| Basic Information | |
|---|---|
| Family ID | F049920 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MTTKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAKS |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 45.07 % |
| % of genes near scaffold ends (potentially truncated) | 34.93 % |
| % of genes from short scaffolds (< 2000 bps) | 85.62 % |
| Associated GOLD sequencing projects | 118 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.42 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (85.616 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.863 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.082 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.726 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.00% β-sheet: 0.00% Coil/Unstructured: 56.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.42 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF02617 | ClpS | 47.95 |
| PF00932 | LTD | 16.44 |
| PF01176 | eIF-1a | 8.90 |
| PF09438 | DUF2017 | 4.79 |
| PF06197 | DUF998 | 1.37 |
| PF03098 | An_peroxidase | 1.37 |
| PF09579 | Spore_YtfJ | 0.68 |
| PF07733 | DNA_pol3_alpha | 0.68 |
| PF01894 | UPF0047 | 0.68 |
| PF01391 | Collagen | 0.68 |
| PF02811 | PHP | 0.68 |
| PF11832 | DUF3352 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG2127 | ATP-dependent Clp protease adapter protein ClpS | Posttranslational modification, protein turnover, chaperones [O] | 47.95 |
| COG0361 | Translation initiation factor IF-1 | Translation, ribosomal structure and biogenesis [J] | 8.90 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 1.37 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.68 |
| COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 0.68 |
| COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 85.62 % |
| Unclassified | root | N/A | 14.38 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c0772479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 909 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105258325 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300000891|JGI10214J12806_11044916 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300002568|C688J35102_120765993 | All Organisms → cellular organisms → Bacteria | 1520 | Open in IMG/M |
| 3300003267|soilL1_10003895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 9671 | Open in IMG/M |
| 3300003987|Ga0055471_10003730 | All Organisms → cellular organisms → Bacteria | 2791 | Open in IMG/M |
| 3300004081|Ga0063454_100612729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 798 | Open in IMG/M |
| 3300004114|Ga0062593_100145653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1785 | Open in IMG/M |
| 3300004114|Ga0062593_100311534 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
| 3300004114|Ga0062593_100571244 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300004157|Ga0062590_101906330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300004463|Ga0063356_101177920 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300004479|Ga0062595_100229103 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300004479|Ga0062595_100419926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 968 | Open in IMG/M |
| 3300004480|Ga0062592_101424993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 661 | Open in IMG/M |
| 3300005093|Ga0062594_100136090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1572 | Open in IMG/M |
| 3300005294|Ga0065705_10105164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 9114 | Open in IMG/M |
| 3300005329|Ga0070683_100166525 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2091 | Open in IMG/M |
| 3300005330|Ga0070690_100116946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1786 | Open in IMG/M |
| 3300005331|Ga0070670_101293339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 667 | Open in IMG/M |
| 3300005332|Ga0066388_102461142 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300005339|Ga0070660_100656099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 879 | Open in IMG/M |
| 3300005353|Ga0070669_100523813 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300005455|Ga0070663_101014523 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300005526|Ga0073909_10251055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 786 | Open in IMG/M |
| 3300005546|Ga0070696_101047350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300005719|Ga0068861_101309354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 705 | Open in IMG/M |
| 3300005842|Ga0068858_100233872 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1742 | Open in IMG/M |
| 3300005886|Ga0075286_1068857 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005937|Ga0081455_10012266 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8553 | Open in IMG/M |
| 3300005937|Ga0081455_10047610 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3711 | Open in IMG/M |
| 3300005937|Ga0081455_10541202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 772 | Open in IMG/M |
| 3300006058|Ga0075432_10132546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 945 | Open in IMG/M |
| 3300006169|Ga0082029_1416647 | Not Available | 1062 | Open in IMG/M |
| 3300009174|Ga0105241_11782122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 600 | Open in IMG/M |
| 3300009545|Ga0105237_10733520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 994 | Open in IMG/M |
| 3300009553|Ga0105249_12729553 | Not Available | 566 | Open in IMG/M |
| 3300009553|Ga0105249_13221725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 525 | Open in IMG/M |
| 3300009789|Ga0126307_10000469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 25863 | Open in IMG/M |
| 3300010036|Ga0126305_10036713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2710 | Open in IMG/M |
| 3300010041|Ga0126312_10263786 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300010042|Ga0126314_10211212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1370 | Open in IMG/M |
| 3300010042|Ga0126314_10567513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 827 | Open in IMG/M |
| 3300010045|Ga0126311_11109636 | Not Available | 651 | Open in IMG/M |
| 3300010301|Ga0134070_10316056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300010362|Ga0126377_11166151 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300010397|Ga0134124_10229913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1697 | Open in IMG/M |
| 3300010399|Ga0134127_10765607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1011 | Open in IMG/M |
| 3300010399|Ga0134127_13537939 | Not Available | 512 | Open in IMG/M |
| 3300010400|Ga0134122_11468787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
| 3300010400|Ga0134122_11703072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 658 | Open in IMG/M |
| 3300010401|Ga0134121_10602507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1028 | Open in IMG/M |
| 3300010403|Ga0134123_11262276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 772 | Open in IMG/M |
| 3300010403|Ga0134123_13084335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300011000|Ga0138513_100024063 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300011119|Ga0105246_11076727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 733 | Open in IMG/M |
| 3300011119|Ga0105246_11590098 | Not Available | 617 | Open in IMG/M |
| 3300012212|Ga0150985_120529880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 506 | Open in IMG/M |
| 3300012494|Ga0157341_1029857 | Not Available | 584 | Open in IMG/M |
| 3300012513|Ga0157326_1065535 | Not Available | 565 | Open in IMG/M |
| 3300012891|Ga0157305_10171656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300012892|Ga0157294_10193898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300012905|Ga0157296_10024894 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300012905|Ga0157296_10025652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1203 | Open in IMG/M |
| 3300012908|Ga0157286_10463568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 506 | Open in IMG/M |
| 3300012911|Ga0157301_10384234 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300012912|Ga0157306_10246593 | Not Available | 627 | Open in IMG/M |
| 3300012915|Ga0157302_10119815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 857 | Open in IMG/M |
| 3300012948|Ga0126375_10909022 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → environmental samples → uncultured Acidimicrobiales bacterium | 708 | Open in IMG/M |
| 3300013096|Ga0157307_1062088 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300013096|Ga0157307_1073656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300014265|Ga0075314_1105053 | Not Available | 615 | Open in IMG/M |
| 3300014270|Ga0075325_1036287 | All Organisms → cellular organisms → Bacteria | 998 | Open in IMG/M |
| 3300014325|Ga0163163_10590831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1173 | Open in IMG/M |
| 3300014326|Ga0157380_10824485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 947 | Open in IMG/M |
| 3300015201|Ga0173478_10226820 | Not Available | 802 | Open in IMG/M |
| 3300015373|Ga0132257_101732845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 801 | Open in IMG/M |
| 3300015373|Ga0132257_101830982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| 3300017965|Ga0190266_10014152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2150 | Open in IMG/M |
| 3300018028|Ga0184608_10516571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300018051|Ga0184620_10053236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1145 | Open in IMG/M |
| 3300018054|Ga0184621_10152343 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300018066|Ga0184617_1184875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
| 3300018067|Ga0184611_1221558 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300018073|Ga0184624_10029619 | All Organisms → cellular organisms → Bacteria | 2109 | Open in IMG/M |
| 3300018073|Ga0184624_10149144 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300018081|Ga0184625_10623451 | Not Available | 526 | Open in IMG/M |
| 3300018466|Ga0190268_10125297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1256 | Open in IMG/M |
| 3300018469|Ga0190270_11550380 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300019356|Ga0173481_10014088 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2319 | Open in IMG/M |
| 3300019356|Ga0173481_10468318 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300019361|Ga0173482_10213673 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300019767|Ga0190267_10646122 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300020016|Ga0193696_1035333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1333 | Open in IMG/M |
| 3300021078|Ga0210381_10134582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 828 | Open in IMG/M |
| 3300021445|Ga0182009_10577939 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300022756|Ga0222622_10480434 | Not Available | 885 | Open in IMG/M |
| 3300025321|Ga0207656_10316463 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300025899|Ga0207642_10276434 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300025901|Ga0207688_10023156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3399 | Open in IMG/M |
| 3300025904|Ga0207647_10373103 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300025907|Ga0207645_10844150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 623 | Open in IMG/M |
| 3300025914|Ga0207671_11380427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 547 | Open in IMG/M |
| 3300025919|Ga0207657_10935036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 667 | Open in IMG/M |
| 3300025925|Ga0207650_11210144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 643 | Open in IMG/M |
| 3300025938|Ga0207704_11282073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 626 | Open in IMG/M |
| 3300025938|Ga0207704_11830323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
| 3300025940|Ga0207691_10422511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1136 | Open in IMG/M |
| 3300025944|Ga0207661_10148562 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2024 | Open in IMG/M |
| 3300025945|Ga0207679_10131867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2006 | Open in IMG/M |
| 3300025961|Ga0207712_10660003 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 910 | Open in IMG/M |
| 3300026003|Ga0208284_1017167 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300026023|Ga0207677_10741360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 875 | Open in IMG/M |
| 3300026023|Ga0207677_11982946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 541 | Open in IMG/M |
| 3300026035|Ga0207703_11984184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 558 | Open in IMG/M |
| 3300026089|Ga0207648_10136370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2162 | Open in IMG/M |
| 3300027695|Ga0209966_1046712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 914 | Open in IMG/M |
| 3300027876|Ga0209974_10232331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300027907|Ga0207428_10059345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3034 | Open in IMG/M |
| 3300028708|Ga0307295_10175638 | Not Available | 601 | Open in IMG/M |
| 3300028712|Ga0307285_10236792 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300028720|Ga0307317_10103508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 944 | Open in IMG/M |
| 3300028754|Ga0307297_10137323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 827 | Open in IMG/M |
| 3300028778|Ga0307288_10318317 | Not Available | 622 | Open in IMG/M |
| 3300028807|Ga0307305_10127964 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1174 | Open in IMG/M |
| 3300028811|Ga0307292_10090741 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300028875|Ga0307289_10207547 | Not Available | 806 | Open in IMG/M |
| 3300028876|Ga0307286_10058596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1314 | Open in IMG/M |
| 3300030336|Ga0247826_10124236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1654 | Open in IMG/M |
| 3300031562|Ga0310886_10273544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
| 3300031824|Ga0307413_10018942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3624 | Open in IMG/M |
| 3300031901|Ga0307406_10136860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1728 | Open in IMG/M |
| 3300031938|Ga0308175_100620210 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300031996|Ga0308176_12906305 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300032000|Ga0310903_10099386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1235 | Open in IMG/M |
| 3300032004|Ga0307414_10777862 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300032017|Ga0310899_10576249 | Not Available | 561 | Open in IMG/M |
| 3300032075|Ga0310890_10482122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 939 | Open in IMG/M |
| 3300032122|Ga0310895_10602517 | Not Available | 563 | Open in IMG/M |
| 3300032126|Ga0307415_100627128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 960 | Open in IMG/M |
| 3300033550|Ga0247829_10329714 | All Organisms → cellular organisms → Bacteria | 1244 | Open in IMG/M |
| 3300033550|Ga0247829_10933327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 722 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.86% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.90% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.48% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 4.11% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 4.11% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.74% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.05% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.37% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.37% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.37% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.68% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Termite Nest | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Termite Nest | 0.68% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005886 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006169 | Termite nest microbial communities from Madurai, India | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Host-Associated | Open in IMG/M |
| 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300013096 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014270 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026003 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 (SPAdes) | Environmental | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028872 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_07724791 | 3300000033 | Soil | MTTKDEPDRRLSALVAALSLNRGELDADALKRLLGLIEATQPSPAKG* |
| INPhiseqgaiiFebDRAFT_1052583252 | 3300000364 | Soil | MTTKDEADRRLSALVAALSLNRGELDAAALERLLRLTEPKPVAPAKS* |
| JGI10214J12806_110449161 | 3300000891 | Soil | MRTKDEPDRRLSALVAALSLNRGELDAAALERLLRLI |
| C688J35102_1207659933 | 3300002568 | Soil | MQTKDKDDRRLSALVTALSLNRGELDAAALERLLGLIEPKPTAAAKS* |
| soilL1_100038954 | 3300003267 | Sugarcane Root And Bulk Soil | MTTKDEPDRRLSALVAALSLNRGELDAAALERLLRLIETKPAATAKS* |
| Ga0055471_100037303 | 3300003987 | Natural And Restored Wetlands | MTTKDEHDRRLSALVTALSLNRGELDAAALERLLGLIEARQAAPAKS* |
| Ga0063454_1006127293 | 3300004081 | Soil | MTTKDEPDRRLSALIAALSLNRGELDAASLERLLGLIEATQPSPAKS* |
| Ga0062593_1001456532 | 3300004114 | Soil | MTTKDEPDRRLSALVAALSLNRGELDAAALERLLRLTEPKPVAPAKS* |
| Ga0062593_1003115343 | 3300004114 | Soil | MRTKDEPDRRLSALVAALSLNRGELDAAALERLLRLIEAKPAATAKS* |
| Ga0062593_1005712442 | 3300004114 | Soil | MTTKDEPDRRLSALVAALSLNRGELDAGALERLLRLTEPKPAAPAKS* |
| Ga0062590_1019063301 | 3300004157 | Soil | MTTKDEPNRRLSALIAALSLNRGELDADALERLLGLIEATQPSAAKS* |
| Ga0063356_1011779202 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLRLTEPKPVTPAKS* |
| Ga0062595_1002291033 | 3300004479 | Soil | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAKS* |
| Ga0062595_1004199262 | 3300004479 | Soil | MTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEGKQPSPAKS* |
| Ga0062592_1014249931 | 3300004480 | Soil | MTMKDEPDRRRSALIAALSLNRGELDADALERLLGLIEATQPSPAKS* |
| Ga0062594_1001360902 | 3300005093 | Soil | VAAAGANPCVMTTKDEPDRRLSALVAALSLNRGELDAAALERLLRLTEPKPAAPAKS* |
| Ga0065705_101051648 | 3300005294 | Switchgrass Rhizosphere | MTTKDEPDRRFSALIAALSLNRGELDAEALERLLGLIEATQPSPAKS* |
| Ga0070683_1001665255 | 3300005329 | Corn Rhizosphere | MTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEAKQPSPAKS* |
| Ga0070690_1001169465 | 3300005330 | Switchgrass Rhizosphere | RRGGGQGELSVMTTKDEPNRRLSALIAALSLNRGELDADALERLLGLIEATRPSAAKS* |
| Ga0070670_1012933391 | 3300005331 | Switchgrass Rhizosphere | MTTKDEPNRRLSALIAALSLNRGELDADALERLLGLIEATRPSAAKS* |
| Ga0066388_1024611422 | 3300005332 | Tropical Forest Soil | METKDEPDRRLSALVTALSLNRGELDAAALERLLGLIEPKPPVAAKS* |
| Ga0070660_1006560993 | 3300005339 | Corn Rhizosphere | MTTKDESDRRLSALVSALSLNRGELDAAALERLLRLTEPKPAAPAKS* |
| Ga0070669_1005238132 | 3300005353 | Switchgrass Rhizosphere | MTTKDEPDRRLSALVAALSLNRGELDAAALERLLRLTEPKPAAPAKS* |
| Ga0070663_1010145232 | 3300005455 | Corn Rhizosphere | LTERRGGGGIEPCVMTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAKS* |
| Ga0073909_102510551 | 3300005526 | Surface Soil | MTTKDEPDRRFSALIAALSLNRGELDAAALERLLGLIERKPAA |
| Ga0070696_1010473503 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | CVMTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAKS* |
| Ga0068861_1013093542 | 3300005719 | Switchgrass Rhizosphere | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKAAAPAKS* |
| Ga0068858_1002338725 | 3300005842 | Switchgrass Rhizosphere | GGGQGEPSVMTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEAKQPSPAKS* |
| Ga0075286_10688571 | 3300005886 | Rice Paddy Soil | FRVMQTKDDGDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAVTKS* |
| Ga0081455_100122667 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTTKDESDRRLSALVTALSLNRGELDAAALERLLRLIEPKPAAPAKS* |
| Ga0081455_100476103 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIEPKPAAPAKS* |
| Ga0081455_105412021 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTTKDEPDRRLSALVAALSLNRGELDAAVLERLLLLI |
| Ga0075432_101325463 | 3300006058 | Populus Rhizosphere | MTTKDEPDRRLSALIAALSLNRGELDADALERLLGLIEATQPSPAKS* |
| Ga0082029_14166472 | 3300006169 | Termite Nest | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIEATKPTPAKS* |
| Ga0105241_117821222 | 3300009174 | Corn Rhizosphere | MTTKDEPDRRHSALIAALSLNRGELDAAALERLLGLIERKPAAPAKS* |
| Ga0105237_107335203 | 3300009545 | Corn Rhizosphere | SGGGQGEPSVMTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEAKQPSPAKS* |
| Ga0105249_127295532 | 3300009553 | Switchgrass Rhizosphere | MTTKDEPDRRHSALIAALSLNRGELDGDALERLLGLIEGKQPSPAKS* |
| Ga0105249_132217252 | 3300009553 | Switchgrass Rhizosphere | LTERRGGGGIEPCVMTTKDELDRRHSALIAALSLNRGELDADALERLLGLIEGKQPSP |
| Ga0126307_100004693 | 3300009789 | Serpentine Soil | MTTKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAKT* |
| Ga0126305_100367137 | 3300010036 | Serpentine Soil | SRNGGGRGELCVMTTKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAKT* |
| Ga0126312_102637862 | 3300010041 | Serpentine Soil | MTTKDEPDRRLSALIAALSLNRGELDAAALERLLSLIEATQPSPAKT* |
| Ga0126314_102112122 | 3300010042 | Serpentine Soil | MTTKDEPDRRFSALIAALSLNRGELDAASLERLLGLIEATQPSPAKS* |
| Ga0126314_105675132 | 3300010042 | Serpentine Soil | MTTKDEPDRRLSALIAALSLNRGELDAAALERLLS |
| Ga0126311_111096363 | 3300010045 | Serpentine Soil | TKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAKT* |
| Ga0134070_103160562 | 3300010301 | Grasslands Soil | METKDEPDRRLSALVAALSLNRGELDAAALERLLRLTEPQPAGHAKS* |
| Ga0126377_111661512 | 3300010362 | Tropical Forest Soil | MTTKDEPDRRLSALVAALSLNRGELDAAALERLIRLTEPKPAAPAKS* |
| Ga0134124_102299134 | 3300010397 | Terrestrial Soil | MTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEGKQPSPVKS* |
| Ga0134127_107656071 | 3300010399 | Terrestrial Soil | RRLSALISALSLNRGELDAAALERLLSLIEATQPTPAKS* |
| Ga0134127_135379392 | 3300010399 | Terrestrial Soil | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLRLIEATQPAPAKA* |
| Ga0134122_114687873 | 3300010400 | Terrestrial Soil | AAGANPCVMTTKDEPDRRLSALVAALSLNRGELDAAALERLLRLTEPKPAAPAKS* |
| Ga0134122_117030722 | 3300010400 | Terrestrial Soil | LTERRGGGGIEPCVMTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPTAPAKS* |
| Ga0134121_106025071 | 3300010401 | Terrestrial Soil | RRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAKS* |
| Ga0134123_112622763 | 3300010403 | Terrestrial Soil | VMTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAKS* |
| Ga0134123_130843351 | 3300010403 | Terrestrial Soil | MTTKDEPDRRLSALVAALSLNRGELDAAALERLLR |
| Ga0138513_1000240632 | 3300011000 | Soil | MTTKDEPDRRFSALIAALSLNRGELDADALERLLGLIEATQPSPAKG* |
| Ga0105246_110767273 | 3300011119 | Miscanthus Rhizosphere | TKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAKS* |
| Ga0105246_115900983 | 3300011119 | Miscanthus Rhizosphere | ALIAALSLNRSELDAAALERLLRLIEAKPAATAKS* |
| Ga0150985_1205298802 | 3300012212 | Avena Fatua Rhizosphere | AASDPDRRLSALIAALSLNRGELDAASLERLLGLIEATQPSPAKS* |
| Ga0157341_10298571 | 3300012494 | Arabidopsis Rhizosphere | MTTKDEPDRRLSALVAALSLNRGELDAAALERLLRLIEAKPAATAKS* |
| Ga0157326_10655352 | 3300012513 | Arabidopsis Rhizosphere | MRTKDEPDRRLSALIAALSLNRGELDAAALERLLRLIEAKPAATAKS* |
| Ga0157305_101716562 | 3300012891 | Soil | MTTKDEPDRRLSALIAALSLNRGELDADALERLLGLIEATQPSPAKG* |
| Ga0157294_101938983 | 3300012892 | Soil | RSGGGQGEPSVMTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEGKQPSPAKS* |
| Ga0157296_100248942 | 3300012905 | Soil | MTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEATQPSPAKG* |
| Ga0157296_100256524 | 3300012905 | Soil | MTTKDEPDRRLSALVTALSLKRGELDAAALERLLGLIERKPAAPAKS* |
| Ga0157286_104635681 | 3300012908 | Soil | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLRLTEPKPITPAKS* |
| Ga0157301_103842342 | 3300012911 | Soil | MTTKDEPDRRLSALISALSLNRGELDAAALERLLSLIEATQPTPAKS* |
| Ga0157306_102465932 | 3300012912 | Soil | MTTKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAKS* |
| Ga0157302_101198152 | 3300012915 | Soil | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPVEPAKS* |
| Ga0126375_109090222 | 3300012948 | Tropical Forest Soil | MTTKDEPDRRLSALVAALSLNRGELDAAAIERLIRLTEPKPAAPAKG* |
| Ga0157307_10620882 | 3300013096 | Soil | MTTKDEPNRRLSALIAALSLNRSELDADALERLLGLIEATRPSAAKS* |
| Ga0157307_10736562 | 3300013096 | Soil | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGL |
| Ga0075314_11050531 | 3300014265 | Natural And Restored Wetlands | RSELCVMTTKDEHARRLSALVTALSLNRGELDAAALERLLGLIEARQAAPAKS* |
| Ga0075325_10362872 | 3300014270 | Natural And Restored Wetlands | MTTKDEHARRLSALVTALSLNRGELDAAALERLLGLIEARQAAPAKS* |
| Ga0163163_105908311 | 3300014325 | Switchgrass Rhizosphere | GEPSVMTTKDELDRRHSALIAALSLNRGELDADALERLLGLIEGKQPSPAKS* |
| Ga0157380_108244851 | 3300014326 | Switchgrass Rhizosphere | NRRLSALIAALSLNRGELDADALERLLGLIEATQPSAAKS* |
| Ga0173478_102268202 | 3300015201 | Soil | MTTKDEPDRRLSALISALSLNRGELGAAALERLLGLIEATQPSPAKG* |
| Ga0132257_1017328452 | 3300015373 | Arabidopsis Rhizosphere | MTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEEKQP |
| Ga0132257_1018309821 | 3300015373 | Arabidopsis Rhizosphere | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPA |
| Ga0190266_100141525 | 3300017965 | Soil | MTTKDEPDRRFSALIAALSLNRGELDAEALERLLGLIEATQPSPAKS |
| Ga0184608_105165711 | 3300018028 | Groundwater Sediment | HRNGGGRGEPSVMTTKHEPDRRLSALIAALSLNRGELDADALERLLGLIEATQPSPAKG |
| Ga0184620_100532363 | 3300018051 | Groundwater Sediment | MTTKDEPDRRFSALIAALSLNRGELDADALERLLGLIEATQPSPAKS |
| Ga0184621_101523432 | 3300018054 | Groundwater Sediment | MTTKDEPDRRLSALITALSLNRGELDAAALERLLGRLEPKPAAPAPKAR |
| Ga0184617_11848751 | 3300018066 | Groundwater Sediment | MTTKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAKS |
| Ga0184611_12215582 | 3300018067 | Groundwater Sediment | MTTKDEPDRRFSALIAALSLNRGELDADALERLLGLIEATQPSPAKG |
| Ga0184624_100296191 | 3300018073 | Groundwater Sediment | KIVTTTKDEPDRRLSALVTALSLNRGELDAAALERLLRLTEPKPAAAAKT |
| Ga0184624_101491442 | 3300018073 | Groundwater Sediment | MTTKDEPDRRLSALIAALSLNRGELDADALERLLGLIEATQPSPAKG |
| Ga0184625_106234512 | 3300018081 | Groundwater Sediment | MTTKDEPDRRLSALIAALSLNRGELDADALERLLGLIEATQPSPAKS |
| Ga0190268_101252972 | 3300018466 | Soil | MTTKDEPDRRFSALIAALSLNRGELDAEALERLLGLIEVTQPSPAKS |
| Ga0190270_115503802 | 3300018469 | Soil | MTTKDEPDRRFSALIAALSLNRGELDAAALERLLGLIEATQPSPAKT |
| Ga0173481_100140883 | 3300019356 | Soil | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAKS |
| Ga0173481_104683182 | 3300019356 | Soil | MTTKDEPDRRLSALISALSLNRGELDAAALERLLSLIEATQPTPAKS |
| Ga0173482_102136732 | 3300019361 | Soil | MTTKDEPDRRLSALVAALSLNRGELDAGALERLLRLTEPKPAAPAKS |
| Ga0190267_106461222 | 3300019767 | Soil | MTTKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAKT |
| Ga0193696_10353333 | 3300020016 | Soil | MTTKDEPDRRFSALIAAPSLNRGELDADALERLLGLIEATQPSPAKG |
| Ga0210381_101345821 | 3300021078 | Groundwater Sediment | LITALSLNRGELDAAALERLLGRLEPKPAAPAPKAR |
| Ga0182009_105779392 | 3300021445 | Soil | MQTKDENDRRLSALVTALSLNRGELDAAALERLLGVIEPKPTAAAKS |
| Ga0222622_104804342 | 3300022756 | Groundwater Sediment | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLRLTEPKPAAAAKT |
| Ga0207656_103164632 | 3300025321 | Corn Rhizosphere | MTTKDEPNRRLSALIAALSLNRGELDADALERLLGLIEATQPSAAKS |
| Ga0207642_102764342 | 3300025899 | Miscanthus Rhizosphere | LTERRGGGGIEPCVMTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAK |
| Ga0207688_100231566 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEAKQPSPAKS |
| Ga0207647_103731032 | 3300025904 | Corn Rhizosphere | MTTKDESDRRLSALVSALSLNRGELDAAALERLLRLTEPKPAAPAKS |
| Ga0207645_108441502 | 3300025907 | Miscanthus Rhizosphere | MTTKDEPDRRLSALVAALSLNRGELDAAALERLLRLTEPKPAAPAKS |
| Ga0207671_113804271 | 3300025914 | Corn Rhizosphere | GGGQGEPSVMTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEAKQPSPAKS |
| Ga0207657_109350362 | 3300025919 | Corn Rhizosphere | VAAAGANPCVMTTKDEPDRRLSALVAALSLNRGELDAAALERLLRLTEPKPAAPAKS |
| Ga0207650_112101442 | 3300025925 | Switchgrass Rhizosphere | MTTKDEPNRRLSALIAALSLNRGELDADALERLLGLIEATRPSAAKS |
| Ga0207704_112820732 | 3300025938 | Miscanthus Rhizosphere | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIARKPA |
| Ga0207704_118303232 | 3300025938 | Miscanthus Rhizosphere | EPCVMTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAKS |
| Ga0207691_104225111 | 3300025940 | Miscanthus Rhizosphere | QGEPSVMTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEAKQPSPAKS |
| Ga0207661_101485622 | 3300025944 | Corn Rhizosphere | MTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEGKQPSPAKS |
| Ga0207679_101318675 | 3300025945 | Corn Rhizosphere | VMTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEGKQPSPAKS |
| Ga0207712_106600032 | 3300025961 | Switchgrass Rhizosphere | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPA |
| Ga0208284_10171671 | 3300026003 | Rice Paddy Soil | MTTKDDSDRRLSALVAALSLNRGELDAAALERLLALVEPRPAAAK |
| Ga0207677_107413603 | 3300026023 | Miscanthus Rhizosphere | GVAAAGANPCVMTTKDEPDRRLSALVAALSLNRGKLDAAALERLLRLTEPKPAAPAKS |
| Ga0207677_119829461 | 3300026023 | Miscanthus Rhizosphere | IEPCVMTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAKS |
| Ga0207703_119841842 | 3300026035 | Switchgrass Rhizosphere | MTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEGKQPSPVKS |
| Ga0207648_101363704 | 3300026089 | Miscanthus Rhizosphere | MTTKDEPDRRHSALIAALSLNRGELDADALERLLGLIEAKQPSPAKG |
| Ga0209966_10467123 | 3300027695 | Arabidopsis Thaliana Rhizosphere | LTERRGGGGIEPSVMTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAK |
| Ga0209974_102323311 | 3300027876 | Arabidopsis Thaliana Rhizosphere | TKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKPAAPAKS |
| Ga0207428_100593453 | 3300027907 | Populus Rhizosphere | MRTKDEPDRRLSALVAALSLNRGELDAAALERLLRLIEAKPAATAKS |
| Ga0307295_101756383 | 3300028708 | Soil | PCLLTPTPEPARRFSALIAALSLNRGELDADALERLLGLIEATQPSPAKG |
| Ga0307285_102367921 | 3300028712 | Soil | DRRLSALVTALSLNRGELDAAALERLLRLTEPKPAAAAKT |
| Ga0307317_101035081 | 3300028720 | Soil | EPDRRFSALIAALSLNRGELDADALERLLGLIEATQPSPAKG |
| Ga0307297_101373233 | 3300028754 | Soil | GSNKIVMTTKDEPDRRLSALVTALSLNRGELDAAALERLLRLTEPKPAAAAKT |
| Ga0307288_103183173 | 3300028778 | Soil | GGGRGEPSVMTTKDEPDRRFSALIAALSLNSGELDADALERLLGLIEATQPSPAKG |
| Ga0307305_101279641 | 3300028807 | Soil | MTTKDEPDRRLSALITALSLNRGELDAAALERLLGRLEPKPAAPA |
| Ga0307292_100907412 | 3300028811 | Soil | MTTKDEPDRRLSALITALSLNRGELDAAALERLLGRLEPKPAAPAPKAG |
| Ga0307314_101003211 | 3300028872 | Soil | HLKRHRNGGGRGEPSVMTTKDEPDRRFSALIAALSLNRGELDADALERLLGLIEATQPSPAKG |
| Ga0307289_102075472 | 3300028875 | Soil | MTTKDENDRRLSALVAALSLNRGELDAAALERLLRLTEPKPVAPAKS |
| Ga0307286_100585961 | 3300028876 | Soil | GVMTTKDEPDRRLSALIAALSLNRGELDADALERLLGLIEATQPSPAKS |
| Ga0247826_101242362 | 3300030336 | Soil | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKAAAPAKS |
| Ga0247826_105719123 | 3300030336 | Soil | RHRNGGGRGEPSVMTTKDEPDRRFSALIAALSLNRGELDADALERLLGLIEATQPSPAKG |
| Ga0310886_102735443 | 3300031562 | Soil | MTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIEATQPSPAKS |
| Ga0307413_100189427 | 3300031824 | Rhizosphere | KDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAQS |
| Ga0310904_100073621 | 3300031854 | Soil | KRHRNGGGRGEPSVMTTKNEPDRRLSALIAALSLNRGELDADALERLLGLIEATQPSPAK |
| Ga0307406_101368605 | 3300031901 | Rhizosphere | MTTKDEPDRRLSALIAALSLNRGELDADALERLLGLIEATQPSPAES |
| Ga0308175_1006202104 | 3300031938 | Soil | MTTKDEPDRRLSALIAALSLNRGELDAASLERLLGLIEATQPSPAKS |
| Ga0308176_129063051 | 3300031996 | Soil | MTTKDEPDRRLSALVAALSLNRGELDAAALERLLRLTEPKPVAPAKS |
| Ga0310903_100993863 | 3300032000 | Soil | MTTKDEPDRRLSALVTALSLNRGELDADALERLLGLIEATQPSPAKS |
| Ga0310897_104246681 | 3300032003 | Soil | LKRHRNGGGRGEPSVMTTKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAKS |
| Ga0307414_107778622 | 3300032004 | Rhizosphere | MTTKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAKR |
| Ga0310899_105762491 | 3300032017 | Soil | KRHRNGGGRGEPCVMTTKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAK |
| Ga0310890_104821221 | 3300032075 | Soil | RHRNGGGGIEPCVMTTKDEPDRRFSALIAALSLNRGELDADALERLLGLIEATQPSPAKG |
| Ga0310895_106025171 | 3300032122 | Soil | RNGGGRGEPCVMTTKDEPDRRLSALIAALSLNRGELDADALERLLGLIEATQPSPAKS |
| Ga0307415_1006271282 | 3300032126 | Rhizosphere | MTTKDEPDRRLSALIAALSLNRGELDAAALERLLGLIEATQPSPAK |
| Ga0247829_103297143 | 3300033550 | Soil | LTERRGGGGIEPCVMTTKDEPDRRLSALVTALSLNRGELDAAALERLLGLIERKAAAPAK |
| Ga0247829_109333272 | 3300033550 | Soil | MTTKDEPDRRLSALVAALSLNRGELDAAALERLLKLTEPKPAAPAKS |
| ⦗Top⦘ |