAAYRKQKATEKHR* |
| Ga0062590_1028416332 | 3300004157 | Soil | MLWWIGSGLILLWLLLKIVAPRGWIPMLLISGVTVLIIQTAAYRKQRATDKHR* |
| Ga0062591_1010738302 | 3300004643 | Soil | MLWLIGSGLIVLWLVLQIFAPRGWVPMLLIAGVSLLIIQTAAYRKTRNHR* |
| Ga0062594_1032551731 | 3300005093 | Soil | MLWLIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTRYTDKHRS* |
| Ga0066677_104636471 | 3300005171 | Soil | MLWLIGSGLILLWALLELIAPRGWAPMLLIAGVSLLIIQLAAYRRTNIHRPRR* |
| Ga0065704_108438521 | 3300005289 | Switchgrass Rhizosphere | MLWLIGSGLILLWLVLQIFAPRGWVPMLLIAGVSLLIIQTAAYRKTRNHR* |
| Ga0065712_103147382 | 3300005290 | Miscanthus Rhizosphere | MLWWIGSLLTAAWVVLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVKKR* |
| Ga0065712_106687481 | 3300005290 | Miscanthus Rhizosphere | MLWLIGSGLVAAWVVLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVQKR* |
| Ga0065715_102381092 | 3300005293 | Miscanthus Rhizosphere | MLWLIGSVLVLLWLVLQFFAPRGWVPMLLIAGITLLIIQTAAYRKTRSHR* |
| Ga0070670_1005242792 | 3300005331 | Switchgrass Rhizosphere | MLWWIGSVLTAASIVLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVEKR* |
| Ga0070670_1013876601 | 3300005331 | Switchgrass Rhizosphere | LQAQRDSVSCMLWLIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKSHK |
| Ga0068869_1000597063 | 3300005334 | Miscanthus Rhizosphere | MLWWIGSGLVVLWGVLQLFAPRGWVPMLLIAGASLLIIQTAAYRKQKATEKHR* |
| Ga0068869_1003999152 | 3300005334 | Miscanthus Rhizosphere | MLWWIGSGLVLLWIPLQLFAPRGWTPMLLIGGISILIIQTAAYRKTKSHR* |
| Ga0068869_1018064831 | 3300005334 | Miscanthus Rhizosphere | MLWWIGSGLILLWIVMQLAAPRGWVPMLLIAGVTILIIQTAAHRKQKATGKHR* |
| Ga0068868_1019340952 | 3300005338 | Miscanthus Rhizosphere | MLWWIGSVLTAASVVLQLFRPRGWTPMLAIGGINLLIIQIAAYRKQKAVEKR* |
| Ga0070689_1000018477 | 3300005340 | Switchgrass Rhizosphere | MLWLIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKRHR* |
| Ga0070689_1018446601 | 3300005340 | Switchgrass Rhizosphere | MLWWIGLGLTAAWVVLQLFRPRGWTPMLAMGGISLLIIQIAAYRKQKAVEKR* |
| Ga0070687_1006083672 | 3300005343 | Switchgrass Rhizosphere | MLWCIGSVLTAASVVLQLFRPRGWTPMLAIGGITLLIIQIAAYRKQKAVEKR* |
| Ga0070692_113961511 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWCIGTGLVLLWIPLQLFAPRGWTPMLLIGGISVLIIQTAAYRKTKYTDKHRS* |
| Ga0070688_1010833401 | 3300005365 | Switchgrass Rhizosphere | MLWLIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYR |
| Ga0070701_102820572 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | VLTAASVVLQLFRPRGWTPMLAIGGITLLIIQMAAYRKQKAVEKR* |
| Ga0070701_110300272 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWLIGLGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTRYTDKHRS* |
| Ga0070705_1004234632 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWIGLCLVVLWGVLQLFAPRGWVPMLLIAGATLLIIQTAAYRKQKATEKHR* |
| Ga0070700_1000002789 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWLIGSGLILLWLVLQLFAPRGWVPMLLIAGVTVLIIQIAAYRKQKATDKYR* |
| Ga0070700_1004637711 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWIGSLLTAAWVVLQLFRPRGWTPMLAIGGISLLIIQIAAY |
| Ga0070662_1018204211 | 3300005457 | Corn Rhizosphere | MLWWIGLSLVVLWGVLQLFAPRGWVPMLLIAGATLLIIQTA |
| Ga0070681_104666552 | 3300005458 | Corn Rhizosphere | MLWWIGSGLVLLWIILQLAAPRGWVPMLLIAGATILIIQTAAYRKEKATAKHK* |
| Ga0070681_112177502 | 3300005458 | Corn Rhizosphere | MLWWIGSGLVAAWVVLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVQKR* |
| Ga0068867_1000415433 | 3300005459 | Miscanthus Rhizosphere | MLWWIGLGLTAAWVVLQLFRPRGWTPMLAMGGISLLIIQIAAYRKQKAVQKR* |
| Ga0070697_1000583473 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWIGTALIVAWLILWLVMPRGWGPLLLISGICLLIIQTAAYRRTRHRK* |
| Ga0070695_1008965802 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWIGFVLIAASVVLQLFRPRGWTPMLAIGGITLLIIQMAAYRKQKAVEKR* |
| Ga0070704_1002381222 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWLIGAGLIVLWIVLTLFAPRGWVPMLLIAGVSLLIIQLAAYRKTKHARSGK* |
| Ga0066670_104278062 | 3300005560 | Soil | MLWLIGSGLILLWVVLELIAPRGWAPMLLIAGVSLLIIQLAAYRRTNIHRSRK |
| Ga0070664_1011832012 | 3300005564 | Corn Rhizosphere | MLWWIGSGLILLWIVMELAAPRGWVPMLLIAGVTILIIQTAAHRKQKATEKHR* |
| Ga0068857_1002707312 | 3300005577 | Corn Rhizosphere | MLWLIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKSHR* |
| Ga0070702_1001073492 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWLIGLGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKSHK* |
| Ga0070702_1015122312 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AAWVVLQLFRPRGWTPMLAIGGITLLIIQMAAYRKQKAVEKR* |
| Ga0068859_1011889452 | 3300005617 | Switchgrass Rhizosphere | MLWLIGSGLVILWVPLQLFAPRGWTPMLLIAGITILTIQTAAYRKTRYTDKHRS* |
| Ga0068859_1020017132 | 3300005617 | Switchgrass Rhizosphere | MLWWIGSVLTAASVVLQLFRPRGWTPMLAIGGITLLIIQIAAYRKQKAVEKR* |
| Ga0068864_1000209197 | 3300005618 | Switchgrass Rhizosphere | MLWLIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQ |
| Ga0068864_1026747882 | 3300005618 | Switchgrass Rhizosphere | MLWWIGSGLILLWIVMELAAPRGWVPMLLIAGVTILIIQTAAHRKQKATGKHR* |
| Ga0068870_109659002 | 3300005840 | Miscanthus Rhizosphere | MLWWIGSGLVAAWVILQLFRPRGWTPMLVIAGVSVLIIQIAAYRKTKAHTFRR* |
| Ga0068870_110901341 | 3300005840 | Miscanthus Rhizosphere | MLWWIGSVLTAASVVLQLFRPRGWTPMLAIGGITLLIIQMAAYRKQKAVEKR* |
| Ga0068863_1010701761 | 3300005841 | Switchgrass Rhizosphere | MLWWIGSVLTAASVVLQLFRPRGWTPMLAIGGITLLIIQIAA |
| Ga0068858_1010962292 | 3300005842 | Switchgrass Rhizosphere | RDSLIAMLWWVGSGLILLWLVLRLVAPRGWIPLLLISGISVLIIQLAAYRKARAAAKRE* |
| Ga0068860_1003509572 | 3300005843 | Switchgrass Rhizosphere | MLWWIGSLLTAAWVVLQLFRPRGWTPMLAIGGISLLIIQIAAYSKQKAVKKR* |
| Ga0068860_1015755812 | 3300005843 | Switchgrass Rhizosphere | LQAQRDSVSMLWWIGTGLVLLWIPLQLFAPRGWTPMLLIGGISVLIIQTAAYRKTKYTDKHRS* |
| Ga0068862_1005179541 | 3300005844 | Switchgrass Rhizosphere | MLWWIGSGLVAAWVVLQLFRPRGWTPMLAIGGISLLII |
| Ga0068862_1007387872 | 3300005844 | Switchgrass Rhizosphere | MLWMIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKSHR* |
| Ga0082029_10168161 | 3300006169 | Termite Nest | MLWWIGSGLIAAWLVLQLFRPRGWIPMLLIAGVSLLIIQFAAYRKQKAVEKR* |
| Ga0079222_108284622 | 3300006755 | Agricultural Soil | MLWLIGSVLILLWVVLQLFAPRGWVPMLLIAGITLLIVQTAAYRKEKAAEKHRKSS* |
| Ga0079222_126486071 | 3300006755 | Agricultural Soil | MLWLIGSGLVVLWVILQLLAPRGWVPMLLIAGISLLIIQTAAYRKTRSHR* |
| Ga0079221_100462392 | 3300006804 | Agricultural Soil | MLWLIGSVLIVLWVVLQLFAPRGWVPMLLIAGITLLIVQAAAYRKEKAAEKHRKSA* |
| Ga0079221_116774402 | 3300006804 | Agricultural Soil | MLWWIGSGLVLLWIVLQLVAPRGWVPMLLIAGVTLLIVQIAAYRKEKATAKHR* |
| Ga0079220_105194612 | 3300006806 | Agricultural Soil | MLWWIGSVLTAASVVLQLFRPRGWTPMLAIGGITLLIIQTAAYRK |
| Ga0075428_1016267912 | 3300006844 | Populus Rhizosphere | VERDSLTAMLWLIGSGLILLWLVLQIFAPRGWVPMLLIAGVSLLIIQTAAYRKKKAIDKHR* |
| Ga0075421_1000263974 | 3300006845 | Populus Rhizosphere | MLWLIGSGLILLWLVLQIFAPRGWVPMLLIAGVSLLIIQTAAYRKKKAIDKHR* |
| Ga0075425_1019363832 | 3300006854 | Populus Rhizosphere | MLWWIGLGLILFWVVLQLFAPRGWAPMLLIGGVSLLIIQIAAYRKRKATDKYR* |
| Ga0079219_101626772 | 3300006954 | Agricultural Soil | MLWLIGSVLIVLWVVLQLFAPRGWVPMLLIAGITLLIVQTAAYRKEKAAEKHRKSA* |
| Ga0079219_105179482 | 3300006954 | Agricultural Soil | MLWWIGSGLVLLWIVLQLAAPRGWVPMLLIAGATILIVQTAAYRKQKATAKHR* |
| Ga0079219_110582842 | 3300006954 | Agricultural Soil | WIGSGLVLLWIILQLAAPRGWVPMLLIAGATILIIQTAAYRKEKATAKHK* |
| Ga0105251_103093722 | 3300009011 | Switchgrass Rhizosphere | MLWWIGSVLTAASIVLQLFRPRGWTPMLAIGGISLLIIQIAGYSKQKAVEKR* |
| Ga0105245_107244312 | 3300009098 | Miscanthus Rhizosphere | MLWWIGSGLVAAWVVLQLFRPRGWTPMLAMGGISLLIIQIAAYRKQKAVQKR* |
| Ga0105247_101828202 | 3300009101 | Switchgrass Rhizosphere | MLWWIGFVLIAASVVLQLFRPRGWTPMLAIGGITLLIIQIAAYRKQKAVEKR* |
| Ga0105243_111895561 | 3300009148 | Miscanthus Rhizosphere | GMLWLIGLGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTRYTDKHRS* |
| Ga0105243_120996162 | 3300009148 | Miscanthus Rhizosphere | MLWWIGFVLTAASVVLQLFRPRGWTPMLAIGGITLLIIQMAAYRKQKAVEKR* |
| Ga0105243_125217672 | 3300009148 | Miscanthus Rhizosphere | MLWWIGSGLILLWIILRFVAPRGWIPMLLIAGVTLLIIQTAAYRKEKATAKHR* |
| Ga0075423_113314102 | 3300009162 | Populus Rhizosphere | MLWLIGSGLILLWLVLQIFAPRGWVPMLLIAGVSLLIIQTAAYR |
| Ga0105241_104529642 | 3300009174 | Corn Rhizosphere | MLWWIGSVLTAASVVLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVEKR* |
| Ga0105241_122961412 | 3300009174 | Corn Rhizosphere | MLWWIGLCLVVLWGVLQLFAPRGWVPMLLIAGATLLIIQTAAYRKQK |
| Ga0105242_112255832 | 3300009176 | Miscanthus Rhizosphere | MLWLIGSGLILLWLVLQLFAPRGWVPMLLIAGATLLIIQTAAYRKQKATEKHR* |
| Ga0105248_108331072 | 3300009177 | Switchgrass Rhizosphere | MLWWIGTGLVLLWIPLQLFAPRGWTPMLLIAGITILIIQTAAYRKTRYTDKHRS* |
| Ga0126305_102776052 | 3300010036 | Serpentine Soil | MLWWIGSGLILLWLVMQLFAPRGWIPMLLLAGISVLIIQTAAYRKTKSHR* |
| Ga0126315_103086432 | 3300010038 | Serpentine Soil | MLWLIGAGLTLLWILLQLLAPRGWTPMLLIAGISILIIQTAAYRKTRNADKHRS* |
| Ga0126315_105720551 | 3300010038 | Serpentine Soil | LWLIGSGLILLWLVLQIFAPRGWVPMLLIAGASVLIIQTAAYRKQKATEKHR* |
| Ga0126312_108027932 | 3300010041 | Serpentine Soil | MLWWIGSGLVLLWIPLQLFAPRGWTPMLLIAGISILIIQTA |
| Ga0126384_116872712 | 3300010046 | Tropical Forest Soil | MLWWIGSGLTAAWVVLQLFRPRGWTPMLAVGGISLLIIQIAAYRKQKAVQKR* |
| Ga0126384_123195751 | 3300010046 | Tropical Forest Soil | MLWWIGSGLVLLWIVLQLAAPRGWVPMLLIAGATI |
| Ga0126382_101949072 | 3300010047 | Tropical Forest Soil | QAERDSLISMLWLIGSGLILLWLVLQLLAPRGWVPMLLIAGVSLLIIQTAAYRKEKATRKHR* |
| Ga0126376_112769151 | 3300010359 | Tropical Forest Soil | MLWWIGSGLILLWVVLQLLAPRGWVPMLLIAGITILIIQTAAYRKQKATDKHR* |
| Ga0134128_102722581 | 3300010373 | Terrestrial Soil | MLWWIGSVLTAASIVLQLFRSRGWTPMLAIGGISLLIIQIAAYRKQKAVEKR* |
| Ga0134128_109561323 | 3300010373 | Terrestrial Soil | FPDAMLWWIGLGLIVLWGILQLFAPRGWVPMLLIAGATLLIIQTAAYRKRKATEKHR* |
| Ga0134128_112821221 | 3300010373 | Terrestrial Soil | MLWLIGSGLVAAWVVLQLFRPRGWTPMLAIGGISLLIIQI |
| Ga0134128_130508321 | 3300010373 | Terrestrial Soil | MLWWIGSVLTAASIVLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVKKR* |
| Ga0105239_111112402 | 3300010375 | Corn Rhizosphere | QAERDSLTAMLWLIGSGLILLWLVLQIFAPRGWVPMLLIAGVSLLIIQTAAYRKTRNHR* |
| Ga0134126_127656572 | 3300010396 | Terrestrial Soil | MLWLIGSGLILLWVVLRLFAPRGWIPMLLIAGVSLIIIQTAAYRKQKDTDKHG* |
| Ga0134124_102087751 | 3300010397 | Terrestrial Soil | MLWWIGSGLVVLWGVLQLFAPRGWVPMLLIAGASLLIIQTAA |
| Ga0134124_102556483 | 3300010397 | Terrestrial Soil | MLWWIGSGLILLWIVMELAAPRGWVPMLLIAGITILIIQTAAYRKQK |
| Ga0134124_109781222 | 3300010397 | Terrestrial Soil | MLWWIGSGLILLWIVMELAAPRGWVPMLLIAGITILIIQTAAYRKQKATEKHR* |
| Ga0134127_113700082 | 3300010399 | Terrestrial Soil | MLWLIGSGLILLWLVLQIFAPRGWVPMLLIAGVSVLIIQTAAYRKQKATDKHR* |
| Ga0134127_118036422 | 3300010399 | Terrestrial Soil | MLWWIGSVLTAASVVLQLFRPRGWTPMLAIGGITLLIIQTAAYRKQKAVEKR* |
| Ga0134122_106066762 | 3300010400 | Terrestrial Soil | MLWWIGSVLTAASVLLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVEKR* |
| Ga0134122_106745791 | 3300010400 | Terrestrial Soil | MLWLIGSGLILLWVVLQLFAPRGWVPMLLIAGVTILIIQTAA |
| Ga0134121_130614902 | 3300010401 | Terrestrial Soil | IGSGLILLWVVLRLFAPRGWIPMLLIAGVSLIIIQTAAYRKQKDTDKHR* |
| Ga0134123_133476732 | 3300010403 | Terrestrial Soil | MLWLIGSGLVAAWVVLQLFRPRGWVPMLAIAGFSLLVIQIAAYRKQKAVQKR* |
| Ga0105246_107942152 | 3300011119 | Miscanthus Rhizosphere | MLWMIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKSHK* |
| Ga0105246_115755512 | 3300011119 | Miscanthus Rhizosphere | MLWWIGSGLILLWLILKVVAPRGWIPMLLIAGVSLLIIQTAAYRKRKATDKHR* |
| Ga0105246_121494392 | 3300011119 | Miscanthus Rhizosphere | LIVAWVVLQLFRPRGWTPMLVIAGVSLIVIQIAAYRKQKAVEKR* |
| Ga0164300_101985252 | 3300012951 | Soil | MLWWIGSGLVAAWVVLQLFRPRGWTPMLAMGGFSLLIIQIAAYRKRKDVEKR* |
| Ga0164300_109291822 | 3300012951 | Soil | MLWLIGSGLILLWLVLQIFAPRGCVPMLLIAGVTVLIIQTAAYRKQKATDKYR* |
| Ga0157373_107449092 | 3300013100 | Corn Rhizosphere | QAERDAVVAMLWWIGSGLVAAWVVLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVQKR* |
| Ga0157378_127443982 | 3300013297 | Miscanthus Rhizosphere | VLTAASVVLQLFRPRGWTPMLAIGGITLLIIQTAAYRKQKAVEKR* |
| Ga0163163_122398381 | 3300014325 | Switchgrass Rhizosphere | QAQRDSVSCMLWLIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKSHK* |
| Ga0157380_107545342 | 3300014326 | Switchgrass Rhizosphere | MLWMIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTRYTDKHRS* |
| Ga0182005_10509872 | 3300015265 | Rhizosphere | MLWWIGSGLILLWIVMELAAPRGWVPMLLIAGVTILIIQTAAYRKQKATEKHR* |
| Ga0190274_133061412 | 3300018476 | Soil | MLWLIGAGLVLLWIPLQLFAPRAWTPMLLIGGISILIIQTAAYRKTKYTDKHRS |
| Ga0182009_100120173 | 3300021445 | Soil | MLWWIGSGLILLYIILRLVAPRGWIPMLLIAGISLLIIQTAAYRKQKAIDKQR |
| Ga0182009_102502722 | 3300021445 | Soil | MLWWVGSGLILLWIVLRLVAPRGWIPMLLIAGVTVLIVQTAAYRKEKATAKHK |
| Ga0207710_105649162 | 3300025900 | Switchgrass Rhizosphere | MLWWIGFVLIAASVVLQLFRPRGWTPMLAIGGITLLIIQMAAYRKQKAVEKR |
| Ga0207643_100346251 | 3300025908 | Miscanthus Rhizosphere | MLWLIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKS |
| Ga0207654_102288802 | 3300025911 | Corn Rhizosphere | MLWWIGSGLVAAWVVLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVEKR |
| Ga0207654_105162751 | 3300025911 | Corn Rhizosphere | MLWWIGSGFILVWVVLRLFAPRDWLPLLLISGVTILIIQVAAYRRTKST |
| Ga0207695_103881581 | 3300025913 | Corn Rhizosphere | SLISMLWLIGSVLVLLWLVLQFFAPRGWVPMLLIAGITLLIIQTAAYRKTRSHR |
| Ga0207662_110576592 | 3300025918 | Switchgrass Rhizosphere | MLWCIGSVLTAASVVLQLFRPRGWTPMLAIGGITLLIIQIAAYRKQKAVEKR |
| Ga0207650_107959302 | 3300025925 | Switchgrass Rhizosphere | MLWWIGSVLTAASIVLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVEKR |
| Ga0207650_114751221 | 3300025925 | Switchgrass Rhizosphere | MLWLIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKSHK |
| Ga0207701_105853072 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWWIGSGLIVLYIVLRLAAPRGWIPMLLIAGVSLLIIQTAAYRKTRSHR |
| Ga0207670_100004887 | 3300025936 | Switchgrass Rhizosphere | MLWLIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKRHR |
| Ga0207670_110911042 | 3300025936 | Switchgrass Rhizosphere | MLWLIGSGLVAAWVVLQLFRPRGWTPMLAIGGITLLIIQMAAYRKQKAVEKR |
| Ga0207691_115142101 | 3300025940 | Miscanthus Rhizosphere | LVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKRHR |
| Ga0207711_107276422 | 3300025941 | Switchgrass Rhizosphere | MLWWIGSVLTAASVVLQLFRPRGWTPMLAIGGITLLIIQIAAY |
| Ga0207689_102705572 | 3300025942 | Miscanthus Rhizosphere | MLWWIGSLLTAAWVVLQLFRPRGWTPMLAIGGISLLIIQIAAYRKQKAVKKR |
| Ga0207679_106508892 | 3300025945 | Corn Rhizosphere | MLWWIGSGLILLWIVMELAAPRGWVPMLLIAGVTILIIQTAAHRKQKATGKHR |
| Ga0207667_115030112 | 3300025949 | Corn Rhizosphere | DTLKMLWLIGAGLIVLWIVLTLFAPRGWVPMLLIAGVSLLIIQLAAYRKTKHARSGK |
| Ga0207703_107233082 | 3300026035 | Switchgrass Rhizosphere | MLWWIGSGLVVLWGVLQLFAPRGWVPMLLIAGASLLIIQTAAYRKQKATEKHR |
| Ga0207708_100008077 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MLWLIGSGLILLWLVLQLFAPRGWVPMLLIAGVTVLIIQIAAYRKQKATDKYR |
| Ga0207648_101287291 | 3300026089 | Miscanthus Rhizosphere | MLWLIGLGQVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTRYTDKHRS |
| Ga0207648_110237272 | 3300026089 | Miscanthus Rhizosphere | DSVSMLWWIGMGLVLLWIPLQLFAPRGWTPMLLIGGISVLIIQTAAYRKTKYTDKHRS |
| Ga0207676_105638392 | 3300026095 | Switchgrass Rhizosphere | MLWWIGSVLTAASVVLQLFRPRGWTPMLAIGGITLLIIQIAAYRKQKAVEKR |
| Ga0207674_123008521 | 3300026116 | Corn Rhizosphere | MLWWIGSGLVLLWIILQLAAPRGWVPMLLIAGATILIIQTAAYRKEKATAKHK |
| Ga0207675_1020156622 | 3300026118 | Switchgrass Rhizosphere | MLWWIGSGLVAAWVVLQLFRPRGWTPMLAIGGISLLIIQFAAYRKQKAVQKR |
| Ga0209027_12604751 | 3300026300 | Grasslands Soil | MLWWVGSGLIILWAVLELVAPRGWVPMLLIAGVSILIIQIAAYRRT |
| Ga0209215_100007813 | 3300027266 | Forest Soil | MLWWIGAGLVAAWVVLELFRPRGWTPMLVIAGITILIIQIAAYRKQKAVEKR |
| Ga0209731_10448012 | 3300027326 | Forest Soil | MLWWIGTALIVAWLILWLVAPRGWAPMLLISGICILIIQTAAYRRANNRK |
| Ga0209177_103836602 | 3300027775 | Agricultural Soil | MLWWIGSGLVLLWIVLQLAAPRGWVPMLLIAGATILIVQTAAYRKQKATAKHR |
| Ga0209382_100491873 | 3300027909 | Populus Rhizosphere | MLWLIGSGLILLWLVLQIFAPRGWVPMLLIAGVSLLIIQTAAYRKKKAIDKHR |
| Ga0268265_112571522 | 3300028380 | Switchgrass Rhizosphere | MLWMIGSGLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKSHR |
| Ga0268264_122423222 | 3300028381 | Switchgrass Rhizosphere | MLWWIGSGLILLWIVMELAAPRGWVPMLLIAGVTILIIQTAAHRKQQATGKHR |
| Ga0310813_105969662 | 3300031716 | Soil | MLWWIGSGLVLLWIILQLAVPRGWVPMLLIAGATILIIQTAAYRKEKATAKHK |
| Ga0310813_115303062 | 3300031716 | Soil | MLWWIGSGLILLWIVMELAAPRGWVPMLLIAGVTILIIQTAAYRKQKATEKHR |
| Ga0307413_114180502 | 3300031824 | Rhizosphere | IGTGLVLLWIPLQLFAPRGWTPMLLIGGISVLIIQTAAYRKAKYTDKHRS |
| Ga0310903_106341562 | 3300032000 | Soil | GLVILWIALQLLAPRGWTPMLLIAGISILIIQTAAYRKTKSHR |
| Ga0307411_100823211 | 3300032005 | Rhizosphere | MLWLIGTGLVLLWIPLQLFAPRGWTPMLLIGGISVLIIQTA |
| Ga0307411_105627141 | 3300032005 | Rhizosphere | IGSGLILLWLVLQIFAPRGWVPMLLIAGASLLIIQTAAYRKTRNHR |
| Ga0310810_111904942 | 3300033412 | Soil | MLWWIGSGLIVLYIVMRLAAPRGWIPMLLIAGVSLLIIQTAAYRKTRSHR |
| ⦗Top⦘ |