| Basic Information | |
|---|---|
| Family ID | F049888 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MITTADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLP |
| Number of Associated Samples | 89 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 90.34 % |
| % of genes near scaffold ends (potentially truncated) | 86.99 % |
| % of genes from short scaffolds (< 2000 bps) | 86.30 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.110 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (38.356 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.082 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.795 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 0.00% Coil/Unstructured: 76.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF11774 | Lsr2 | 4.11 |
| PF09722 | Xre_MbcA_ParS_C | 4.11 |
| PF07510 | DUF1524 | 2.74 |
| PF08386 | Abhydrolase_4 | 2.74 |
| PF13411 | MerR_1 | 2.05 |
| PF08447 | PAS_3 | 1.37 |
| PF08808 | RES | 1.37 |
| PF07690 | MFS_1 | 1.37 |
| PF13556 | HTH_30 | 1.37 |
| PF12802 | MarR_2 | 1.37 |
| PF06736 | TMEM175 | 1.37 |
| PF01841 | Transglut_core | 0.68 |
| PF01047 | MarR | 0.68 |
| PF01544 | CorA | 0.68 |
| PF00248 | Aldo_ket_red | 0.68 |
| PF00289 | Biotin_carb_N | 0.68 |
| PF11239 | DUF3040 | 0.68 |
| PF00872 | Transposase_mut | 0.68 |
| PF13701 | DDE_Tnp_1_4 | 0.68 |
| PF04434 | SWIM | 0.68 |
| PF02551 | Acyl_CoA_thio | 0.68 |
| PF03781 | FGE-sulfatase | 0.68 |
| PF05598 | DUF772 | 0.68 |
| PF04075 | F420H2_quin_red | 0.68 |
| PF13276 | HTH_21 | 0.68 |
| PF00196 | GerE | 0.68 |
| PF07452 | CHRD | 0.68 |
| PF14690 | zf-ISL3 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG3548 | Uncharacterized membrane protein | Function unknown [S] | 1.37 |
| COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 1.37 |
| COG0598 | Mg2+ and Co2+ transporter CorA | Inorganic ion transport and metabolism [P] | 0.68 |
| COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG1946 | Acyl-CoA thioesterase | Lipid transport and metabolism [I] | 0.68 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.68 |
| COG4279 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.68 |
| COG4715 | Uncharacterized protein, contains SWIM-type Zn finger domain | Function unknown [S] | 0.68 |
| COG5431 | Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domain | General function prediction only [R] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.11 % |
| All Organisms | root | All Organisms | 45.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459014|G1P06HT02IODQZ | Not Available | 670 | Open in IMG/M |
| 3300001404|JGI20181J14860_1000936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4510 | Open in IMG/M |
| 3300001404|JGI20181J14860_1002564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium tuberculosis complex → Mycobacterium tuberculosis | 2139 | Open in IMG/M |
| 3300002162|JGI24139J26690_1034048 | Not Available | 950 | Open in IMG/M |
| 3300002162|JGI24139J26690_1073655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 617 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1029511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 873 | Open in IMG/M |
| 3300003369|JGI24140J50213_10053796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1419 | Open in IMG/M |
| 3300003369|JGI24140J50213_10255381 | Not Available | 538 | Open in IMG/M |
| 3300005334|Ga0068869_100498185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1017 | Open in IMG/M |
| 3300005335|Ga0070666_11248682 | Not Available | 554 | Open in IMG/M |
| 3300005337|Ga0070682_100086420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica | 2042 | Open in IMG/M |
| 3300005343|Ga0070687_100618208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 747 | Open in IMG/M |
| 3300005356|Ga0070674_101718424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300005439|Ga0070711_101856812 | Not Available | 529 | Open in IMG/M |
| 3300005456|Ga0070678_100227820 | Not Available | 1552 | Open in IMG/M |
| 3300005578|Ga0068854_100438229 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 1089 | Open in IMG/M |
| 3300005617|Ga0068859_101460542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 754 | Open in IMG/M |
| 3300005718|Ga0068866_10006665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4816 | Open in IMG/M |
| 3300005841|Ga0068863_100732689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica | 984 | Open in IMG/M |
| 3300005994|Ga0066789_10345620 | Not Available | 622 | Open in IMG/M |
| 3300005994|Ga0066789_10448790 | Not Available | 539 | Open in IMG/M |
| 3300006172|Ga0075018_10815661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Salinispora → Salinispora pacifica | 513 | Open in IMG/M |
| 3300006237|Ga0097621_101517505 | Not Available | 636 | Open in IMG/M |
| 3300006642|Ga0075521_10028189 | Not Available | 2341 | Open in IMG/M |
| 3300006642|Ga0075521_10066411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1603 | Open in IMG/M |
| 3300006642|Ga0075521_10101307 | Not Available | 1321 | Open in IMG/M |
| 3300006642|Ga0075521_10137606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1140 | Open in IMG/M |
| 3300006642|Ga0075521_10431837 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300006642|Ga0075521_10478280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 609 | Open in IMG/M |
| 3300006795|Ga0075520_1227806 | Not Available | 781 | Open in IMG/M |
| 3300006795|Ga0075520_1258329 | Not Available | 723 | Open in IMG/M |
| 3300006795|Ga0075520_1450219 | Not Available | 511 | Open in IMG/M |
| 3300006881|Ga0068865_100820275 | Not Available | 804 | Open in IMG/M |
| 3300009148|Ga0105243_10003092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 13693 | Open in IMG/M |
| 3300009148|Ga0105243_10262288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1547 | Open in IMG/M |
| 3300010401|Ga0134121_10651076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica | 993 | Open in IMG/M |
| 3300012985|Ga0164308_10132624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1811 | Open in IMG/M |
| 3300012987|Ga0164307_11857314 | Not Available | 511 | Open in IMG/M |
| 3300012987|Ga0164307_11930889 | Not Available | 500 | Open in IMG/M |
| 3300012988|Ga0164306_10307923 | Not Available | 1159 | Open in IMG/M |
| 3300012988|Ga0164306_11180326 | Not Available | 641 | Open in IMG/M |
| 3300012988|Ga0164306_11232211 | Not Available | 629 | Open in IMG/M |
| 3300012989|Ga0164305_11207189 | Not Available | 656 | Open in IMG/M |
| 3300013296|Ga0157374_12117074 | Not Available | 589 | Open in IMG/M |
| 3300013306|Ga0163162_12237892 | Not Available | 628 | Open in IMG/M |
| 3300014326|Ga0157380_10108140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2330 | Open in IMG/M |
| 3300014326|Ga0157380_10378257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1335 | Open in IMG/M |
| 3300014326|Ga0157380_12595580 | Not Available | 573 | Open in IMG/M |
| 3300014498|Ga0182019_10061721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2199 | Open in IMG/M |
| 3300014502|Ga0182021_10215882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella | 2243 | Open in IMG/M |
| 3300014969|Ga0157376_10222943 | Not Available | 1747 | Open in IMG/M |
| 3300014969|Ga0157376_11314783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Labedaea → Labedaea rhizosphaerae | 753 | Open in IMG/M |
| 3300015371|Ga0132258_11269228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1862 | Open in IMG/M |
| 3300015371|Ga0132258_13731038 | Not Available | 1039 | Open in IMG/M |
| 3300015373|Ga0132257_103148425 | Not Available | 601 | Open in IMG/M |
| 3300017792|Ga0163161_10192665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1568 | Open in IMG/M |
| 3300017792|Ga0163161_11656925 | Not Available | 565 | Open in IMG/M |
| 3300017965|Ga0190266_11320395 | Not Available | 508 | Open in IMG/M |
| 3300018469|Ga0190270_10888429 | Not Available | 908 | Open in IMG/M |
| 3300018481|Ga0190271_12236438 | Not Available | 653 | Open in IMG/M |
| 3300018920|Ga0190273_10037506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2349 | Open in IMG/M |
| 3300019767|Ga0190267_10206966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 926 | Open in IMG/M |
| 3300019767|Ga0190267_10615266 | Not Available | 676 | Open in IMG/M |
| 3300025427|Ga0208077_1009166 | Not Available | 1421 | Open in IMG/M |
| 3300025461|Ga0208851_1011052 | Not Available | 1895 | Open in IMG/M |
| 3300025461|Ga0208851_1020665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1275 | Open in IMG/M |
| 3300025475|Ga0208478_1010515 | Not Available | 2066 | Open in IMG/M |
| 3300025475|Ga0208478_1063620 | Not Available | 677 | Open in IMG/M |
| 3300025495|Ga0207932_1005182 | All Organisms → cellular organisms → Bacteria | 4216 | Open in IMG/M |
| 3300025650|Ga0209385_1037973 | Not Available | 1831 | Open in IMG/M |
| 3300025878|Ga0209584_10364092 | Not Available | 558 | Open in IMG/M |
| 3300025918|Ga0207662_10601744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica | 765 | Open in IMG/M |
| 3300025924|Ga0207694_10832191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica | 780 | Open in IMG/M |
| 3300025927|Ga0207687_10622084 | Not Available | 912 | Open in IMG/M |
| 3300025937|Ga0207669_11385776 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300025938|Ga0207704_10289634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella | 1249 | Open in IMG/M |
| 3300025938|Ga0207704_10501133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 979 | Open in IMG/M |
| 3300025940|Ga0207691_10216039 | Not Available | 1664 | Open in IMG/M |
| 3300025961|Ga0207712_11700830 | Not Available | 565 | Open in IMG/M |
| 3300026067|Ga0207678_10652827 | Not Available | 924 | Open in IMG/M |
| 3300026095|Ga0207676_10427671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1243 | Open in IMG/M |
| 3300026121|Ga0207683_10106855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2503 | Open in IMG/M |
| 3300026121|Ga0207683_10153413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2079 | Open in IMG/M |
| 3300026142|Ga0207698_10644619 | Not Available | 1049 | Open in IMG/M |
| 3300026291|Ga0209890_10219037 | Not Available | 604 | Open in IMG/M |
| 3300028596|Ga0247821_10804113 | Not Available | 620 | Open in IMG/M |
| 3300028740|Ga0302294_10172456 | Not Available | 545 | Open in IMG/M |
| 3300028740|Ga0302294_10196804 | Not Available | 513 | Open in IMG/M |
| 3300028770|Ga0302258_1103330 | Not Available | 691 | Open in IMG/M |
| 3300028803|Ga0307281_10210072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Ruaniaceae → Occultella → Occultella kanbiaonis | 704 | Open in IMG/M |
| 3300028855|Ga0302257_1042697 | Not Available | 997 | Open in IMG/M |
| 3300028868|Ga0302163_10169749 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300028868|Ga0302163_10197155 | Not Available | 556 | Open in IMG/M |
| 3300028868|Ga0302163_10244649 | Not Available | 509 | Open in IMG/M |
| 3300028870|Ga0302254_10259081 | Not Available | 641 | Open in IMG/M |
| 3300029980|Ga0302298_10053884 | Not Available | 1205 | Open in IMG/M |
| 3300029984|Ga0311332_10038667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3307 | Open in IMG/M |
| 3300029984|Ga0311332_10470748 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 983 | Open in IMG/M |
| 3300029984|Ga0311332_10541478 | Not Available | 916 | Open in IMG/M |
| 3300029984|Ga0311332_10556842 | Not Available | 903 | Open in IMG/M |
| 3300029984|Ga0311332_10722935 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300029984|Ga0311332_11407527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita | 564 | Open in IMG/M |
| 3300029987|Ga0311334_10181326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1603 | Open in IMG/M |
| 3300029987|Ga0311334_10798628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 776 | Open in IMG/M |
| 3300029987|Ga0311334_11066303 | Not Available | 674 | Open in IMG/M |
| 3300029989|Ga0311365_10559241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 992 | Open in IMG/M |
| 3300029989|Ga0311365_10961774 | Not Available | 737 | Open in IMG/M |
| 3300029990|Ga0311336_10839068 | Not Available | 793 | Open in IMG/M |
| 3300029990|Ga0311336_11554189 | Not Available | 582 | Open in IMG/M |
| 3300030000|Ga0311337_10037775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella multipartita → Nakamurella multipartita DSM 44233 | 3743 | Open in IMG/M |
| 3300030000|Ga0311337_10191591 | Not Available | 1675 | Open in IMG/M |
| 3300030002|Ga0311350_11155812 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Coccoidea → Coccidae → Rhodococcus | 690 | Open in IMG/M |
| 3300030002|Ga0311350_11334986 | Not Available | 638 | Open in IMG/M |
| 3300030003|Ga0302172_10091119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 925 | Open in IMG/M |
| 3300030003|Ga0302172_10189514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
| 3300030010|Ga0302299_10444717 | Not Available | 657 | Open in IMG/M |
| 3300030294|Ga0311349_10455303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1211 | Open in IMG/M |
| 3300030294|Ga0311349_10677457 | Not Available | 973 | Open in IMG/M |
| 3300030294|Ga0311349_11605852 | Not Available | 602 | Open in IMG/M |
| 3300030339|Ga0311360_10702292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica | 806 | Open in IMG/M |
| 3300030491|Ga0302211_10116585 | Not Available | 776 | Open in IMG/M |
| 3300030491|Ga0302211_10275987 | Not Available | 500 | Open in IMG/M |
| 3300030838|Ga0311335_10034727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3101 | Open in IMG/M |
| 3300030838|Ga0311335_10560361 | Not Available | 797 | Open in IMG/M |
| 3300030838|Ga0311335_11328747 | Not Available | 517 | Open in IMG/M |
| 3300030943|Ga0311366_10181485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1818 | Open in IMG/M |
| 3300030943|Ga0311366_11417330 | Not Available | 596 | Open in IMG/M |
| 3300030943|Ga0311366_11419518 | Not Available | 596 | Open in IMG/M |
| 3300031232|Ga0302323_101006858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica | 925 | Open in IMG/M |
| 3300031232|Ga0302323_101036198 | Not Available | 912 | Open in IMG/M |
| 3300031232|Ga0302323_102890701 | Not Available | 548 | Open in IMG/M |
| 3300031521|Ga0311364_10688730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300031521|Ga0311364_10719971 | Not Available | 1003 | Open in IMG/M |
| 3300031521|Ga0311364_12360301 | Not Available | 519 | Open in IMG/M |
| 3300031722|Ga0311351_10060119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2947 | Open in IMG/M |
| 3300031722|Ga0311351_10830065 | Not Available | 706 | Open in IMG/M |
| 3300031722|Ga0311351_11347700 | Not Available | 548 | Open in IMG/M |
| 3300031726|Ga0302321_101513834 | Not Available | 773 | Open in IMG/M |
| 3300031726|Ga0302321_103109126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300031726|Ga0302321_103413010 | Not Available | 517 | Open in IMG/M |
| 3300031902|Ga0302322_101178691 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300031918|Ga0311367_10162231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2351 | Open in IMG/M |
| 3300031918|Ga0311367_10539411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1194 | Open in IMG/M |
| 3300031918|Ga0311367_10597452 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300033550|Ga0247829_10791175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella endophytica | 790 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 38.36% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 16.44% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 2.05% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.37% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.37% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.37% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.68% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459014 | Litter degradation PV2 | Engineered | Open in IMG/M |
| 3300001404 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 | Environmental | Open in IMG/M |
| 3300002162 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-21A | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300003369 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 002-22A | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300025427 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025475 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025495 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300028770 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_4 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028855 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300028870 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4 | Environmental | Open in IMG/M |
| 3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300030002 | II_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
| 3300030010 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4 | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
| 3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
| 3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2PV_02273140 | 2170459014 | Switchgrass, Maize And Mischanthus Litter | MIATTTAPPWLRRSDQAVTWARGMLSPHRAVVIDCETTDLPGAICEV |
| JGI20181J14860_10009367 | 3300001404 | Arctic Peat Soil | TDAPGWLRRSDQAVTWACSMLTPRRAVVIDCETTDLPGALRRVPW* |
| JGI20181J14860_10025641 | 3300001404 | Arctic Peat Soil | MITTDAPGWLRRSDQAVHWARTMLTPRRAVVIDCETT |
| JGI24139J26690_10340482 | 3300002162 | Arctic Peat Soil | MITATADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDL |
| JGI24139J26690_10736551 | 3300002162 | Arctic Peat Soil | MITTDAPAWLRRSDQAVHWARTMLTPRRAVVIDCETTDLPGGVTGNDG |
| JGIcombinedJ26865_10295112 | 3300002347 | Arctic Peat Soil | MITTTADAPAWLRRSDQAVHWARTMLTPRRAVVIDCETTDLPGGVT |
| JGI24140J50213_100537963 | 3300003369 | Arctic Peat Soil | MITTAAAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDL |
| JGI24140J50213_102553812 | 3300003369 | Arctic Peat Soil | MMTTTAPPWLRRSDQAVTWARGMLSPHRAVVIDCETTDLPGAISGKVAVVDTEG |
| Ga0068869_1004981851 | 3300005334 | Miscanthus Rhizosphere | MITTADAPPWLRRSDQAVTWARTMFQPHRAVVINCETTDLPGP* |
| Ga0070666_112486821 | 3300005335 | Switchgrass Rhizosphere | MIATRSAPTWLRRSDQAVTWARTMLQPHRAVVIDWETTDLPGALTGKVGY* |
| Ga0070682_1000864201 | 3300005337 | Corn Rhizosphere | MITTTDAPPWLRRSDQAVAWARTMLSPHRAVVIDCETTDLPGA |
| Ga0070687_1006182081 | 3300005343 | Switchgrass Rhizosphere | MITTTDAPLWLRRSDQAVAWARAMLSPHRAVVIDCETTDLPG |
| Ga0070674_1017184241 | 3300005356 | Miscanthus Rhizosphere | MITTTTAPPWLRRSDQAVTWVRTMLTPHRAVVIDCETTDLPGALTGKAGYS |
| Ga0070711_1018568121 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MITTTATPPWLRRSDQAVTWARTMLTPHRAVVIDCETTDLPG |
| Ga0070678_1002278203 | 3300005456 | Miscanthus Rhizosphere | MIATRSAPTWLRRSDQAVTWARTMLQPHRAVVIDCETTDLPGALTGKVGY* |
| Ga0068854_1004382292 | 3300005578 | Corn Rhizosphere | MITTADAPPWLRRPDQAVTWARTMLTPHRAVVIDCETTNLPGALSGKVGY* |
| Ga0068859_1014605421 | 3300005617 | Switchgrass Rhizosphere | MITTTDAPLWLRRSDQAVAWARAMLSPHRAVVIDCETTDLPGALTE |
| Ga0068866_100066657 | 3300005718 | Miscanthus Rhizosphere | MITTTDAPPWLRRSDQAVAWARTMLSPHRAVVIDCETTDL |
| Ga0068863_1007326891 | 3300005841 | Switchgrass Rhizosphere | MITTADAPPWLRRPDQAVTWARTMLTPHRAVVIDC |
| Ga0068860_1000882581 | 3300005843 | Switchgrass Rhizosphere | WLRRSDQAVTWARTMFQPHRAVVINCETTDLPGP* |
| Ga0066789_103456201 | 3300005994 | Soil | MITTADAPPWLRRSDQAVTWARTMLRPGVAVVIDCETTDLPGRITG |
| Ga0066789_104487902 | 3300005994 | Soil | MITTDAPAWLRRSDQAVHWARTTLAPRRAVVIDCETTDLP |
| Ga0075018_108156611 | 3300006172 | Watersheds | MITTSTAPPWLRRSDQAVTWARTMLTPGRAVVIDCETTDLPGVLTGKVGF* |
| Ga0097621_1015175051 | 3300006237 | Miscanthus Rhizosphere | PWLRRSDQAVTWARTMLQPHRAVVIDCETTDLPGALTGKVGY* |
| Ga0075521_100281891 | 3300006642 | Arctic Peat Soil | MITTADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLP |
| Ga0075521_100664111 | 3300006642 | Arctic Peat Soil | MTEVPMITATTATPAWLRRSDQAVSWARAMLQRDRAVVIDCETTDLPGAVCE |
| Ga0075521_101013073 | 3300006642 | Arctic Peat Soil | VITTADAPPWLRRSDQAVTWARTMLRPGVAVVIDCETTDLPGRITGKVQGRLLEPAE* |
| Ga0075521_101376061 | 3300006642 | Arctic Peat Soil | MITTDAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGGVTGND |
| Ga0075521_104318371 | 3300006642 | Arctic Peat Soil | MITTTADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGGVT |
| Ga0075521_104782802 | 3300006642 | Arctic Peat Soil | MITTADAPAWLRRSDQAVTWARTMLQPRRAVVIDCETTDLP |
| Ga0075520_12278061 | 3300006795 | Arctic Peat Soil | MTGEVPMITATTDAPAWLRRSDQAVTWARTMLQPRRAVVIDCETT |
| Ga0075520_12583293 | 3300006795 | Arctic Peat Soil | MITTAADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETT |
| Ga0075520_14502191 | 3300006795 | Arctic Peat Soil | MITATTATPAWLRRSDQAVSWARAMLQRDRAVVIDCETTDLP |
| Ga0068865_1008202752 | 3300006881 | Miscanthus Rhizosphere | MITTTTAPPWLRRSDQAVTWVRTMLTPHRAVVIDC |
| Ga0105243_100030921 | 3300009148 | Miscanthus Rhizosphere | MITTADAPPWLRRPDQAVTWARTMLTPHRAVVIDCETTDLPGA |
| Ga0105243_102622882 | 3300009148 | Miscanthus Rhizosphere | MMTTSTAPPWLRRSDQAITWARTMLQPHAAVVIDCETTDLPGAITGKSAFRTC* |
| Ga0134121_106510761 | 3300010401 | Terrestrial Soil | MITTTDAPPWLRRSDQAITWARTMLTPGRAVVIDCETTD |
| Ga0164308_101326242 | 3300012985 | Soil | MITTTDSPPWLRRSDQAITWARTMLQPHAAVVIDCETTDLPGAITGKSAFRTC* |
| Ga0164307_118573142 | 3300012987 | Soil | MITTTDAPPWLRRSDQAVTRARTMLQPHRAVVIDCETTDLPGALSGKVGY* |
| Ga0164307_119308892 | 3300012987 | Soil | MITTADPPSWLRLSDQAVTWARTMLTPHHAVVIDCEKTDLPGALVASSDIRTCRI |
| Ga0164306_103079232 | 3300012988 | Soil | MIATRSAPTWLRRSDQAVTWARTMLQPHRAVVIDWETTDL |
| Ga0164306_111803261 | 3300012988 | Soil | MIATTTAPTWLRRSDQAVTWARTMLSPHRAVVIDCETTDLPGALCE |
| Ga0164306_112322111 | 3300012988 | Soil | MITTTATPPWLRRSDQAVTWARTMLTPHRAVVIDCETTNLPGALSGKVGY* |
| Ga0164305_112071892 | 3300012989 | Soil | MITTSTAPPWLRRSDQAVTWARGMLSPHRAVVIDCETTDLPGAITGKVGY* |
| Ga0157374_121170741 | 3300013296 | Miscanthus Rhizosphere | MITTVDAPPWLRRSDQAVTWARTMLQPHRAVVIDTETTDLPGALTGKVGIFEPAE* |
| Ga0163162_122378921 | 3300013306 | Switchgrass Rhizosphere | PTWLRRSDQAVTWARTMLQPHRAVVIDCETTDLPGALTGKVGY* |
| Ga0157380_101081404 | 3300014326 | Switchgrass Rhizosphere | MITTADAPPWLRRPDQAVTWARTMLTPHRAVVIDCETTDLPGVLCEIAVV |
| Ga0157380_103782571 | 3300014326 | Switchgrass Rhizosphere | STAPPWLRRSDQAVTWARTMLQPHRAVVIDCETTDLPGSLSGKVGYSNLRN* |
| Ga0157380_125955801 | 3300014326 | Switchgrass Rhizosphere | MITTSTAPTWLRRSDQAVTWARTMLQPHRAVVIDCETTDLPGAIGGNVGYS |
| Ga0182019_100617214 | 3300014498 | Fen | MITTAAPAWLRRSDQAVTWARTMLTPHRAVVIDCE |
| Ga0182021_102158824 | 3300014502 | Fen | MITTADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGGVTDRQA* |
| Ga0157376_102229433 | 3300014969 | Miscanthus Rhizosphere | MIATRSAPTWLRRSDQAVTWARTMLQPHRAVVIDWETTDLPGALTGK |
| Ga0157376_113147832 | 3300014969 | Miscanthus Rhizosphere | MMTTSTAPPWLRRSDQAITWARTMLQPHAAVVIDCETTDLPGAITGK |
| Ga0132258_112692281 | 3300015371 | Arabidopsis Rhizosphere | MITTAWLRRSDQAVTWARTMLQRDHAVVIDCETPD |
| Ga0132258_137310382 | 3300015371 | Arabidopsis Rhizosphere | MITTDAPAWLRRSDQAVTWARTMLQRDRAVVIDCETTDLPGGVTGNDGY |
| Ga0132257_1031484252 | 3300015373 | Arabidopsis Rhizosphere | MITTAAPAWLRRSDQAVTWARTMLQRDHAVVIDCETPD |
| Ga0163161_101926653 | 3300017792 | Switchgrass Rhizosphere | MITTADAPPWLRRSDQAVTWARTMFQPHRAVVINCET |
| Ga0163161_116569252 | 3300017792 | Switchgrass Rhizosphere | MITTTDAPPWLRRSDQAVTWARTMFQPHRAVVINCE |
| Ga0190266_113203951 | 3300017965 | Soil | MITTSTAPTWLRRSDQAVTWARGMLSPHRAVVIDCETTDLPG |
| Ga0190270_108884293 | 3300018469 | Soil | MITTTEAPSWLRRSDQAITWARTMLQPHRAVVIDCE |
| Ga0190271_122364381 | 3300018481 | Soil | MMTTTAPPWLRRSDQAVTWARGMLSPHRAVVIDCETTDLPGA |
| Ga0190273_100375063 | 3300018920 | Soil | MIATAAAPSWLRRSDQAVTWARNMLQSHRAVVIDCETTDLPGAISGKVSY |
| Ga0190267_102069663 | 3300019767 | Soil | MMTTTEPPWLRRSDQAVTWARTMLKPQYAVVIDCET |
| Ga0190267_106152661 | 3300019767 | Soil | MIATAAAPSWLRRSDQAVTWARSMLSPHRAVVIDCETTDLPGAISGKVGY |
| Ga0208077_10091661 | 3300025427 | Arctic Peat Soil | MITATADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGG |
| Ga0208851_10110523 | 3300025461 | Arctic Peat Soil | GTPMITTADAPAWLRRSDQAVNWARTMLQPRRAVVIDCETTDLPGGVTW |
| Ga0208851_10206651 | 3300025461 | Arctic Peat Soil | MITTDAPAWLRRSDQAVTWARTMLTPRRAVVIDCETT |
| Ga0208478_10105151 | 3300025475 | Arctic Peat Soil | MITTTADAPAWLRRSDQAVHWARTMLTPRRAVVIDCETTDLPGAVTA |
| Ga0208478_10636201 | 3300025475 | Arctic Peat Soil | MITTTDAPAWLRRSDQAVTWARTMLTPRRAVVIDC |
| Ga0207932_10051825 | 3300025495 | Arctic Peat Soil | MITTDVPAWLRRSDQAVTWCPHHAPPRRAVVIDCETTDLP |
| Ga0209385_10379731 | 3300025650 | Arctic Peat Soil | MITATADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGGVTGND |
| Ga0209584_103640921 | 3300025878 | Arctic Peat Soil | MITTAAPAWLRRSDQAVHWARTMLTPRRAVVIDCETTDLPGGVTGNDG |
| Ga0207662_106017442 | 3300025918 | Switchgrass Rhizosphere | MITTTDAPLWLRRSDQAVAWARAMLSPHRAVVIDCETTDLPGALTEV |
| Ga0207694_108321911 | 3300025924 | Corn Rhizosphere | MITTTDAPPWLRRSDQAVTWARTMLHPGTAVVIDCETT |
| Ga0207687_106220841 | 3300025927 | Miscanthus Rhizosphere | MITTTTAPPWLRRSDQAVTWVRTMLTPHRAVVIDCETTDLPGALTGKAGYSN |
| Ga0207669_113857761 | 3300025937 | Miscanthus Rhizosphere | MITTTTAPPWLRRSDQAVTWVRTMLTPHRAVVIDCETTDLPGALT |
| Ga0207704_102896341 | 3300025938 | Miscanthus Rhizosphere | MITTSTAPTWLRRSDQAVTWARTMLQPHRAVVIDCET |
| Ga0207704_105011331 | 3300025938 | Miscanthus Rhizosphere | MITTTTAPPWLRRSDQAVTWVRTMLTPHRAVVIDCET |
| Ga0207691_102160391 | 3300025940 | Miscanthus Rhizosphere | SPWLRRSDQAVTWARTMFQPHRAVVINCETTDLPGP |
| Ga0207712_117008301 | 3300025961 | Switchgrass Rhizosphere | MITTTDAPLWLRRSDQAVAWARAMLSPHRAVVIDCE |
| Ga0207678_106528272 | 3300026067 | Corn Rhizosphere | MITTTDAPTWLRRSDQAVTWARGMLSPHRAVVIDCETTDLPGAICE |
| Ga0207676_104276713 | 3300026095 | Switchgrass Rhizosphere | MITTADAPPWLRRSDQAVTWARTMFQPHRAVVINCETTDLP |
| Ga0207683_101068552 | 3300026121 | Miscanthus Rhizosphere | MIATRSAPTWLRRSDQAVTWARTMLQPHRAVVIDCETTDLPGALTGKVGY |
| Ga0207683_101534134 | 3300026121 | Miscanthus Rhizosphere | MITTTTAPPWLRRSDQAVTWARTMLTPHHAVVIDCETTDLPG |
| Ga0207698_106446191 | 3300026142 | Corn Rhizosphere | MITTTTAPPWLRRSDQAVTWARTMLTPGRAVVIDCETTDLPGALTGKVGYQN |
| Ga0209890_102190372 | 3300026291 | Soil | MITTADAPPWLRRSDQAVTWARTMLRPGVAVVIDCETTD |
| Ga0247821_108041131 | 3300028596 | Soil | MITTADAPAWLRRSDQAVTWARTMLQPRRAVVIDCETTDLPGGVTGNDGY |
| Ga0302294_101724562 | 3300028740 | Fen | MITTAAPGWLRRSDQAVHWARTMLHPRRAVVIDCETID |
| Ga0302294_101968042 | 3300028740 | Fen | MTEVPMITATTDAPAWLRRSDQAVSWARAMLQRDRAVVIDCETTDLPG |
| Ga0302258_11033301 | 3300028770 | Fen | MMTTTTAPSWLRRSDQAVTWARGMLSPHRAVVIDCETTDLPGAISGKVGYSNL |
| Ga0307281_102100721 | 3300028803 | Soil | WLSRSDQAVTWARTMLQRDRAVVIDCETTDLPGGVTW |
| Ga0302257_10426971 | 3300028855 | Fen | MITATADAPAWLRRSDQAVTWARTMLTPRRAVVIDCE |
| Ga0302163_101697491 | 3300028868 | Fen | MITTAAPAWLRRSDQAVHWARSMLTPRRAVVIDCETTDLPGGVTGN |
| Ga0302163_101971551 | 3300028868 | Fen | MITTADAPAWLRRSDQAVTWARTMLTPRRAVVIDC |
| Ga0302163_102446491 | 3300028868 | Fen | MITTADAPAWLRRSDQAVTWARSMLTPHRAVVIDCETTDLPGGVTGND |
| Ga0302254_102590811 | 3300028870 | Fen | MITTAAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDL |
| Ga0302298_100538844 | 3300029980 | Fen | MITTAAPGWLRRSDQAVHWARTMLHPRRAVVIDCETTDLP |
| Ga0311332_100386671 | 3300029984 | Fen | MITTADAPAWLRRSDQAVTWARSMLTPRRAVVIDCETTDLPGGVTGNDG |
| Ga0311332_104707482 | 3300029984 | Fen | MITTVAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGGV |
| Ga0311332_105414781 | 3300029984 | Fen | MITTAAPGWLRRSDQAVHWARTMLTPRRAVVIDCETTDLP |
| Ga0311332_105568421 | 3300029984 | Fen | MITTADAPGWLRRSDQAVTWARTMLTPRRAVVIDCETTDLP |
| Ga0311332_107229351 | 3300029984 | Fen | MITTDAPAWLRRSDQAVHWARTMLTPRRAVVIDCETTDLPG |
| Ga0311332_114075273 | 3300029984 | Fen | TDAPAWLRRSDQAVTRARTMLQPRRAVVIDCETTDLPGGVTRNDGYQKPAE |
| Ga0311334_101813261 | 3300029987 | Fen | MITTDAPAWLRRSDQAVHWARIMLTPRRAVVIDCETTDLPGGV |
| Ga0311334_107986281 | 3300029987 | Fen | MITTADAPAWLRRSDQAVTWARTMLHPRRAVVIDCETTDLPGG |
| Ga0311334_110663032 | 3300029987 | Fen | MITTAAPAWLRRSDQAVTWARTMLQPRRAVVIDCETTDLPGGVTGNDGY |
| Ga0311365_105592412 | 3300029989 | Fen | MITTDAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDL |
| Ga0311365_109617742 | 3300029989 | Fen | MITTAAPAWLRRSDQAVTWARTMLTPRRAVVIDCE |
| Ga0311336_108390681 | 3300029990 | Fen | MITTAAPAWLRRSDQAVHWARTMLTPRRAVVIDCETTDLPGGVTGND |
| Ga0311336_115541892 | 3300029990 | Fen | MTEVPMITATTDAPAWLRRSDQAVSWARAMLQRDRAVVIDCET |
| Ga0311337_100377751 | 3300030000 | Fen | MITTAAPAWLRRSDQAVNWARTMLQPRRAVVIDCETTDLPGGVTW |
| Ga0311337_101915911 | 3300030000 | Fen | MITTAAPGWLRRSDQAVHWARTMLHPRRAVVIDCETI |
| Ga0311350_111558121 | 3300030002 | Fen | MITTAAPAWLRRSDQAVTWARTMLTPRRAVVIDCETRDLPG |
| Ga0311350_113349861 | 3300030002 | Fen | MITTAAPAWLRRSDQAVTWARTMLQPRRAVVIDCETTDLPGGVTG |
| Ga0302172_100911193 | 3300030003 | Fen | MMTTTTAPSWLRRSDQAVTWARGMLSPHRAVVIDCETTDLPGAISGKVGY |
| Ga0302172_101895142 | 3300030003 | Fen | LRRSDQAVTWARTMLQPCRAVVIDCETTDLPGGVTGNDGYQNLRE |
| Ga0302299_104447172 | 3300030010 | Fen | MITTDAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGGV |
| Ga0311349_104553032 | 3300030294 | Fen | MITTADAPGWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPG |
| Ga0311349_106774571 | 3300030294 | Fen | MITTDAPAWLRRSDQAVTWARTMLTPRRAVVIDCDTTDLPGGV |
| Ga0311349_116058522 | 3300030294 | Fen | MITTTTADAPAWLRRSDQAVTWARSMLTPRRAVVIDCETTDL |
| Ga0311360_107022922 | 3300030339 | Bog | MITADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETT |
| Ga0302211_101165851 | 3300030491 | Fen | MITATADAPAWLRRSDQAVTWARTMLTPRRAVVIDC |
| Ga0302211_102759872 | 3300030491 | Fen | MITTAAPGWLRRSDQAVHWARTMLTPHRAVVIDCETTDLPGGVAGNDG |
| Ga0311335_100347275 | 3300030838 | Fen | MITTAAAPAWLRRSDQAVHWARTMLTPRRAVVIDCET |
| Ga0311335_105603612 | 3300030838 | Fen | MITTAAPAWLRRSDQAVHWARTMLTPHRAVVIDCETTDLPGGATGNDG |
| Ga0311335_113287471 | 3300030838 | Fen | MITTDAPAWLRRSDQAVTWARTMLTPRRAVVIDCDTTDLPGGVTGNDG |
| Ga0311366_101814854 | 3300030943 | Fen | MMTTTAPPWLRRSDQAVTWARGMLSPHRAVVIDCETTDLPGAISGK |
| Ga0311366_114173301 | 3300030943 | Fen | MITATADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGGVTCN |
| Ga0311366_114195182 | 3300030943 | Fen | MITTDAPAWLRRSDQAVHWARTMLTPRRAVVIDCETTDLP |
| Ga0302323_1010068582 | 3300031232 | Fen | VITTADAPPWLRRSDQAVHWARTMLTPRRAVVIDCETTDLPGGL |
| Ga0302323_1010361981 | 3300031232 | Fen | MITTDAPAWLRRSDQAVTWARTMLLRDRAVVIDCETT |
| Ga0302323_1028907012 | 3300031232 | Fen | MITTDAPAWLRRSDQAVTWARTMLQPCRAVVIDCETTDLPG |
| Ga0311364_106887303 | 3300031521 | Fen | MITTADAPAWLRRSDQAVTWARTMLHPRRAVVIDCETTDLP |
| Ga0311364_107199712 | 3300031521 | Fen | MITATADAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGGVTGNDG |
| Ga0311364_123603012 | 3300031521 | Fen | MITTAAPAWLRRSDQAVHWARSMLTPRRAVVIDCETTDLPGGVTGNDGY |
| Ga0311351_100601191 | 3300031722 | Fen | MITTADAPAWLRRSDQAVTWARSMLTPRRAVVIDCET |
| Ga0311351_108300651 | 3300031722 | Fen | MITTDAPAWLRRSDQAVHWARIMLTPRRAVVIDCETTDLPGGVT |
| Ga0311351_113477002 | 3300031722 | Fen | MITTTTDAPAWLRRSDQAVHWARTMLTPRRAVVIDCETTDLP |
| Ga0302321_1015138341 | 3300031726 | Fen | MITTDAPAWLRRSDQAVHWARTMLTPRRAVVIDCETTD |
| Ga0302321_1031091262 | 3300031726 | Fen | MITTDAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGGVTGN |
| Ga0302321_1034130102 | 3300031726 | Fen | MITTAAPGWLRRSDQAVTWARTMLQPRRAVVIDCETTDL |
| Ga0302322_1011786911 | 3300031902 | Fen | MITTDAPAWLRRSDQAVTWARTMLTPRRAVVIDCET |
| Ga0311367_101622315 | 3300031918 | Fen | MITTGEPPAWLRRSDQAVTWARRHMLSPRRAVVIDCETTDLPGGVTGNDGH |
| Ga0311367_105394111 | 3300031918 | Fen | MITTAAPAWLRRSDQAVTWARTMLTPRRAVVIDCETTDLPGCVTEGAVVDIS |
| Ga0311367_105974522 | 3300031918 | Fen | MITITTDAPAWLQRSDQAVHWARTMLHPRRAVVIDCETTDLPGGVTGN |
| Ga0247829_107911751 | 3300033550 | Soil | MITTADAPPWLRRPDQAVTWARTMLTPHRAVVIDCETTDLPGALCE |
| ⦗Top⦘ |