| Basic Information | |
|---|---|
| Family ID | F049890 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MPEEVTSLIDPAEQFNEETLIRRIREGEHDLFYELIRPYERRVY |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.14 % |
| % of genes near scaffold ends (potentially truncated) | 97.26 % |
| % of genes from short scaffolds (< 2000 bps) | 91.78 % |
| Associated GOLD sequencing projects | 117 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (94.521 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (10.959 % of family members) |
| Environment Ontology (ENVO) | Unclassified (20.548 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.83% β-sheet: 0.00% Coil/Unstructured: 54.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF01292 | Ni_hydr_CYTB | 49.32 |
| PF00033 | Cytochrome_B | 20.55 |
| PF00174 | Oxidored_molyb | 10.96 |
| PF00933 | Glyco_hydro_3 | 1.37 |
| PF00515 | TPR_1 | 1.37 |
| PF02685 | Glucokinase | 0.68 |
| PF13414 | TPR_11 | 0.68 |
| PF01641 | SelR | 0.68 |
| PF13899 | Thioredoxin_7 | 0.68 |
| PF00691 | OmpA | 0.68 |
| PF00378 | ECH_1 | 0.68 |
| PF13424 | TPR_12 | 0.68 |
| PF00005 | ABC_tran | 0.68 |
| PF13411 | MerR_1 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 49.32 |
| COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 49.32 |
| COG3038 | Cytochrome b561 | Energy production and conversion [C] | 49.32 |
| COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 49.32 |
| COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 49.32 |
| COG1290 | Cytochrome b subunit of the bc complex | Energy production and conversion [C] | 20.55 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 10.96 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 10.96 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 1.37 |
| COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG0837 | Glucokinase | Carbohydrate transport and metabolism [G] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 94.52 % |
| Unclassified | root | N/A | 5.48 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001154|JGI12636J13339_1026008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300001593|JGI12635J15846_10267828 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300003367|JGI26338J50219_1026332 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300004080|Ga0062385_10833092 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300004092|Ga0062389_100904763 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300004152|Ga0062386_101080048 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300004152|Ga0062386_101241042 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005167|Ga0066672_10837744 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005177|Ga0066690_10815410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 605 | Open in IMG/M |
| 3300005332|Ga0066388_101670963 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005450|Ga0066682_10951759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300005533|Ga0070734_10025498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3823 | Open in IMG/M |
| 3300005541|Ga0070733_11046161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
| 3300005557|Ga0066704_10311529 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
| 3300005575|Ga0066702_10605545 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300005591|Ga0070761_10723981 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005598|Ga0066706_11037107 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300005610|Ga0070763_10295557 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300005921|Ga0070766_10419735 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300005921|Ga0070766_10633572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300006047|Ga0075024_100542308 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300006052|Ga0075029_100869792 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300006052|Ga0075029_101007730 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300006052|Ga0075029_101349036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 502 | Open in IMG/M |
| 3300006059|Ga0075017_100384201 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300006059|Ga0075017_100935341 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300006102|Ga0075015_100521603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 687 | Open in IMG/M |
| 3300006102|Ga0075015_100772981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300006172|Ga0075018_10723508 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006173|Ga0070716_100028578 | All Organisms → cellular organisms → Bacteria | 3006 | Open in IMG/M |
| 3300006173|Ga0070716_101223522 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300006176|Ga0070765_100909855 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006796|Ga0066665_10691520 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300006797|Ga0066659_10146679 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300006893|Ga0073928_10573063 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300006893|Ga0073928_11035859 | Not Available | 558 | Open in IMG/M |
| 3300006954|Ga0079219_10119801 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300007076|Ga0075435_101955031 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300009038|Ga0099829_10975263 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 703 | Open in IMG/M |
| 3300009088|Ga0099830_10683318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300009137|Ga0066709_100666866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1491 | Open in IMG/M |
| 3300009521|Ga0116222_1288296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 709 | Open in IMG/M |
| 3300009522|Ga0116218_1390459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300009525|Ga0116220_10067870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1494 | Open in IMG/M |
| 3300009616|Ga0116111_1088650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300009643|Ga0116110_1250954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300009700|Ga0116217_10551894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300010048|Ga0126373_10586750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
| 3300010341|Ga0074045_10717715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300010343|Ga0074044_11096332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
| 3300010360|Ga0126372_12761609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300010361|Ga0126378_12274476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300010379|Ga0136449_101364568 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300010379|Ga0136449_103183549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300011271|Ga0137393_10512391 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300012206|Ga0137380_10555642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1007 | Open in IMG/M |
| 3300012206|Ga0137380_10797874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300012361|Ga0137360_10576616 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300012361|Ga0137360_10872102 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
| 3300012362|Ga0137361_10106946 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2443 | Open in IMG/M |
| 3300012362|Ga0137361_10536806 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300012363|Ga0137390_10216934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1900 | Open in IMG/M |
| 3300012925|Ga0137419_10396630 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300012944|Ga0137410_10736434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 824 | Open in IMG/M |
| 3300014152|Ga0181533_1128653 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300014200|Ga0181526_10720145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300014838|Ga0182030_11444626 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300015371|Ga0132258_10940935 | All Organisms → cellular organisms → Bacteria | 2182 | Open in IMG/M |
| 3300016750|Ga0181505_10058784 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1214 | Open in IMG/M |
| 3300017822|Ga0187802_10360318 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300017823|Ga0187818_10277062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 735 | Open in IMG/M |
| 3300017929|Ga0187849_1332685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300017935|Ga0187848_10262083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300017943|Ga0187819_10870951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 504 | Open in IMG/M |
| 3300017955|Ga0187817_10557787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 731 | Open in IMG/M |
| 3300017955|Ga0187817_10916267 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300017961|Ga0187778_10034946 | All Organisms → cellular organisms → Bacteria | 3074 | Open in IMG/M |
| 3300017998|Ga0187870_1055033 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300018001|Ga0187815_10470484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 537 | Open in IMG/M |
| 3300018007|Ga0187805_10408479 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300018012|Ga0187810_10309231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300018023|Ga0187889_10454766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300018025|Ga0187885_10409488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300018033|Ga0187867_10656273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300018034|Ga0187863_10908862 | Not Available | 500 | Open in IMG/M |
| 3300018046|Ga0187851_10598432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 623 | Open in IMG/M |
| 3300018085|Ga0187772_10299115 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300018482|Ga0066669_12367709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300020579|Ga0210407_10975594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300020582|Ga0210395_10002602 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 13983 | Open in IMG/M |
| 3300020582|Ga0210395_11286496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300021088|Ga0210404_10501457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300021168|Ga0210406_10698802 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300021401|Ga0210393_11109375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300021407|Ga0210383_10210063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1666 | Open in IMG/M |
| 3300021479|Ga0210410_10166591 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300022557|Ga0212123_10797482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300022722|Ga0242657_1244627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300025414|Ga0208935_1046563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300025419|Ga0208036_1059895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300025442|Ga0208034_1021076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1773 | Open in IMG/M |
| 3300025500|Ga0208686_1048158 | All Organisms → cellular organisms → Bacteria | 1003 | Open in IMG/M |
| 3300025507|Ga0208188_1120598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300025926|Ga0207659_10511753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1017 | Open in IMG/M |
| 3300026315|Ga0209686_1030795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2062 | Open in IMG/M |
| 3300026318|Ga0209471_1003837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 8382 | Open in IMG/M |
| 3300026318|Ga0209471_1135352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300026328|Ga0209802_1245775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300026335|Ga0209804_1119963 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1195 | Open in IMG/M |
| 3300026467|Ga0257154_1017601 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300026480|Ga0257177_1001581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2283 | Open in IMG/M |
| 3300026497|Ga0257164_1086887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300026557|Ga0179587_11021012 | Not Available | 544 | Open in IMG/M |
| 3300027047|Ga0208730_1002565 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300027497|Ga0208199_1065048 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 769 | Open in IMG/M |
| 3300027645|Ga0209117_1154845 | Not Available | 597 | Open in IMG/M |
| 3300027674|Ga0209118_1052121 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300027825|Ga0209039_10286515 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300027826|Ga0209060_10274538 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 771 | Open in IMG/M |
| 3300027853|Ga0209274_10273623 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300027862|Ga0209701_10245317 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300027882|Ga0209590_10272396 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
| 3300027882|Ga0209590_10990207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300027884|Ga0209275_10663150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300027986|Ga0209168_10493127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 592 | Open in IMG/M |
| 3300028906|Ga0308309_11899043 | Not Available | 502 | Open in IMG/M |
| 3300029636|Ga0222749_10048092 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1876 | Open in IMG/M |
| 3300029817|Ga0247275_1127352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 655 | Open in IMG/M |
| 3300030339|Ga0311360_10529806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300030862|Ga0265753_1061683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 690 | Open in IMG/M |
| 3300030991|Ga0073994_10005370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 627 | Open in IMG/M |
| 3300031708|Ga0310686_109715537 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1424 | Open in IMG/M |
| 3300031708|Ga0310686_119841596 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1814 | Open in IMG/M |
| 3300031718|Ga0307474_11173851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 607 | Open in IMG/M |
| 3300031771|Ga0318546_10749320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300031833|Ga0310917_11161243 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300032160|Ga0311301_12551264 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300032205|Ga0307472_100020087 | All Organisms → cellular organisms → Bacteria | 3638 | Open in IMG/M |
| 3300032783|Ga0335079_11640963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300033004|Ga0335084_10924687 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300033158|Ga0335077_10925022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300033561|Ga0371490_1175047 | Not Available | 517 | Open in IMG/M |
| 3300033825|Ga0334843_029572 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300034819|Ga0373958_0150244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.22% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.85% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.16% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.42% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.74% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.05% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.37% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.37% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.37% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.68% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.68% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300003367 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025419 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
| 3300026480 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-B | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027047 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF042 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| 3300033825 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E1 1-5 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12636J13339_10260081 | 3300001154 | Forest Soil | MPEEVTSLEPPANLFNEEMLIQRIRNGEHDLFYDLIRPYERRVYSAAFAILRN |
| JGI12635J15846_102678283 | 3300001593 | Forest Soil | MPEEVTSLEPPAKPFNEEMLIQRIRNGEHDLFYELIR |
| JGI26338J50219_10263321 | 3300003367 | Bog Forest Soil | MPEEAISLENRAERLNEEMLIRRIRDGEHELFYHLIRPYERRVYSTAFAIL |
| Ga0062385_108330922 | 3300004080 | Bog Forest Soil | MPGEGTSLTDPAEQFNEEMLIRRIREGEHDLFYELIRPYERRVYS |
| Ga0062389_1009047631 | 3300004092 | Bog Forest Soil | MMPEGTSLENRAEQFNEEQLIQRVRGGEHDLFYELVRPYER |
| Ga0062386_1010800482 | 3300004152 | Bog Forest Soil | MREEVMSLGNPAGQFNEELLIRRIRDGEHDLFYELIRPYERRVYSA |
| Ga0062386_1012410421 | 3300004152 | Bog Forest Soil | MPEEVMSLGSPAGQFNEELLIRRIRDGEHDLFYELIRPYERRVYSA |
| Ga0066672_108377441 | 3300005167 | Soil | MPEELTALEDPAQQFNEETLIQRVRDGEHDRFYALIRPYERRVYAAAFAILRNDAD |
| Ga0066690_108154101 | 3300005177 | Soil | MPERVISLERPAEPFNEETLIRRVLAGERELFYELIRPYE |
| Ga0066388_1016709631 | 3300005332 | Tropical Forest Soil | LGAVESTAEKINEAMLIRRIRNGEHELFYDLIRPYERRVYATTFAI |
| Ga0066682_109517591 | 3300005450 | Soil | VLPRGLMPESAASLQNPARQLDEATLIERIRNGEHDLFYELIR |
| Ga0070734_100254985 | 3300005533 | Surface Soil | MPEKLTSLENPAEQPNEAMLIRRVRDGERDLFYELIRPYERRV |
| Ga0070733_110461612 | 3300005541 | Surface Soil | MPGEAISLENPADKLNEEMLIRRIRDGEHELFYELIR |
| Ga0066704_103115293 | 3300005557 | Soil | MSAETVSLGNPAESYNEQALIRRIRDGEHEAFYQLIQPYERRVYATTFAIL |
| Ga0066702_106055452 | 3300005575 | Soil | MPESATPLGHPARQTSEAELVRRVRDGEHDLFYELIRPYERRVYSAAFAIL |
| Ga0070761_107239811 | 3300005591 | Soil | MPEEAISLENRADRLNEETLIRRIRDGEHELFYELIRPY |
| Ga0066706_110371072 | 3300005598 | Soil | MLEEVTSLNSPAERFNEETLIRRIREGEHELFYELIRPYERRVYS |
| Ga0070763_102955571 | 3300005610 | Soil | MPEGAISLENRADRLNEETLIRRIRDGEHELFYELIRPYERRVYST |
| Ga0070766_104197351 | 3300005921 | Soil | MPEEAISLENRADRLNEETLIRRIRGGEHELFYELIRPYERRVYST |
| Ga0070766_106335722 | 3300005921 | Soil | MPETTASLGNPSEPLHEETLIRRIREGEHELFYELIRPY |
| Ga0075024_1005423081 | 3300006047 | Watersheds | MPAEAASRENSREQSDEAILIRRIRDGEHELFYELVRPYE |
| Ga0075029_1008697921 | 3300006052 | Watersheds | MPGERTSRTDPAEQFNEEMLIRRIREGEHDLFYELIRPYERRVYSAA |
| Ga0075029_1010077301 | 3300006052 | Watersheds | MSAEAGSLEQPAEQFEEGALIRRICGGEHELFYELIRPYERRVYAAAFAILR |
| Ga0075029_1013490362 | 3300006052 | Watersheds | MPERLTLLERPAEQANEAMLIRRVRDGEQELFYELIRPYERRVYAAAFAI |
| Ga0075017_1003842013 | 3300006059 | Watersheds | MPELETSRTDPAGQFNEEMLIRRIREGEHDLFYELI |
| Ga0075017_1009353411 | 3300006059 | Watersheds | MPGEGISLTDPAAQFNEEMLIRRIRDGEHDLFYELIRPYER |
| Ga0075015_1005216032 | 3300006102 | Watersheds | MPERMNSLERPAEQLNEAMVIRRVLAGEHDLFYELIRPYERRVYA |
| Ga0075015_1007729812 | 3300006102 | Watersheds | MPEEVTSLKRPAQQFNEETLIRRVRDGENDLFYELIRPY |
| Ga0075018_107235082 | 3300006172 | Watersheds | VMPEEVTSLKNPAERFNEETLIRRIREGEHELFYELIRPYERRVYSAALAI |
| Ga0070716_1000285781 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEGVTSLSNPAERFTEETLIRRIREGEHELFYELIRPYER |
| Ga0070716_1012235222 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MPEDVTSLKSAADRFNEERLIQRIREGEHELFYELIRPYERRVYSAALA |
| Ga0070765_1009098551 | 3300006176 | Soil | MPGEATSLTDPAEQFNEGILIRRIRDGEHDLFYELIRPYERRVYSA |
| Ga0066665_106915201 | 3300006796 | Soil | MPDSAASLDNPAHQPDEATLIDRVRNGEHDLFYELIRPYERNVYRAAFAI |
| Ga0066659_101466793 | 3300006797 | Soil | MMPEGVTSLNKPAAQPSEDLLIRHIQDGEHEVFYELIRPYE |
| Ga0073928_105730632 | 3300006893 | Iron-Sulfur Acid Spring | MPERLISLERPAEQFNEEMLIRRVLAGEHELFYELIRPYERRVYA |
| Ga0073928_110358592 | 3300006893 | Iron-Sulfur Acid Spring | MPERMISLERPAEQFNEEMLIRRVLAGEHELFYELIRPYERRVYA |
| Ga0079219_101198013 | 3300006954 | Agricultural Soil | MPGETTSLTDPAQQFNEEMLIRRIRDGEQELFYELVR |
| Ga0075435_1019550312 | 3300007076 | Populus Rhizosphere | MPGETTSLTDPAQQFNEEMLIRRIRDGEHDLFYELIRPYERRVYSA |
| Ga0099829_109752632 | 3300009038 | Vadose Zone Soil | MPAEVSSLENPAQRFNEQKLIQRIRDGEHELFYELVRPYERRIYA |
| Ga0099830_106833182 | 3300009088 | Vadose Zone Soil | MPARAAALDNPAEKLDEEVLIRRIRDGEHELFHELIRPYESRV |
| Ga0066709_1006668663 | 3300009137 | Grasslands Soil | MPGEATSLENPAEKSNEEMLIRRIRGGEHELFYELIRPYERRVYS |
| Ga0116222_12882961 | 3300009521 | Peatlands Soil | MLAQLISLDNPADRLNEEMLIRRVREGEHELFYELIRPYERR |
| Ga0116218_13904592 | 3300009522 | Peatlands Soil | MPEEAISLDNPADRLNEEMLIRRIRNGEHELFYELI |
| Ga0116220_100678703 | 3300009525 | Peatlands Soil | MPAEAISLDDPADRMNEEMLIRRIRDGEHELFYELI |
| Ga0116111_10886501 | 3300009616 | Peatland | MPEEVMSLGSPAGQFNEELLIRRIRDGEHDLFYELIRPYERRVY |
| Ga0116110_12509541 | 3300009643 | Peatland | MPEEVTSLEHPAKPSNEGMLIQRIRNGEHDLFYELI |
| Ga0116217_105518942 | 3300009700 | Peatlands Soil | MPEEAISLDNPAERLNEEMLIRRIRNGEHELFYELIQPYERRVY |
| Ga0126373_105867503 | 3300010048 | Tropical Forest Soil | MLEEVTSLNSPAERFNEETLIRRIREGEHELFYELIRPYERRVYSA |
| Ga0074045_107177151 | 3300010341 | Bog Forest Soil | MPGEATSLENPADRLNEETLIRRIRDGEPALFYQLIQPYERRVYSAAFAIVRNEAD |
| Ga0074044_110963322 | 3300010343 | Bog Forest Soil | MMPGERTSLTDPAQQFNEQMLIRRIRDGEHDLFYELIRPYERRV |
| Ga0126372_127616091 | 3300010360 | Tropical Forest Soil | MPEGVTSLSSPAERFNEEMLIRRIRDGEHELFYELVRPYERRVYSAA |
| Ga0126378_122744761 | 3300010361 | Tropical Forest Soil | MLEEVTSLNSPAERFNEETLIRRVREGEHELFYELIRPYERRVY |
| Ga0136449_1013645681 | 3300010379 | Peatlands Soil | MPEEVMSLGSPAGQFNEELLIRRIRDGEHDLFYELIRPYERRVYSAALAIL |
| Ga0136449_1031835491 | 3300010379 | Peatlands Soil | MPEEVTSLEHSAKLFNEEMLIQRIRDGEHDIFYELIR |
| Ga0137393_105123913 | 3300011271 | Vadose Zone Soil | MPAEVSSLENPAQRFNEQKLIQRIRDGEHELFYELIRPY |
| Ga0137380_105556423 | 3300012206 | Vadose Zone Soil | MPEEVTSLIDPAEQFNEETLIRRIREGEHDLFYELIRPYERRVY |
| Ga0137380_107978741 | 3300012206 | Vadose Zone Soil | MPDEAPLLDSPALQCNEQELIRRIRDGEDSLFYELIRPYERRVY |
| Ga0137360_105766162 | 3300012361 | Vadose Zone Soil | MPEKVTLLERPAEQCNEATLIRRVRDGEHELFYELIRPYERRVYAAAFAIL |
| Ga0137360_108721021 | 3300012361 | Vadose Zone Soil | MPERVISLERPAEQFNEEMLIRRVLAGEHELFYELIRPYERRVYAAAF |
| Ga0137361_101069461 | 3300012362 | Vadose Zone Soil | VPERVTSLESAEKFNEEMLIRRVRDGEHELFYELIRPYERRVYAA |
| Ga0137361_105368062 | 3300012362 | Vadose Zone Soil | MPERVISLERPAEQFNEEMLIRRVLAGEHELFYELIRPYER |
| Ga0137390_102169341 | 3300012363 | Vadose Zone Soil | MPERVISLEHPAEQFNEEMLIRRVLAGEHELFYELIRPYERRVYAAAF |
| Ga0137419_103966301 | 3300012925 | Vadose Zone Soil | MPARAAALDNPAEKLDEEVLIRRIRDGELELFHQLIRPYESRVYSAA |
| Ga0137410_107364342 | 3300012944 | Vadose Zone Soil | MPDERSTLGDGSQQPSEETLIRRIRDGEHDLFYQLIRP |
| Ga0181533_11286531 | 3300014152 | Bog | MREEVMSLEDPAGQFNEGLLIRRIRDGEHDLFYELIRPYERRVYATAF |
| Ga0181526_107201451 | 3300014200 | Bog | MPEELTSLENPAEQPNEGMLIRRVCGGERDLFCQLIRPYE |
| Ga0182030_114446262 | 3300014838 | Bog | MPEEVTSLENRAERFDEEMLIRRIRDGEHVLFYELIRPY |
| Ga0132258_109409355 | 3300015371 | Arabidopsis Rhizosphere | MLGEVTSLNNPAEQLNEETLIRRIREGEHELFYELIRPYERRVYSAAFAILR |
| Ga0181505_100587841 | 3300016750 | Peatland | MPEEVTSLEHPAKPFNEEMLIQRIRNGEHDLFYELIRPYERRVYSTAFAIL |
| Ga0187802_103603182 | 3300017822 | Freshwater Sediment | MPEEAISLDNPAERLNEEMLIRRIRSGEHELFYELIRPYERRVYST |
| Ga0187818_102770622 | 3300017823 | Freshwater Sediment | MPGEGISRTDPAVQFNEDMLIRRIRDGERDLFYELIRPYERRGYSAALAILRNE |
| Ga0187849_13326851 | 3300017929 | Peatland | MPEEVTSLEHPAKPFNEEMLIQRIRNGEHDLFYELIRPYERRV |
| Ga0187848_102620832 | 3300017935 | Peatland | MPEEVTSLEHPAKPFNEEMLIQRIRNGEHDLFYELIRPYERRVY |
| Ga0187819_108709511 | 3300017943 | Freshwater Sediment | MPEELTSLENPAEQPNEGMLIRRVREGERDLFYELIRPYERRVFA |
| Ga0187817_105577872 | 3300017955 | Freshwater Sediment | MLGEGTSLENRAEQFNEELLIRRIRDGEHDLFYELVRPYER |
| Ga0187817_109162671 | 3300017955 | Freshwater Sediment | MPEEVMSLGSPAGQFNEELLIRRIRDGEHDLFYELI |
| Ga0187778_100349463 | 3300017961 | Tropical Peatland | MPEERTALEGPAAQFNEEVLIRRIRDGERDLFYELIRP |
| Ga0187870_10550331 | 3300017998 | Peatland | MPEEVMSLGSPAGQFNEELLIRRIRDGEHDLFYELIRPYERRVYS |
| Ga0187815_104704842 | 3300018001 | Freshwater Sediment | MPEEVMSLGNPAGQFNEELLIRRIRDGEHDLFYELIRP |
| Ga0187805_104084791 | 3300018007 | Freshwater Sediment | MPEERTSLTDPAQQFNEEMLIRCIRDGEHDLFYELIRPYERR |
| Ga0187810_103092311 | 3300018012 | Freshwater Sediment | MLEKQTSLDTPAEQRNEGVLIRRVRDGERDLFYELIRPYERRVFAAAFAI |
| Ga0187889_104547662 | 3300018023 | Peatland | MPEEVTSLEHSARPFSEEMLIQRIRNGEHDLFYELIRPYERRVY |
| Ga0187885_104094882 | 3300018025 | Peatland | MPEEVTSLEHPAKLFHEEMLIQRIRNGEHDLFYELIRPYERRVY |
| Ga0187867_106562732 | 3300018033 | Peatland | MPEEVTSLEHPAKPFNEEMLIQRIRNGEHDLFYELIRPYERRVYSTAFAILRNE |
| Ga0187863_109088621 | 3300018034 | Peatland | MAERTTSLERPAERLDEATLIRRVREGEHELFYELIRPYERRLYAAAF |
| Ga0187851_105984322 | 3300018046 | Peatland | MPEEATDLGNPAQELSEESLIRRIRDGEHDLFYELIRPYERRVFATALAILR |
| Ga0187858_104214681 | 3300018057 | Peatland | MSAELNQVGNPAQQLHEQQLIQRIRDGEHELFYELI |
| Ga0187772_102991153 | 3300018085 | Tropical Peatland | MAPGATSLDNSIDQSNEEALIRRVRDGESELFYELIHPYERRL |
| Ga0066669_123677091 | 3300018482 | Grasslands Soil | MPDDGKKLGDHTRQSNEETLIRRIRDGEHDLFYELVRPYERRVYAAA |
| Ga0210407_109755942 | 3300020579 | Soil | MPGEGTSLTDPVEQFNEEMLIGRIREGEHDLFYELIRP |
| Ga0210395_1000260220 | 3300020582 | Soil | VMPGEGTSLTDAAEQFNEEMLIRRIREGEHDLFYEL |
| Ga0210395_112864962 | 3300020582 | Soil | MPEEVSLLELPAKPFNEEMLIQRIRNGEHGLFYELIRP |
| Ga0210404_105014571 | 3300021088 | Soil | MPGEGTSLTDPVEQFNEEMLIRRIREGEHDLFYELIHPYERRVYSAALAILRNEA |
| Ga0210406_106988021 | 3300021168 | Soil | MPERVMSLEQPAEQLHEAMLIRRIVAGEHELFYELIRP |
| Ga0210393_111093752 | 3300021401 | Soil | MPGEATSTDPAVQFYEEKLIRRIRDGEHDLFCELV |
| Ga0210383_102100633 | 3300021407 | Soil | MPERVMSLEQPAEQLHEAMLIRRIVAGEHELFYELIRPYERRLYATAFAIL |
| Ga0210410_101665911 | 3300021479 | Soil | MPGERTSLTDPAQQFNEEMLIRRIRDGEHDLFYELIRPYERRVY |
| Ga0212123_107974822 | 3300022557 | Iron-Sulfur Acid Spring | MHAEGASLKNPGDQFNEELLIRRIRDGEPDLFYELIRPYEGRVYSAAFAI |
| Ga0242657_12446271 | 3300022722 | Soil | MPGEGTSLTDPVEQFNEEMLIRRIREGEHELFYELIHPYERRVYSAAL |
| Ga0224556_10123684 | 3300024295 | Soil | MAAEVSPLDNPAQQLRERELIQRVRDGERELFYELIRP |
| Ga0208935_10465632 | 3300025414 | Peatland | VEVVISVLQWGVMPEEAISLENRAERLNEETLIRRIRDGEHELFYDLIQPYERRVYSTAFAILRNEA |
| Ga0208036_10598952 | 3300025419 | Peatland | MPEEVMSLGSPAGQFNEELLIRRIRDGEHDLFYELIRPYERRVYSAALAILRN |
| Ga0208034_10210761 | 3300025442 | Peatland | MPEEVMSLGSPAGQFNEELLIRRIRDGEHDLFYELIRPYERRVYSAALAI |
| Ga0208686_10481582 | 3300025500 | Peatland | MPGRLISLEHPAEQFNEATLIRRVRDGEHELFYQLIRPYE |
| Ga0208188_11205982 | 3300025507 | Peatland | MPEEVTSLEHPAKPFNEEMLIQRIRDGEHDIFYELIRPYE |
| Ga0207659_105117533 | 3300025926 | Miscanthus Rhizosphere | MPGETTSLTDPAQQFNEEMLIRRIRDGEQELFYELVRPYERRI |
| Ga0209686_10307951 | 3300026315 | Soil | MMPEGVTSLNKPAAQPSEDLLIRHIQDGEHEVFYELIRPYERCVYRTAFAILRN |
| Ga0209471_10038379 | 3300026318 | Soil | MPARAAALDNPAEKLDEEVLIRRIRDGELELFHQLIRP |
| Ga0209471_11353521 | 3300026318 | Soil | MPESAASLDYPAHQPDEATLIQRIRDGEHDLFYELIRPYERNVYRTAFA |
| Ga0209802_12457752 | 3300026328 | Soil | MPDSAASLDNPAHQPDEATLIDRVRNGEHDLFYELIRPYERNVYR |
| Ga0209804_11199631 | 3300026335 | Soil | MPGEATSLENPAEKSNEEMLIRRIRGGEHELFYELIRPYERRVYSAAFAI |
| Ga0257154_10176011 | 3300026467 | Soil | MPEEAISLENPAQRLNEEMLIRRIRDGEHELFYDLI |
| Ga0257177_10015811 | 3300026480 | Soil | MPERVTSLERPAEQFNEEVLIRRVVAGEHDLFYELIRPYERRVYATAFA |
| Ga0257164_10868872 | 3300026497 | Soil | MPEEVTSLEPPANLFNEEMLIQRIRNGEHDLFYELIRPYERRVYS |
| Ga0179587_110210121 | 3300026557 | Vadose Zone Soil | MPERVISLERPAEQFNEEMLIRRVLAGEHELFYELIRPYERRVY |
| Ga0208730_10025651 | 3300027047 | Forest Soil | MPGEGTSLTDPAKQFNEEMLIRRIREGEHDLFYELIRPYERRV |
| Ga0208199_10650481 | 3300027497 | Peatlands Soil | MPAEAISLDDPADRMNEEMLIRRIRDGEHELFYELIRPYE |
| Ga0209117_11548452 | 3300027645 | Forest Soil | MPERLISLERPAEQFNEEMLIRRVLAGEHELFYELIRPYERRVYAAAFAI |
| Ga0209118_10521211 | 3300027674 | Forest Soil | MPGEASLLENPDQLKEAKLIGRIRDGENELFYELIRPY |
| Ga0209039_102865151 | 3300027825 | Bog Forest Soil | MPGRVHSLECPAEPFNEEMLIRRVLAGEHELFYEKRIA |
| Ga0209060_102745381 | 3300027826 | Surface Soil | MPEKLTSLENPAEQPNEAMLIRRVRDGERDLFYELIR |
| Ga0209274_102736231 | 3300027853 | Soil | MPGEATSTDPALQFYEETLIRRIRDGEHDLFYELVRPYEGRVYSAALSILRNEHDAEDVS |
| Ga0209701_102453171 | 3300027862 | Vadose Zone Soil | MPERATSLDNPAEKLDEEVLIRRIRDGEHELFHELIRPYESR |
| Ga0209590_102723963 | 3300027882 | Vadose Zone Soil | MLEGMTSLNSPVERFNEETLIRRVREGEHELFYELIRPYERRVYSAALS |
| Ga0209590_109902072 | 3300027882 | Vadose Zone Soil | MPEEVTSLENQDGRFNEEMLIRRIRDGEHDLFYELIR |
| Ga0209275_106631502 | 3300027884 | Soil | MPETTASLENAGEPWNEEALIRRIREGEHELFYELIRPYERRVYA |
| Ga0209168_104931272 | 3300027986 | Surface Soil | LLENPAERSDEAMLIRRVVDGETELFYELIRPYERRLYSAALAIL |
| Ga0308309_118990433 | 3300028906 | Soil | MPEEVSLLELPAKPFNEEMLIQRIRNGEHGLFYELIRPYERR |
| Ga0222749_100480921 | 3300029636 | Soil | MLGERTSLTDPVQQFNEEMLIRRIRDGEHDLFFELIRPYERRIYSAALAIL |
| Ga0247275_11273522 | 3300029817 | Soil | MPEEVISLGNPAGQFNEELLIRRIRDGEHDLFYELIRPYERRVY |
| Ga0311360_105298061 | 3300030339 | Bog | MPAEAASLENPARKSNEEVLIRRIRNGEHELFYQLIQPYERRVYATAFAI |
| Ga0265753_10616832 | 3300030862 | Soil | MPGEGTSLTDAAEQFNEETLIRRIREGEHDLFYEL |
| Ga0073994_100053701 | 3300030991 | Soil | MLAAQEHSAEESNEEMLIRRIRNGEHELFYELIRPHERR |
| Ga0310686_1097155373 | 3300031708 | Soil | MPEEVTSLEPLAKPFNEEMLIQRIRNGEHDLFYELIRPYERRVYSAAFA |
| Ga0310686_1198415961 | 3300031708 | Soil | MPEEAISLENRAERLNEETLIRRIRDGEHELFYELIRPYERRVYST |
| Ga0307474_111738511 | 3300031718 | Hardwood Forest Soil | MVVISVMRWESMPEEATSLEDRADKLNEEMLIRRIRGGEHELFYDLIRPYERRVYSTAFAILR |
| Ga0318546_107493201 | 3300031771 | Soil | MPEQLSVLGGPAAQFNEEVLIRRIRDGERDLFYELIRPYERRVFAAALAILRN |
| Ga0310917_111612432 | 3300031833 | Soil | MLEEVTSLNSPAERFNEETLIRRVREGEHELFYELIRPYERRV |
| Ga0311301_125512641 | 3300032160 | Peatlands Soil | VMPGEGISLTDPAEQFNEEMLIRRIREGEHDLFYELIRPYERRVYS |
| Ga0307472_1000200876 | 3300032205 | Hardwood Forest Soil | LPEEVTSRENQDERFNEEMLIRRIRDGEHDLFYELIRPYERRVYSAALAI |
| Ga0335079_116409631 | 3300032783 | Soil | MPEELSRLGGPAAQFNEEVLIRRIRDGERDLFYELIRPYERRVFAAAL |
| Ga0335084_109246872 | 3300033004 | Soil | MPVEVTSLSSPAERFDEEMLIRRIREGEHELFYELIRP |
| Ga0335077_109250222 | 3300033158 | Soil | MPLETTSPVDRAERSHEEELIRRIRGGEHELFYELIRPYERRVYSAAFAILRN |
| Ga0371490_11750471 | 3300033561 | Peat Soil | MPGERTSLTDPAQQFNEEMLIRRIRDGEHDLFYELIRPYERRVYSAALA |
| Ga0334843_029572_1_153 | 3300033825 | Soil | MAERSMSLDRPAEQLNESILIRRIRDGEHDLFYELIRPYERRVYAAAFAIL |
| Ga0373958_0150244_3_107 | 3300034819 | Rhizosphere Soil | MPGETTSLTDPAQQFNEEMLIRRIRDGEQDLFYEL |
| ⦗Top⦘ |