Basic Information | |
---|---|
Family ID | F049893 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 146 |
Average Sequence Length | 47 residues |
Representative Sequence | MLLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKQAA |
Number of Associated Samples | 106 |
Number of Associated Scaffolds | 146 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 27.27 % |
% of genes near scaffold ends (potentially truncated) | 22.60 % |
% of genes from short scaffolds (< 2000 bps) | 70.55 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.40 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (56.164 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil (12.329 % of family members) |
Environment Ontology (ENVO) | Unclassified (19.863 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.795 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.67% β-sheet: 0.00% Coil/Unstructured: 53.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 146 Family Scaffolds |
---|---|---|
PF01979 | Amidohydro_1 | 44.52 |
PF10282 | Lactonase | 38.36 |
PF01882 | DUF58 | 0.68 |
PF12345 | DUF3641 | 0.68 |
PF13462 | Thioredoxin_4 | 0.68 |
PF01566 | Nramp | 0.68 |
PF12867 | DinB_2 | 0.68 |
PF01553 | Acyltransferase | 0.68 |
PF01578 | Cytochrom_C_asm | 0.68 |
COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
---|---|---|---|
COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.68 |
COG1914 | Mn2+ or Fe2+ transporter, NRAMP family | Inorganic ion transport and metabolism [P] | 0.68 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 56.16 % |
Unclassified | root | N/A | 43.84 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002568|C688J35102_119400574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
3300002568|C688J35102_120986498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6730 | Open in IMG/M |
3300002906|JGI25614J43888_10079505 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
3300003324|soilH2_10359658 | All Organisms → cellular organisms → Bacteria | 1876 | Open in IMG/M |
3300004479|Ga0062595_100064072 | All Organisms → cellular organisms → Bacteria | 1766 | Open in IMG/M |
3300004479|Ga0062595_100628080 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300004800|Ga0058861_11288811 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
3300004803|Ga0058862_10289124 | Not Available | 689 | Open in IMG/M |
3300005186|Ga0066676_10314650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
3300005329|Ga0070683_100170257 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2067 | Open in IMG/M |
3300005332|Ga0066388_100766739 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300005336|Ga0070680_100178440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1789 | Open in IMG/M |
3300005434|Ga0070709_10453436 | Not Available | 967 | Open in IMG/M |
3300005434|Ga0070709_11635689 | Not Available | 525 | Open in IMG/M |
3300005436|Ga0070713_101235149 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
3300005437|Ga0070710_11128613 | Not Available | 577 | Open in IMG/M |
3300005439|Ga0070711_100415299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1095 | Open in IMG/M |
3300005439|Ga0070711_101481341 | Not Available | 592 | Open in IMG/M |
3300005458|Ga0070681_10246769 | Not Available | 1698 | Open in IMG/M |
3300005458|Ga0070681_10774993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
3300005518|Ga0070699_101777616 | Not Available | 564 | Open in IMG/M |
3300005518|Ga0070699_102144762 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300005529|Ga0070741_10009497 | All Organisms → cellular organisms → Bacteria | 18840 | Open in IMG/M |
3300005530|Ga0070679_101748957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300005532|Ga0070739_10360722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
3300005533|Ga0070734_10003093 | All Organisms → cellular organisms → Bacteria | 18284 | Open in IMG/M |
3300005533|Ga0070734_10029661 | All Organisms → cellular organisms → Bacteria | 3473 | Open in IMG/M |
3300005537|Ga0070730_10151288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1574 | Open in IMG/M |
3300005538|Ga0070731_10878355 | Not Available | 594 | Open in IMG/M |
3300005542|Ga0070732_10020570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3710 | Open in IMG/M |
3300005542|Ga0070732_10834308 | Not Available | 562 | Open in IMG/M |
3300005542|Ga0070732_10959935 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
3300005547|Ga0070693_100652045 | Not Available | 766 | Open in IMG/M |
3300005575|Ga0066702_10276715 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
3300005587|Ga0066654_10588572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
3300005587|Ga0066654_10668169 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300005616|Ga0068852_101039558 | Not Available | 838 | Open in IMG/M |
3300005764|Ga0066903_106403206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300006050|Ga0075028_100396852 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300006172|Ga0075018_10684136 | Not Available | 553 | Open in IMG/M |
3300006173|Ga0070716_101308633 | Not Available | 586 | Open in IMG/M |
3300006175|Ga0070712_100423619 | Not Available | 1103 | Open in IMG/M |
3300006903|Ga0075426_10144706 | Not Available | 1713 | Open in IMG/M |
3300006954|Ga0079219_10690232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 773 | Open in IMG/M |
3300007788|Ga0099795_10034625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1760 | Open in IMG/M |
3300009545|Ga0105237_10837125 | Not Available | 927 | Open in IMG/M |
3300009551|Ga0105238_11032928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
3300009651|Ga0105859_1278144 | Not Available | 518 | Open in IMG/M |
3300009662|Ga0105856_1116259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 791 | Open in IMG/M |
3300010159|Ga0099796_10281786 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300010159|Ga0099796_10363026 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300010371|Ga0134125_12364939 | Not Available | 578 | Open in IMG/M |
3300010373|Ga0134128_10520783 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
3300010373|Ga0134128_10840751 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300010375|Ga0105239_11231096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 863 | Open in IMG/M |
3300010397|Ga0134124_10157376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2032 | Open in IMG/M |
3300010399|Ga0134127_12543516 | Not Available | 592 | Open in IMG/M |
3300012202|Ga0137363_11121767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
3300012212|Ga0150985_119536622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
3300012469|Ga0150984_104637182 | Not Available | 509 | Open in IMG/M |
3300012582|Ga0137358_10334290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Gallionellaceae → Candidatus Nitrotoga → unclassified Candidatus Nitrotoga → Candidatus Nitrotoga sp. LAW | 1027 | Open in IMG/M |
3300012683|Ga0137398_10035374 | All Organisms → cellular organisms → Bacteria | 2867 | Open in IMG/M |
3300012930|Ga0137407_12396186 | Not Available | 504 | Open in IMG/M |
3300012955|Ga0164298_10016086 | All Organisms → cellular organisms → Bacteria | 3073 | Open in IMG/M |
3300012957|Ga0164303_10417855 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
3300012958|Ga0164299_10314210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 969 | Open in IMG/M |
3300012958|Ga0164299_10390423 | Not Available | 890 | Open in IMG/M |
3300012958|Ga0164299_10493027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 813 | Open in IMG/M |
3300012958|Ga0164299_10691624 | Not Available | 712 | Open in IMG/M |
3300012960|Ga0164301_10429748 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
3300012960|Ga0164301_10580252 | Not Available | 824 | Open in IMG/M |
3300012971|Ga0126369_13121131 | Not Available | 542 | Open in IMG/M |
3300012984|Ga0164309_10569417 | Not Available | 879 | Open in IMG/M |
3300012985|Ga0164308_10042046 | All Organisms → cellular organisms → Bacteria | 2887 | Open in IMG/M |
3300012986|Ga0164304_10696349 | Not Available | 771 | Open in IMG/M |
3300012986|Ga0164304_10826978 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300012987|Ga0164307_10324472 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300012987|Ga0164307_10630233 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
3300013296|Ga0157374_12084335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 594 | Open in IMG/M |
3300015089|Ga0167643_1047977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
3300015242|Ga0137412_10761854 | Not Available | 714 | Open in IMG/M |
3300020070|Ga0206356_11009008 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300020078|Ga0206352_10967452 | Not Available | 696 | Open in IMG/M |
3300020078|Ga0206352_11120949 | Not Available | 548 | Open in IMG/M |
3300020610|Ga0154015_1572658 | Not Available | 798 | Open in IMG/M |
3300021180|Ga0210396_11214107 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300021404|Ga0210389_10026648 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4451 | Open in IMG/M |
3300021475|Ga0210392_10290611 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300021560|Ga0126371_10178201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2207 | Open in IMG/M |
3300022467|Ga0224712_10333857 | Not Available | 714 | Open in IMG/M |
3300023056|Ga0233357_1009470 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
3300024288|Ga0179589_10278835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 748 | Open in IMG/M |
3300024288|Ga0179589_10396186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 632 | Open in IMG/M |
3300025544|Ga0208078_1007296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2711 | Open in IMG/M |
3300025912|Ga0207707_10191321 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
3300025913|Ga0207695_10123239 | All Organisms → cellular organisms → Bacteria | 2558 | Open in IMG/M |
3300025913|Ga0207695_11218631 | Not Available | 633 | Open in IMG/M |
3300025914|Ga0207671_11272657 | Not Available | 573 | Open in IMG/M |
3300025917|Ga0207660_10302145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1274 | Open in IMG/M |
3300025917|Ga0207660_11620241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300025920|Ga0207649_10463994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 958 | Open in IMG/M |
3300025929|Ga0207664_10766602 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
3300025944|Ga0207661_10404642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1238 | Open in IMG/M |
3300025981|Ga0207640_11409110 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300026078|Ga0207702_10654842 | Not Available | 1033 | Open in IMG/M |
3300026078|Ga0207702_11362960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
3300026319|Ga0209647_1228904 | Not Available | 626 | Open in IMG/M |
3300026557|Ga0179587_10126770 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
3300026557|Ga0179587_10199245 | Not Available | 1268 | Open in IMG/M |
3300027307|Ga0209327_1044200 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
3300027574|Ga0208982_1048145 | Not Available | 847 | Open in IMG/M |
3300027773|Ga0209810_1291678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
3300027826|Ga0209060_10004971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 9910 | Open in IMG/M |
3300027826|Ga0209060_10063461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1761 | Open in IMG/M |
3300027842|Ga0209580_10015592 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3326 | Open in IMG/M |
3300027842|Ga0209580_10393835 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300027903|Ga0209488_10045089 | All Organisms → cellular organisms → Bacteria | 3241 | Open in IMG/M |
3300028800|Ga0265338_10178425 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
3300031057|Ga0170834_102818541 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1288 | Open in IMG/M |
3300031938|Ga0308175_100167022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2130 | Open in IMG/M |
3300033412|Ga0310810_11328118 | Not Available | 562 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 12.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.27% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.59% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.22% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 6.16% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.11% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.11% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.11% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.74% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.74% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.05% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.05% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.37% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.37% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.37% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.37% |
Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 1.37% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.68% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.68% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.68% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.68% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.68% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.68% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
3300009662 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027574 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027773 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
C688J35102_1194005742 | 3300002568 | Soil | MVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKQVA* |
C688J35102_1209864981 | 3300002568 | Soil | MMLWIILGMGWVAILFAGITLFRLADYADKKVRRLAERPRQRKKQAA* |
JGI25614J43888_100795052 | 3300002906 | Grasslands Soil | MLLWIILGMGWLGVLFAAVSLFRIAGYADKKMRRLAQRPRRREDQAA* |
soilH2_103596582 | 3300003324 | Sugarcane Root And Bulk Soil | MLLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKIAA* |
Ga0063455_1013160931 | 3300004153 | Soil | MLLWIILGLSWIIILFAAVCLFRIAGYADKKMRRIVQRPRRSEDQAA* |
Ga0062595_1000640722 | 3300004479 | Soil | MVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKIAA* |
Ga0062595_1005339951 | 3300004479 | Soil | MLLWIILGISWAVILCVAVCLFRLAGYADKKMRNLAQRPRRREDQAA* |
Ga0062595_1006280802 | 3300004479 | Soil | MVLWIILGMGWLAILFAGISLFRLADYADKKVRRLTERPRQRNKQAA* |
Ga0058861_112888111 | 3300004800 | Host-Associated | MLWIILGMGWLAILFAGVTLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0058862_102891241 | 3300004803 | Host-Associated | ILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKQVA* |
Ga0066676_103146503 | 3300005186 | Soil | MLWIILGMGWLAILFAGVVLFRLADYADKKVRRLADRPRERKKQAA* |
Ga0070683_1001702572 | 3300005329 | Corn Rhizosphere | MMLWIILGMGWLAILFAGVTLFRLADYADKKVRRLAERPRQRKNQAA* |
Ga0066388_1002299433 | 3300005332 | Tropical Forest Soil | MLLWVILGFSWIVILLVAISLFRIAGYADRKMRRLAQRPRRREDQAA* |
Ga0066388_1007667392 | 3300005332 | Tropical Forest Soil | MLLWIILGLGWIAVLLAAVALFRLAGYADKKVRRRLTTRPRRSEDQAA* |
Ga0070680_1001784402 | 3300005336 | Corn Rhizosphere | MMLWIILGMGWLAILFAGVTLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0070709_101002892 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLWIILGISWAVILCAAVCLFRLAGYADKKMRNFAQRPRRREDQAA* |
Ga0070709_104534362 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRERKKQAA* |
Ga0070709_116356892 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLWIILGMGWLAILFAGITLFRLADYADKKVRRLAERPRERKKQAA* |
Ga0070713_1012351492 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLWVILGMGWLAILFAGITLFRLADYADRKLRRLAERPKQRKKQAA* |
Ga0070710_111286131 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLWIILVIGWLGILVAGVSLFRIAGYADKKVRRFVERPRYRNDQAA* |
Ga0070711_1004152991 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLWIILGMGWLGVLFAAVSLFRIAGYADKKMRRLAQRPRRR |
Ga0070711_1014813412 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0070681_102467691 | 3300005458 | Corn Rhizosphere | MMLWIILGMGWLAILFAGVTLFRLADYADRKVRRLAERPRQRKKQAA* |
Ga0070681_107749931 | 3300005458 | Corn Rhizosphere | MLWIILGMGWLAILFAGITLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0070699_1017776162 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IILGMGWLAILFAGISLFRLADYADKKVRRLTERPRQRNKQAA* |
Ga0070699_1021447621 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLWLILGMGWLAILFAGIILFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0070741_100094973 | 3300005529 | Surface Soil | MLLWVILGLCWLVILFAGVSLFRIAGYADKKMRRLVHRPRHSGDQAA* |
Ga0070679_1017489572 | 3300005530 | Corn Rhizosphere | MVLWIILGMAWLAILFAGITLFRLADYADKKVRRFAERPRERKKQAA* |
Ga0070739_103607222 | 3300005532 | Surface Soil | MLLWIILALGWIGVLMAGVALFRLASFADRQMRRYAQRPRQQEDQAA* |
Ga0070734_1000309321 | 3300005533 | Surface Soil | MVLWIILGMGWLAIMFAGIMLFRLAGYADRKVRRLAERPRQRKKQAA* |
Ga0070734_100296613 | 3300005533 | Surface Soil | MLMWIILGFGWLAILFAGVSLFRLAGYADKKVRRLAQRPRQRNNQAA* |
Ga0070730_100243823 | 3300005537 | Surface Soil | MLLWIILGICWGVILCAAICLFRLAGYADKKMRNLAQRPRRREDQAA* |
Ga0070730_100247604 | 3300005537 | Surface Soil | MLLWIILGISWAVILFAGVCLFRLAGYADKKMRNLAQRPRGREDQAA* |
Ga0070730_101512882 | 3300005537 | Surface Soil | MVLWIILGLGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0070731_108783552 | 3300005538 | Surface Soil | MLMWIILGFGWLAILFAGVSLFRLAGYADKQVRRLTQRPRERNNQAA* |
Ga0070732_100205704 | 3300005542 | Surface Soil | MVLWVILGMGWLAILFAGVSLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0070732_108343082 | 3300005542 | Surface Soil | ILGMGWLAILFAGITLFRLADYADKKLRRLAERPKQRKKQAA* |
Ga0070732_109599351 | 3300005542 | Surface Soil | MVLWIILGMGWLAILFAGITLFRLADYADKKLRRLAERPKQRKKQAA* |
Ga0070693_1006520451 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKLVA* |
Ga0066703_103934972 | 3300005568 | Soil | MLLWIILGLSWAFILCAAVCLFRIAGYADRQMRRRLSQRPQRRRAAEDQTA* |
Ga0066702_102767152 | 3300005575 | Soil | MMLWIILGMGWLAILFAGISLFRLAGYADKKVRRLAERPRERKKQAA* |
Ga0066654_105885722 | 3300005587 | Soil | MMLWIILGLGWLAILFAGVTLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0066654_106681692 | 3300005587 | Soil | MMLWIILGMGWVAILFAGITLFRLADYAEKKVRRLAERPRQRKKQAA* |
Ga0068852_1010395582 | 3300005616 | Corn Rhizosphere | ILFAGVTLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0066903_1002465694 | 3300005764 | Tropical Forest Soil | MLLWIILGLGWIAVLLAAVALVRLAGYADKKVRRRLTTRTRRSEDQAA* |
Ga0066903_1003353332 | 3300005764 | Tropical Forest Soil | MLLWVILGFSWLVILLAAISIFRIAGYADRKMRRLTQRPRRNEDQAA* |
Ga0066903_1064032061 | 3300005764 | Tropical Forest Soil | MLLWIILGIGWLGILFAGVSLFRIAGYADKKVRRFVDRPRYRVER |
Ga0070717_106752612 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MLLWIILGISWAVILCAAVCVFRLAGYADKKMRNFAQRPRRREDQAA* |
Ga0075028_1003968522 | 3300006050 | Watersheds | MVLWIILGIGWLAILFAGISLFRLADYADKKVRRLAERPRQRNKQAA* |
Ga0075018_106841362 | 3300006172 | Watersheds | RRNESITRMLLWIILGLGWLGVLFAAVCLFRIAGYADKKVRRLAERPRRREDRAA* |
Ga0070716_1013086332 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLWIILGMGWLAILFAGITLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0070712_1004236192 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRERKKQAA* |
Ga0070712_1011524122 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | SWAVILWAAVCLFRLAGYADKKMRNFAQRPRRREDQAA* |
Ga0075426_101447062 | 3300006903 | Populus Rhizosphere | MGWLAILFAGISLFRLADYADKKVRRLTERPRQRNKQAA* |
Ga0079219_106902322 | 3300006954 | Agricultural Soil | MLLWIILGMGWLGVLFAGVSLFRIAGYADKKMRRLAQRPRRREDQAA* |
Ga0099795_100346252 | 3300007788 | Vadose Zone Soil | MLLWIILGLGWLGILFAGVALFRLADYADKKVRRLADRPRQRKKQAA* |
Ga0105237_108371252 | 3300009545 | Corn Rhizosphere | MVLWIILGMAWLAVLFAGITLFRLADYADKKVRRFAERPRERKKQAA* |
Ga0105238_110329282 | 3300009551 | Corn Rhizosphere | MVLWLILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKQVA* |
Ga0105859_12781441 | 3300009651 | Permafrost Soil | MLLWIILGVGWLCILLAGISLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0105856_11162591 | 3300009662 | Permafrost Soil | MLLWIILGFGWLGILVAGVSLFRFAAYADKKVRRLTERPRRRDKQAA* |
Ga0126384_100593903 | 3300010046 | Tropical Forest Soil | MLLWIILGISWALILCAAICVFRLAGYADKKMRRFTQRPRHREDQAA* |
Ga0126384_123018131 | 3300010046 | Tropical Forest Soil | MLLWVILGFSWVAILLAAISLFRIAGYADRKMRRFVQRPRRGEDHAT* |
Ga0126382_116360102 | 3300010047 | Tropical Forest Soil | MLLWIILGFSWLVILLAAISLFRIAGYADRKMRRLTQRQRRREDQAA* |
Ga0099796_102817862 | 3300010159 | Vadose Zone Soil | MLLWIILGMGWLAILFAGITLFRLADYADKKVRRLAERPRQRKNQAA* |
Ga0099796_103630262 | 3300010159 | Vadose Zone Soil | MVLWIILGMGWLAILFAGIILFRLADYADKKVRRLTERPRERKKQAA* |
Ga0126370_117994662 | 3300010358 | Tropical Forest Soil | LGISWALILCAAICVFRLAGYADKKMRRFTQRPRHREDQAA* |
Ga0126376_105470262 | 3300010359 | Tropical Forest Soil | MLLWVILGFGWLVILLAAISLFRIAGYADRKMRRLTQRPRRNEDQAA* |
Ga0126378_111014712 | 3300010361 | Tropical Forest Soil | MLLWIILALAWIVILFAAVSLFRIAGYADKKMRRLAHRPRRREDQAA* |
Ga0134125_123649392 | 3300010371 | Terrestrial Soil | WLAILFAGITLFRLADYADKKVRRLAERPRQRRKQAA* |
Ga0134128_105207832 | 3300010373 | Terrestrial Soil | MVLWLILGMGWLAILFAGVILFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0134128_108407512 | 3300010373 | Terrestrial Soil | MGRLVILFAGVRLFRLANYADKKVRRLAERPRQRKKLAA* |
Ga0105239_112310962 | 3300010375 | Corn Rhizosphere | MMLWIILGMGWLAILFAGITLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0134124_101573762 | 3300010397 | Terrestrial Soil | MLLWIILGMGWLGILIAGVSLFRIAGYADKKLRRLVDRPDRTDHPRYRTDRPRYRNDQAA |
Ga0134127_125435162 | 3300010399 | Terrestrial Soil | MVLWIILGMGWLAILFAGVSLFRLANYADKKVRRLAERPRQRKKLVA* |
Ga0134121_127582642 | 3300010401 | Terrestrial Soil | MLLWIILGLSWVIILFAAVCLFRIAGYADKKMRRIVQRPRRSEDQAA* |
Ga0137363_111217671 | 3300012202 | Vadose Zone Soil | MLLWIILALGWLGILLAAISLFRLANYADKKVRRMAQRPRRREDQAA* |
Ga0150985_1195366223 | 3300012212 | Avena Fatua Rhizosphere | MMLWIILGMGWLAILFAGVVLFRLADYADKKVRRLADRPRERKKQAA* |
Ga0150984_1046371821 | 3300012469 | Avena Fatua Rhizosphere | ILGIGWLGILFAGVSLFRIAGYADKKVRRFVDRPRYRVERSRYRNDQAA* |
Ga0137358_103342902 | 3300012582 | Vadose Zone Soil | DVNLFRQMLLWIILALGWLGILLAAISLFRLANYADKKVRRMAQRPRRREDQAA* |
Ga0137398_100353742 | 3300012683 | Vadose Zone Soil | MESYCWMLLWIILGLGWLGILFAGVALFRLADYADKKVRRLADRPRQRKKQAA* |
Ga0137407_123961862 | 3300012930 | Vadose Zone Soil | LVLLWIILGLGWLGILFAGVALFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0164298_100160862 | 3300012955 | Soil | MLVWIILGVGWLGVLFAGIALFRLADYADKKVRRLADRPRQRHKQAA* |
Ga0164303_104178552 | 3300012957 | Soil | MLVWIILGVGWLGVLFAGIALFRLADYADKKVRRLAERPRQRHKQAA* |
Ga0164299_103142101 | 3300012958 | Soil | MVLWIILGMGWLAIMFAGIMLFRLADYADRKVRRLAERPRQRKKQAA |
Ga0164299_103904232 | 3300012958 | Soil | MLLWIILGLGWLGILLAAVCLFRLAGYADKKVRRLSARPRRREDQAA* |
Ga0164299_104930272 | 3300012958 | Soil | MLLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0164299_106916242 | 3300012958 | Soil | WLAILFAGISLFRLAEYADKKVRRLAERPRERKKQAA* |
Ga0164301_104297482 | 3300012960 | Soil | MVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQREKQAA* |
Ga0164301_105802522 | 3300012960 | Soil | LLLVWIILVVGWLGVLFAGIALFRLADYADKKVRRLADRPRHRHKQAA* |
Ga0126369_100627093 | 3300012971 | Tropical Forest Soil | MLLWIILGISWALILCAAVCLFRLAGYADKKMRNFKMRSFAQRSRRREDQAA* |
Ga0126369_131211312 | 3300012971 | Tropical Forest Soil | MLLWIILGLGWIAVLLAAVALVRLAGYADKKVRRRLTTRPRRSEDQAA* |
Ga0164309_105694171 | 3300012984 | Soil | MLLWIILGIGWLGILFAGVSLFRIAGYADKKVRRFVERPRYRNDQAA* |
Ga0164308_100420463 | 3300012985 | Soil | MLVWIILGVGWLGVLFAGIAVFRLADYADKKVRRLADRPRQRHKQAA* |
Ga0164304_106963492 | 3300012986 | Soil | VERPLSPTPQYWIESYSVMLLWIILGMGWLAILFAGVSLFRLADYADKKVRRLAERPRQRKKQAA* |
Ga0164304_108269782 | 3300012986 | Soil | MVLWIILGMGWLAIMFAGIMLFRLADYADRKVRRLAERPRQRKKQAA* |
Ga0164307_103244722 | 3300012987 | Soil | MLVWIILGGGCLVVLFAGIALFRLADYADKKVRRLADRPRQRHKQAA* |
Ga0164307_106302332 | 3300012987 | Soil | MLLWIILGMGWLAIIIAGISLFRLADYADKKVRRLAERPRERKKQAA* |
Ga0157374_120843352 | 3300013296 | Miscanthus Rhizosphere | MVLWIILGMGWLAILFAGITLLRLADYADKKVRRLAERPRQRKKQAA* |
Ga0167643_10479771 | 3300015089 | Glacier Forefield Soil | MLLWIILGFGWLGILVAGVSLFRFAGYADKKVRRLTERPRRGDKQAA* |
Ga0137412_107618542 | 3300015242 | Vadose Zone Soil | MLLWIILGLGWLGILFAGVALFRLADYADKKVRRLAERPRHRSKQTA* |
Ga0206356_110090082 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLWIILGMAWLAVLFAGITLFRLADYADKKVRRFAERPRERKKQAA |
Ga0206352_109674522 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLWIILGMGWLAILFAGVTLFRLADYADKKVRRLAERPRQRKKQAA |
Ga0206352_111209492 | 3300020078 | Corn, Switchgrass And Miscanthus Rhizosphere | WIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKQVA |
Ga0154015_15726582 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | VQPGNKGLNLIAMVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKQVA |
Ga0210396_112141071 | 3300021180 | Soil | MWIILGFGWLGVLLAGVSLFRVASFADKKVRHLDKKVRSIAERRRRYDQAA |
Ga0210389_100266482 | 3300021404 | Soil | MLMWIILGFGWLGVLFAGVSLFRIAGYADKKVRRLAQRPRGRNDQAA |
Ga0210392_102906112 | 3300021475 | Soil | MWIILGFGWLGVLFAGVSLFRIAGYADKKVRRLAQRPRGRNDQAA |
Ga0126371_101782013 | 3300021560 | Tropical Forest Soil | MVLWIILGVGWLAILFAGISLFRLANYADKKVRRMAERPRQRDKQAA |
Ga0126371_108759232 | 3300021560 | Tropical Forest Soil | MLLWIILALGWIVILFAAVSLFRIAGYADKKMRRLIHRPRHSEDQAA |
Ga0126371_111377622 | 3300021560 | Tropical Forest Soil | MLLWVILGLCWLVILFAAVSLFRIAGYADKKMRRLVHRPRHSEDQAA |
Ga0126371_120194802 | 3300021560 | Tropical Forest Soil | MLLWIILGISWALILCAAVCLFRLAGYADKKMRNFKMRSFAQRPRRREDQAA |
Ga0224712_103338571 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | LGMGWLAILFAGVTLFRLADYADKKVRRLAERPRQRKKQAA |
Ga0233357_10094702 | 3300023056 | Soil | MLLWIILGIGWLGILCAGISLFRLADYADKKVRHLDKKMRRLADRPRQSKKLAA |
Ga0179589_102788352 | 3300024288 | Vadose Zone Soil | MLLWIILGMGWLGVLIAGVFLFRIAGYADKKLRRLAGRQRYRNDQAA |
Ga0179589_103961862 | 3300024288 | Vadose Zone Soil | MLLWIILGLGWLGILFAGITLFRLADYADKKVRRLADRPRQRNKQAA |
Ga0208078_10072964 | 3300025544 | Arctic Peat Soil | AGISLFRLADYADKKVRHLDKKMRRLAGRPRQSKKLAA |
Ga0207707_101913212 | 3300025912 | Corn Rhizosphere | MLWIILGMGWLAILFAGVTLFRLADYADKKVRRLAERPRQRKKQAA |
Ga0207695_101232392 | 3300025913 | Corn Rhizosphere | MVLWIILGMAWLAILFAGITLFRLADYADKKVRRFAERPRERKKQAA |
Ga0207695_112186311 | 3300025913 | Corn Rhizosphere | GWLAILFAGVTLFRLADYADKKVRRLAERPRQRKKQAA |
Ga0207671_112726571 | 3300025914 | Corn Rhizosphere | NLIAMVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKLVA |
Ga0207660_103021451 | 3300025917 | Corn Rhizosphere | MMLWIILGMGWLAILFAGVTLFRLADYADKKVRRLAERPRQRKKQAA |
Ga0207660_116202411 | 3300025917 | Corn Rhizosphere | MVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERP |
Ga0207649_104639942 | 3300025920 | Corn Rhizosphere | GNKGLNLIAMVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKQVA |
Ga0207664_107666023 | 3300025929 | Agricultural Soil | MLVWIILGVGWLGVLFAGIALFRLADYADKKVRRL |
Ga0207661_104046422 | 3300025944 | Corn Rhizosphere | MVLWIILGMGWLAILFAGISLFRLADYADKKVRRL |
Ga0207640_114091102 | 3300025981 | Corn Rhizosphere | MVLWIILGMGWLAVLFAGISLFRLADYADKKVRRLAERPRERKKQAA |
Ga0207702_106548422 | 3300026078 | Corn Rhizosphere | GMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKLVA |
Ga0207702_113629601 | 3300026078 | Corn Rhizosphere | MVLWIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRQRKKLVA |
Ga0209647_12289041 | 3300026319 | Grasslands Soil | PQHWIESYSLMLLWIILGLGWLGILFAGVALFRLADYADKKVRRLADRPRQRKKQAA |
Ga0209059_12669551 | 3300026527 | Soil | NLFSRMLLWIILGLSWAFILCAAVCLFRIAGYADRQMRRRLSQRPQRRRAAEDQTA |
Ga0179587_101267702 | 3300026557 | Vadose Zone Soil | MLLWIILALGWLGILLAAISLFRLANYADKKVRRMAQRPRRREDQAA |
Ga0179587_101992451 | 3300026557 | Vadose Zone Soil | MLLWIILGIGWLGILVAGVSLFRLADYADKKVRRLAERPRQRNKQAA |
Ga0209327_10442002 | 3300027307 | Forest Soil | MWIILGIGWFGILLAGISLFRLAGYADKKVRSFTQRTRSRTDLAA |
Ga0208982_10481451 | 3300027574 | Forest Soil | MWIILGFGWLGVLFAGVSLFRIAGYADKKVRDLAQRPRRRNDLAA |
Ga0209810_12916781 | 3300027773 | Surface Soil | MLLWIILALGWIGVLMAGVALFRLASFADRQMRRYAQRPRQQEDQAA |
Ga0209060_100049714 | 3300027826 | Surface Soil | MVLWIILGMGWLAIMFAGIMLFRLAGYADRKVRRLAERPRQRKKQAA |
Ga0209060_100634612 | 3300027826 | Surface Soil | MWIILGFGWLAILFAGVSLFRLAGYADKKVRRLAQRPRQRNNQAA |
Ga0209580_100155924 | 3300027842 | Surface Soil | MVLWVILGMGWLAILFAGVSLFRLADYADKKVRRLAERPRQRKKQAA |
Ga0209580_103938352 | 3300027842 | Surface Soil | MVLWIILGMGWLAILFAGITLFRLADYADKKLRRLAERPKQRKKQAA |
Ga0209166_100681592 | 3300027857 | Surface Soil | MLLWIILGICWGVILCAAICLFRLAGYADKKMRNLAQRPRRREDQAA |
Ga0209166_105842811 | 3300027857 | Surface Soil | MLLWIILGISWAVILFAGVCLFRLAGYADKKMRNLAQRPRGREDQAA |
Ga0209488_100450893 | 3300027903 | Vadose Zone Soil | MLLWIILGLGWLGILFAGVALFRLADYADKKVRRLADRPRQRKKQAA |
Ga0265338_101784252 | 3300028800 | Rhizosphere | MWIILGLGWIGVLFAGVSLFRFAGYADKQVRRLAQRPRRSNDQAA |
Ga0170834_1028185411 | 3300031057 | Forest Soil | MVLWIILGMGWLAILFAGITLFRLADYADKKVRRLADRPRQRKKQ |
Ga0308175_1001670222 | 3300031938 | Soil | MMLWIILGMGWLAILFAGVTLFRLADYADKKVRRLAERPRQRKNQAA |
Ga0310810_113281182 | 3300033412 | Soil | WIILGMGWLAILFAGISLFRLADYADKKVRRLAERPRERKKQAA |
⦗Top⦘ |