| Basic Information | |
|---|---|
| Family ID | F049851 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GVFRAKGVEKGKSYVRRERFVDTWIFKNGKWVCVATNATPVLH |
| Number of Associated Samples | 131 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.11 % |
| % of genes near scaffold ends (potentially truncated) | 93.84 % |
| % of genes from short scaffolds (< 2000 bps) | 88.36 % |
| Associated GOLD sequencing projects | 126 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.205 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.644 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.918 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.685 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 49.30% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF06379 | RhaT | 13.01 |
| PF00583 | Acetyltransf_1 | 8.90 |
| PF01134 | GIDA | 8.90 |
| PF01676 | Metalloenzyme | 7.53 |
| PF00072 | Response_reg | 3.42 |
| PF00756 | Esterase | 2.74 |
| PF07719 | TPR_2 | 2.74 |
| PF14534 | DUF4440 | 2.05 |
| PF01808 | AICARFT_IMPCHas | 1.37 |
| PF04185 | Phosphoesterase | 1.37 |
| PF12704 | MacB_PCD | 1.37 |
| PF04305 | DUF455 | 1.37 |
| PF07238 | PilZ | 1.37 |
| PF00486 | Trans_reg_C | 1.37 |
| PF00795 | CN_hydrolase | 1.37 |
| PF00188 | CAP | 1.37 |
| PF01230 | HIT | 0.68 |
| PF12974 | Phosphonate-bd | 0.68 |
| PF07883 | Cupin_2 | 0.68 |
| PF00933 | Glyco_hydro_3 | 0.68 |
| PF01553 | Acyltransferase | 0.68 |
| PF13683 | rve_3 | 0.68 |
| PF12762 | DDE_Tnp_IS1595 | 0.68 |
| PF09723 | Zn-ribbon_8 | 0.68 |
| PF01965 | DJ-1_PfpI | 0.68 |
| PF02272 | DHHA1 | 0.68 |
| PF14384 | BrnA_antitoxin | 0.68 |
| PF02371 | Transposase_20 | 0.68 |
| PF01729 | QRPTase_C | 0.68 |
| PF11645 | PDDEXK_5 | 0.68 |
| PF13561 | adh_short_C2 | 0.68 |
| PF05635 | 23S_rRNA_IVP | 0.68 |
| PF00873 | ACR_tran | 0.68 |
| PF04365 | BrnT_toxin | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0138 | AICAR transformylase/IMP cyclohydrolase PurH | Nucleotide transport and metabolism [F] | 1.37 |
| COG2340 | Spore germination protein YkwD and related proteins with CAP (CSP/antigen 5/PR1) domain | Cell cycle control, cell division, chromosome partitioning [D] | 1.37 |
| COG2833 | Uncharacterized protein, contains ferritin-like DUF455 domain | Function unknown [S] | 1.37 |
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.37 |
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 0.68 |
| COG1472 | Periplasmic beta-glucosidase and related glycosidases | Carbohydrate transport and metabolism [G] | 0.68 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 0.68 |
| COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.68 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.21 % |
| Unclassified | root | N/A | 4.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_102375085 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300001471|JGI12712J15308_10140363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101303086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 617 | Open in IMG/M |
| 3300002909|JGI25388J43891_1026889 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300004114|Ga0062593_101507827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 725 | Open in IMG/M |
| 3300004479|Ga0062595_100378159 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300004479|Ga0062595_102249415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300005184|Ga0066671_10168258 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
| 3300005332|Ga0066388_100113867 | All Organisms → cellular organisms → Bacteria | 3208 | Open in IMG/M |
| 3300005336|Ga0070680_101138390 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300005434|Ga0070709_10690204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300005434|Ga0070709_11596346 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300005435|Ga0070714_100000427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 30642 | Open in IMG/M |
| 3300005436|Ga0070713_100362152 | Not Available | 1348 | Open in IMG/M |
| 3300005445|Ga0070708_100369441 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300005456|Ga0070678_101667122 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300005458|Ga0070681_12053596 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300005518|Ga0070699_101545392 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005541|Ga0070733_11092953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300005542|Ga0070732_10032592 | All Organisms → cellular organisms → Bacteria | 2971 | Open in IMG/M |
| 3300005546|Ga0070696_100514193 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300005558|Ga0066698_10058249 | All Organisms → cellular organisms → Bacteria | 2459 | Open in IMG/M |
| 3300005576|Ga0066708_10066616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2060 | Open in IMG/M |
| 3300005576|Ga0066708_10359583 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300005586|Ga0066691_10184968 | All Organisms → cellular organisms → Bacteria | 1209 | Open in IMG/M |
| 3300005591|Ga0070761_10301788 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 964 | Open in IMG/M |
| 3300005602|Ga0070762_10102799 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300005614|Ga0068856_100503488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1232 | Open in IMG/M |
| 3300005615|Ga0070702_100266257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1169 | Open in IMG/M |
| 3300005712|Ga0070764_10210495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1094 | Open in IMG/M |
| 3300005921|Ga0070766_10682258 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300006173|Ga0070716_101612772 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300006174|Ga0075014_100422614 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300006175|Ga0070712_100636361 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300006791|Ga0066653_10415690 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 688 | Open in IMG/M |
| 3300006794|Ga0066658_10471556 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300006806|Ga0079220_11043529 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300006904|Ga0075424_101752752 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300006954|Ga0079219_10642912 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300007076|Ga0075435_100220147 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300009011|Ga0105251_10242941 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 811 | Open in IMG/M |
| 3300009038|Ga0099829_11643053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 530 | Open in IMG/M |
| 3300009088|Ga0099830_10564973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 931 | Open in IMG/M |
| 3300009088|Ga0099830_11258493 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009088|Ga0099830_11672904 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300009089|Ga0099828_10141742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2117 | Open in IMG/M |
| 3300009177|Ga0105248_12339422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 608 | Open in IMG/M |
| 3300009700|Ga0116217_10028285 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4306 | Open in IMG/M |
| 3300009824|Ga0116219_10139086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1408 | Open in IMG/M |
| 3300009839|Ga0116223_10020723 | All Organisms → cellular organisms → Bacteria | 4642 | Open in IMG/M |
| 3300010046|Ga0126384_12014044 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010335|Ga0134063_10188514 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
| 3300010336|Ga0134071_10354853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 742 | Open in IMG/M |
| 3300010358|Ga0126370_10721531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 878 | Open in IMG/M |
| 3300010360|Ga0126372_11871291 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300010360|Ga0126372_12257051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300010371|Ga0134125_10315850 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300010373|Ga0134128_12205239 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300010375|Ga0105239_11782308 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300010376|Ga0126381_102998337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 671 | Open in IMG/M |
| 3300010396|Ga0134126_12480451 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300010397|Ga0134124_12699941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300010397|Ga0134124_12882495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
| 3300010876|Ga0126361_11215964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300010937|Ga0137776_1619108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300011120|Ga0150983_14124250 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300011270|Ga0137391_10431395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1123 | Open in IMG/M |
| 3300011271|Ga0137393_10291785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 1388 | Open in IMG/M |
| 3300012189|Ga0137388_10055339 | All Organisms → cellular organisms → Bacteria | 3239 | Open in IMG/M |
| 3300012200|Ga0137382_10721438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300012203|Ga0137399_10023155 | All Organisms → cellular organisms → Bacteria | 4120 | Open in IMG/M |
| 3300012206|Ga0137380_11610268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300012207|Ga0137381_11611913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300012209|Ga0137379_10069817 | All Organisms → cellular organisms → Bacteria | 3379 | Open in IMG/M |
| 3300012209|Ga0137379_10981580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300012211|Ga0137377_11431866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300012212|Ga0150985_112700622 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300012362|Ga0137361_11559033 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300012929|Ga0137404_10765085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 876 | Open in IMG/M |
| 3300012971|Ga0126369_10279987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1658 | Open in IMG/M |
| 3300012984|Ga0164309_10454740 | Not Available | 969 | Open in IMG/M |
| 3300012986|Ga0164304_10664790 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012987|Ga0164307_11571008 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300012988|Ga0164306_11485664 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300013296|Ga0157374_10694757 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300013296|Ga0157374_11186218 | Not Available | 785 | Open in IMG/M |
| 3300013296|Ga0157374_12947134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300015371|Ga0132258_12976734 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
| 3300015373|Ga0132257_100084560 | All Organisms → cellular organisms → Bacteria | 3620 | Open in IMG/M |
| 3300015373|Ga0132257_100227261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2221 | Open in IMG/M |
| 3300017659|Ga0134083_10387877 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300017927|Ga0187824_10061976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1164 | Open in IMG/M |
| 3300017927|Ga0187824_10242084 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300017930|Ga0187825_10073601 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1168 | Open in IMG/M |
| 3300018431|Ga0066655_10786394 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300018468|Ga0066662_12454978 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300020006|Ga0193735_1134974 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300020581|Ga0210399_10325364 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
| 3300021170|Ga0210400_11372868 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300021403|Ga0210397_10895724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 687 | Open in IMG/M |
| 3300021406|Ga0210386_11816943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300021407|Ga0210383_10477500 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300021432|Ga0210384_10026883 | All Organisms → cellular organisms → Bacteria | 5419 | Open in IMG/M |
| 3300021432|Ga0210384_11091387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 701 | Open in IMG/M |
| 3300021432|Ga0210384_11310722 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300021478|Ga0210402_11052329 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300025414|Ga0208935_1035518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
| 3300025900|Ga0207710_10518028 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300025929|Ga0207664_10705169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 907 | Open in IMG/M |
| 3300025945|Ga0207679_10742668 | All Organisms → cellular organisms → Bacteria | 892 | Open in IMG/M |
| 3300026078|Ga0207702_10462786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1232 | Open in IMG/M |
| 3300026078|Ga0207702_10527555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
| 3300026281|Ga0209863_10065316 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300026297|Ga0209237_1107916 | Not Available | 1204 | Open in IMG/M |
| 3300026322|Ga0209687_1195999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300026354|Ga0257180_1036494 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300026514|Ga0257168_1103194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 635 | Open in IMG/M |
| 3300026530|Ga0209807_1114260 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300027629|Ga0209422_1116651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
| 3300027855|Ga0209693_10044370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2186 | Open in IMG/M |
| 3300027889|Ga0209380_10773161 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300027895|Ga0209624_10324968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1025 | Open in IMG/M |
| 3300028047|Ga0209526_10458219 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300028780|Ga0302225_10616671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300028795|Ga0302227_10382608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 534 | Open in IMG/M |
| 3300028806|Ga0302221_10052822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1860 | Open in IMG/M |
| 3300028906|Ga0308309_11066466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300029943|Ga0311340_10229834 | Not Available | 1833 | Open in IMG/M |
| 3300030054|Ga0302182_10154429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 992 | Open in IMG/M |
| 3300030339|Ga0311360_11001690 | Not Available | 660 | Open in IMG/M |
| 3300030503|Ga0311370_11804851 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 621 | Open in IMG/M |
| 3300030618|Ga0311354_11387894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300030707|Ga0310038_10045667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2503 | Open in IMG/M |
| 3300031231|Ga0170824_101358959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300031233|Ga0302307_10611880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300031242|Ga0265329_10295741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300031715|Ga0307476_10092691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2123 | Open in IMG/M |
| 3300031720|Ga0307469_11434081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300031754|Ga0307475_10130573 | All Organisms → cellular organisms → Bacteria | 1985 | Open in IMG/M |
| 3300031796|Ga0318576_10202222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 934 | Open in IMG/M |
| 3300031939|Ga0308174_10240244 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1402 | Open in IMG/M |
| 3300031962|Ga0307479_11637255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 598 | Open in IMG/M |
| 3300032180|Ga0307471_101291911 | Not Available | 892 | Open in IMG/M |
| 3300032205|Ga0307472_100406039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1141 | Open in IMG/M |
| 3300033004|Ga0335084_10314148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1619 | Open in IMG/M |
| 3300033887|Ga0334790_114834 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.64% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.22% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.16% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.11% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.11% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.05% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.37% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.37% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.68% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.68% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.68% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.68% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002909 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300025414 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028795 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_1 | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030054 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1023750852 | 3300000955 | Soil | TGLFHAKGVENGRRYNRYDRFVDTWMFKDGKWVCVATNATPVAH* |
| JGI12712J15308_101403632 | 3300001471 | Forest Soil | EAGKPYVRRERFVDTWIYTGGKWVCVASDATPVLH* |
| JGIcombinedJ26739_1013030861 | 3300002245 | Forest Soil | RARGVEAGKPYVRRERFVDTWIYTGGKWACVASDATPVLH* |
| JGI25388J43891_10268891 | 3300002909 | Grasslands Soil | AKGVEGGKRYVRRERFVDTWLFNAGKWVCVATNATPVLH* |
| Ga0062593_1015078272 | 3300004114 | Soil | ANEEQVAPESLVVHMHGQTAVAVGVFAAKGSHGGKPYVRRERFVDTWILKNGKWVCVATNATPMTH* |
| Ga0062595_1003781591 | 3300004479 | Soil | IATGVFHAKGVEGGKKYNRRDRFVDTWLYTNGKWVCVATNTTPVLH* |
| Ga0062595_1022494151 | 3300004479 | Soil | FRAKGVEAGKPYVRRERFVDTWIYRNGTWVCVATNATPVLR* |
| Ga0066671_101682581 | 3300005184 | Soil | AKGVDRGKRYERRERFVDTWINKDGKWVCVATNATPVLH* |
| Ga0066388_1001138673 | 3300005332 | Tropical Forest Soil | LRVKGVENGKSYSHRERFVDTWLRKGDGWVCIATNPTPMR* |
| Ga0070680_1011383901 | 3300005336 | Corn Rhizosphere | GVFRAKGVEKGKSYVRRERFVDTWIFKNGKWVCVATNATPVLH* |
| Ga0070709_106902041 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LRVKGVESGKPYTRRERFVDTWLHKGNNWVCIATDATPIVH* |
| Ga0070709_115963461 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AKGVEAGKPYVRRERFVDTWIYKGGNWVCVATNATPVLQ* |
| Ga0070714_1000004278 | 3300005435 | Agricultural Soil | VFGTAAIATGVMRVKGVEGGKSYTRRERFVDTWIYKGGTWVCVGTNTTPVLH* |
| Ga0070713_1003621522 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ASGVLRVKGVEGGKPYTRRERFVDTWLHKGNNWVCIATDATPIVH* |
| Ga0070708_1003694411 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSVSRQGSGKAYSRRERFVDTWVYKDGQWRCVGTNATPILH |
| Ga0070678_1016671222 | 3300005456 | Miscanthus Rhizosphere | HMHGQTAVAVGVFAAKGSHGGKPYVRRERFVDTWILKNGKWVCVATNATPMTH* |
| Ga0070681_120535962 | 3300005458 | Corn Rhizosphere | PESLVVHMHGQTAVAVGVFAAKGSHGGKPYVRRERFVDTWILKNGKWVCVATNATPMTH* |
| Ga0070699_1015453921 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | SAAISTGVFRAKGIEAGKPYVRRERFVDTWVFKGGKWVCVATNATPVVH* |
| Ga0070733_110929531 | 3300005541 | Surface Soil | VKGVEGGTAYTRREGFVDTWLYKGGNWVCVGTDATPVLH* |
| Ga0070732_100325926 | 3300005542 | Surface Soil | KGVEGGRAYTRRERFVDTWLHKGPNWVCVATNATPMH* |
| Ga0070696_1005141931 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | NTAISTGVFRAKGVEKGKSYVRRERFVDTWIFKNGKWVCVATNATPVLH* |
| Ga0066698_100582493 | 3300005558 | Soil | SITVHVFGDVAIATGVFQAKGVEKGKRYSRRDRFVDTWLRKGENWVCIGTNATPILH* |
| Ga0066708_100666164 | 3300005576 | Soil | EGGKRYVRRERFVDTWLFNAGKWVCVATNATPVLH* |
| Ga0066708_103595833 | 3300005576 | Soil | VERGKRYVRRERFVDTWLLNTGKWVCVATNATPVLH* |
| Ga0066691_101849681 | 3300005586 | Soil | NTAIATGVFRAKGVEGGKAYSRRERFIDTWVLKDGQWRCVGTDATPILH* |
| Ga0070761_103017883 | 3300005591 | Soil | VKGVERGKSYIRRERFVDTWLKKGLNWVCVGTDATPILQ* |
| Ga0070762_101027994 | 3300005602 | Soil | NVTIATGVMKVKGVEAGKPYTRRERFVDTWVFKHGAWVCIGTNATPVLH* |
| Ga0068856_1005034882 | 3300005614 | Corn Rhizosphere | IATGVFEAKGVDAGKRYVRRERFVDTWIYKNGKWVCVATNAIPVLR* |
| Ga0070702_1002662571 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | AVGVFAAKGSRGGKPYVRRERFVDTWILKNGKWVCVATNATPMTH* |
| Ga0070764_102104951 | 3300005712 | Soil | IENGKPFVRHDRFVDTWIKSGNTWVCVAASATSMIH* |
| Ga0070766_106822581 | 3300005921 | Soil | RVFGTVAVASGVMRVKGVENGRSYTRREQFVDTWLFKGGKWVCIATDATPIAH* |
| Ga0070716_1016127722 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | VEKGKSYVRRERFVDTWIFRNGKWVCVATNATPVLH* |
| Ga0075014_1004226141 | 3300006174 | Watersheds | AAIATGVFRAKGVEGGKPYVRRERFVDTWVYKGGKWTCVATNATPMLH* |
| Ga0070712_1006363613 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MHVKGMENGKSYSRRERFVDTWLLKRGNWVCVGTNATPVLH* |
| Ga0066653_104156903 | 3300006791 | Soil | RAKGVEGGKRYVRRERFVDTWLFNAGKWVCVATNATPVLH* |
| Ga0066658_104715562 | 3300006794 | Soil | VKGMENGKAYTGRELFVDPWIFKAGTWVRIGTNATPVLY* |
| Ga0079220_110435291 | 3300006806 | Agricultural Soil | IFHAKGSESGKHYTRRERFVDTWLFKDGKWVCVATNATPVLH* |
| Ga0075424_1017527522 | 3300006904 | Populus Rhizosphere | ENGRRYNRYDRFVDTWTFKDGKWVCVATNATPVAH* |
| Ga0079219_106429122 | 3300006954 | Agricultural Soil | EGGKPYVRRERFVDTWIYQNGKWKCAAASATTVLH* |
| Ga0075435_1002201472 | 3300007076 | Populus Rhizosphere | SVHVFGKTAIATGVFRAKGVEGGKRYVRRERFVDTWLFNAGKWVCVATNATPVLH* |
| Ga0105251_102429412 | 3300009011 | Switchgrass Rhizosphere | ARGKRGGKPYVRRERFVDTWILKKGNWVCVATNATPMTH* |
| Ga0099829_116430531 | 3300009038 | Vadose Zone Soil | GVEGGKSYMRRERFVDTWLYKNGKWVCVASNATPILH* |
| Ga0099830_105649731 | 3300009088 | Vadose Zone Soil | HGQTAIAVGVFAAKGSRNGKPYVRRERFVDTWILKSGNWVCVATNATPILH* |
| Ga0099830_112584932 | 3300009088 | Vadose Zone Soil | ATGIFRAKGVAGGKSYVRRERFIDTWVYKDGRWICVATDATPILH* |
| Ga0099830_116729042 | 3300009088 | Vadose Zone Soil | EGGKPYVHRERFVDTWIYKDGKWRCAAASATIVLH* |
| Ga0099828_101417424 | 3300009089 | Vadose Zone Soil | GVFAAKGSRNGKPYVRRERFVDTWILKNGNWVCVATNATPILH* |
| Ga0105248_123394221 | 3300009177 | Switchgrass Rhizosphere | VVHMHGQTAVAVGVFAAKGSHGGKPYVRRERFVDTWILKNGKWVCVATNATPMTH* |
| Ga0116217_100282851 | 3300009700 | Peatlands Soil | MRVKGVEAGKPYTRRERFVDTWLLKKGTWVCVGTDATPVLH* |
| Ga0116219_101390861 | 3300009824 | Peatlands Soil | VFGNVAIATGVMRVKGVEAGKPYTRRERFVDTWLLKKGTWVCVGTDATPVLH* |
| Ga0116223_100207235 | 3300009839 | Peatlands Soil | KGVEAGKPYTRRERFVDTWLLKKGTWVCVGTDATPVLH* |
| Ga0126384_120140441 | 3300010046 | Tropical Forest Soil | TAIATGLFHAKGVENGRHYNRYDRFVDTWMFKESKWVCVATNATPVIH* |
| Ga0134063_101885142 | 3300010335 | Grasslands Soil | IATGVFQAKGVEKGKRYSRRDRFVDTWLRKGENWVCIGTNATPILH* |
| Ga0134071_103548532 | 3300010336 | Grasslands Soil | ATGVFRAKGVEGGKRYVRRERFVDTWLFNAGKWVCVATNATPVLH* |
| Ga0126370_107215311 | 3300010358 | Tropical Forest Soil | GVFEAKGLEAGKRYVRRERFVDTWVYKNNKWVCVATNAVPVLH* |
| Ga0126372_118712911 | 3300010360 | Tropical Forest Soil | VFRAKGVEGGKRYVRRERFVDTWLFNAGKWVCVATNATPVLH* |
| Ga0126372_122570511 | 3300010360 | Tropical Forest Soil | ILRVKGVENGKSYSRRERFVDTWLRKGDGWVCIATDATPMK* |
| Ga0134125_103158503 | 3300010371 | Terrestrial Soil | VEKGKSYVRRERFVDTWIFKNGKWVCVATNATPVLH* |
| Ga0134128_122052392 | 3300010373 | Terrestrial Soil | MSVRVHGTIAIATGVFRAKGVEGGKHYVRRERFVDTWLLKDGTWVCIATNATPILH* |
| Ga0105239_117823082 | 3300010375 | Corn Rhizosphere | PESLSVHIHGQTAIATGVFAARGKRGGKPYVRRERFVDTWILKKGNWVCVATNATPMTH* |
| Ga0126381_1029983371 | 3300010376 | Tropical Forest Soil | QGEPESMSVHVFGTTAIATGVMRVKGIENATSYTRRERFVDTWIFKGGTWVCVGTNATPVLH* |
| Ga0134126_124804512 | 3300010396 | Terrestrial Soil | MSVCVHGTIAIATGVFRAKGVEGGKHYVRRERFVDTWLLKDGTWVCIATNATPILH* |
| Ga0134124_126999411 | 3300010397 | Terrestrial Soil | EAGKPYIRRERFVDTWIYRNGTWVCVATNATPVLR* |
| Ga0134124_128824951 | 3300010397 | Terrestrial Soil | NEEQVAPESLSVHIHGQTAIATGVFAARGKRGGKPYVRRERFVDTWILKKGNWVCVATTATPMTH* |
| Ga0126361_112159641 | 3300010876 | Boreal Forest Soil | FHVHVFDNVAIATGVMRVKGVEGGKAYTRHERFVDTWLLKHGNWVCVGTGATPVLH* |
| Ga0137776_16191082 | 3300010937 | Sediment | RVKGVEGGKPYTRRVRFVDTWLLKYGSWVCIGTNATPILH* |
| Ga0150983_141242501 | 3300011120 | Forest Soil | GVEARKPYVRRECFVDTWVYKSGKWVCIATNAMPVLR* |
| Ga0137391_104313951 | 3300011270 | Vadose Zone Soil | RAKGIEGGKSYVRRERFVDTWLYKNGKWVCVASNATPILH* |
| Ga0137393_102917852 | 3300011271 | Vadose Zone Soil | AKGVEGGKSYVRRERFVDTWIYKKGQWVCVASNATPVLH* |
| Ga0137388_100553397 | 3300012189 | Vadose Zone Soil | AAKGSRNGKPYVRRERFVDTWILKNGNWVCVATNATPILH* |
| Ga0137382_107214381 | 3300012200 | Vadose Zone Soil | DVAVATGVLRVKGMENGKSYTRRERFVDTWFRKGDNWVCIATNATPITH* |
| Ga0137399_100231555 | 3300012203 | Vadose Zone Soil | VRVFGEVAIASGVMRVKGVESGKPYTRREQFVDTWLFKSGKWVCIATDATPVVK* |
| Ga0137380_116102682 | 3300012206 | Vadose Zone Soil | FAAKGSRNGKPYVRRERFVDTWILKNGNWVCVATNATPILH* |
| Ga0137381_116119131 | 3300012207 | Vadose Zone Soil | GEEGGKSYNRRERFVDTWLFKRGNWVCVGTDATPVLH* |
| Ga0137379_100698171 | 3300012209 | Vadose Zone Soil | TAVATGVFRAKGVEGGKRYVRRERFVDTWLFNAGKWVCVATNATPVLH* |
| Ga0137379_109815801 | 3300012209 | Vadose Zone Soil | VGVFAAKGSRNGKPYVRRERFVDTWILKNGNWVCVATNATPILH* |
| Ga0137377_114318661 | 3300012211 | Vadose Zone Soil | HGQTAIAVGVFAAKGSRNGKPYVRRERFVDTWILKNGNWVCVATNATPILH* |
| Ga0150985_1127006221 | 3300012212 | Avena Fatua Rhizosphere | IATGIMRVKGEEHGSPYNRRERFVDTWMFKRGNWVCIGTDATPVVH* |
| Ga0137361_115590332 | 3300012362 | Vadose Zone Soil | RKGKAYIRRERFVDTWILKNGNWVCVATNATPILH* |
| Ga0137404_107650851 | 3300012929 | Vadose Zone Soil | KGSRNGKPYVRRERFVDTWILKNGNWVCVATNATPILH* |
| Ga0126369_102799871 | 3300012971 | Tropical Forest Soil | VAIAAGVMRVKGTENGKSYTRREQFVDTWLFKGGKWVCIATNATPVTH* |
| Ga0164309_104547402 | 3300012984 | Soil | MNVHVYGNVAIATGVMRVKGVENGKSYTRRERFVDTWLFKRGSWVCVGTDATPVLH* |
| Ga0164304_106647902 | 3300012986 | Soil | AISTGVFRAKGVEKGKSYVRRERFVDTWIFKNGKWVCVATNATPVLH* |
| Ga0164307_115710082 | 3300012987 | Soil | VGVFAAKGSHGGKPYVRRERFVDTWILKNGKWVCVATNATPMTH* |
| Ga0164306_114856642 | 3300012988 | Soil | AKGVEKGKSYVRRERFVDTWIFRNGKWVCVATNATPVLH* |
| Ga0157374_106947571 | 3300013296 | Miscanthus Rhizosphere | KGVEGGKKYNRRDRFVDTWLYTNGKWVCVATNATPVLH* |
| Ga0157374_111862182 | 3300013296 | Miscanthus Rhizosphere | GVFRAKGVEAGKPYVRRERFVDTWIYKNENWVCVATNATPVLHGAF* |
| Ga0157374_129471341 | 3300013296 | Miscanthus Rhizosphere | GVFRAKGVEAGKPYVRRERFVDTWIYKNENWVCVATNATPVLHRLP* |
| Ga0132258_129767342 | 3300015371 | Arabidopsis Rhizosphere | RAKGVEKGKSYVRRERFVDTWIFRNGKWVCVATNATPVLH* |
| Ga0132257_1000845601 | 3300015373 | Arabidopsis Rhizosphere | GSHGGKPYVRRERFVDTWILKNGKWVCVATNATPMTH* |
| Ga0132257_1002272611 | 3300015373 | Arabidopsis Rhizosphere | TGVLKVKGVENGKQYTRREQFVDTWVNKGGKWVCVATDATPVLR* |
| Ga0134083_103878771 | 3300017659 | Grasslands Soil | HVFGDVAIATGVFQAKGVEKGKRYSRRDRFVDTWLRKGENWVCIGTNATPILH |
| Ga0187824_100619761 | 3300017927 | Freshwater Sediment | RVHGDVAIATGVMRAQGKERGKDYIRPERFVDTWIRKNGNWVCVATDATPIK |
| Ga0187824_102420841 | 3300017927 | Freshwater Sediment | MRAQGKERGKDYIRPERFVDTWIRKNGNWVCVATDATPIK |
| Ga0187825_100736011 | 3300017930 | Freshwater Sediment | PESMSVHVYGTIAIATGVFRAKGLAGGKPYVRRERFVDTWLLKDGNWVCIATNATPILH |
| Ga0066655_107863941 | 3300018431 | Grasslands Soil | RAKGVEGGKRYVRRERFVDTWLFNAGKWVCVATNATPVLH |
| Ga0066662_124549782 | 3300018468 | Grasslands Soil | GNTAIATGVFRAKGVEAGKSYVRRERFVDTWVDRGGKWSCVATNATPVLH |
| Ga0193735_11349741 | 3300020006 | Soil | HVFGNAAVATGVFQAKGIEAGKPYVRRERFVDTWVYKGGKWVCVATDATPVLH |
| Ga0210399_103253641 | 3300020581 | Soil | ATGVFRAKGMEGGKSYVRRERFIDTWVEKGGRWICVATDATPILH |
| Ga0210400_113728682 | 3300021170 | Soil | VHIFGNVAIATGVMRVKGFEGGKPYSRRERFVDTWLLKHGAWVCVGTDATPVLR |
| Ga0210397_108957241 | 3300021403 | Soil | VEGGKAYSRRERFVDTWLLEHGNWVCVGTDATPVLH |
| Ga0210386_118169431 | 3300021406 | Soil | ENGKSYTRRERFVDTWLYKKGNWVCVGTDATPVLH |
| Ga0210383_104775002 | 3300021407 | Soil | LTLTLNVHLFGDVAIASGVMRVKGVERGKSYIRRERFVDTWLKKGLNWVCVGTDATPILQ |
| Ga0210384_100268831 | 3300021432 | Soil | ATGIFREKGTEGGKPYLRRERFVDTWIYKGDKWQCAAANATTILR |
| Ga0210384_110913871 | 3300021432 | Soil | GNTAIATGVFRAKGVEGGKSYVRRERFIDTWVYKGERWICVATDATPILH |
| Ga0210384_113107221 | 3300021432 | Soil | GVEAGKPYVRRERFVDTWVYKGDKWVCVATNATPVLR |
| Ga0210402_110523292 | 3300021478 | Soil | GVESGKTYVRRERFVDTWLFKDGKWVCVASNATPIVH |
| Ga0208935_10355182 | 3300025414 | Peatland | VFGNVAIATGVMRVKGVEGGKSYTRRERFVDTWLLKKGTWVCVGTDATPVLH |
| Ga0207710_105180281 | 3300025900 | Switchgrass Rhizosphere | ESLVVHMHGQTAVAVGVFAAKGSHGGKPYVRRERFVDTWILKNGKWVCVATNATPMTH |
| Ga0207664_107051692 | 3300025929 | Agricultural Soil | VLRVKGVEGGKPYTRRERFVDTWLHKGENWVCIATNATPIH |
| Ga0207679_107426681 | 3300025945 | Corn Rhizosphere | KGVEKGKSYVRRERFVDTWIFRNGKWVCVATNATPVLH |
| Ga0207702_104627861 | 3300026078 | Corn Rhizosphere | IATGVFEAKGVDAGKRYVRRERFVDTWIYKNGKWVCVATNAIPVLR |
| Ga0207702_105275553 | 3300026078 | Corn Rhizosphere | AVGVFAAKGSHGGKPYVRRERFVDTWILKNGKWVCVATNATPMTH |
| Ga0209863_100653161 | 3300026281 | Prmafrost Soil | GNTAVATGVFRAKGVEAGKSYVRRERFVDTWIYKSGKWVCVASNATPVLH |
| Ga0209237_11079161 | 3300026297 | Grasslands Soil | FRAKGVEGGKRYVRRERFVDTWLFNAGKWVCVATNATPVLH |
| Ga0209687_11959991 | 3300026322 | Soil | VEGGKPYTRRERFVDTWLHKGENWVCIATNATPIH |
| Ga0257180_10364942 | 3300026354 | Soil | TGIFRAKGIEGGKPYVHRERFVDTWIYKDGKWRCAAASATIVLH |
| Ga0257168_11031941 | 3300026514 | Soil | GVFRAKGVEGGKSYVRRERFVDTWIYKNGRWVCVASNATPVLH |
| Ga0209807_11142602 | 3300026530 | Soil | VFGNTAVATGVFRAKGVEGGKRYVRRERFVDTWLFNAGKWVCVATNATPVLH |
| Ga0209422_11166512 | 3300027629 | Forest Soil | QVAPESFHVHVFDNVAIATGVMRVKGVEGGKAYTRHERFVDTWLLKHGNWVCVGTGATPVLH |
| Ga0209693_100443704 | 3300027855 | Soil | VFDNVAIATGVMRVKGVEGGKAYARHERFVDTWLLKHGNWVCVGTGATPVLH |
| Ga0209380_107731611 | 3300027889 | Soil | RVKGVENGKSYTRRERFVDTWLYKKGNWVCVGTDATPVLH |
| Ga0209624_103249681 | 3300027895 | Forest Soil | LFGDAAIASGVMQVKGVERGKSYIRRERFVDTWLKKGSNWVCVGTDATPILH |
| Ga0209526_104582193 | 3300028047 | Forest Soil | IATGVMRVKGVEAGKPYTRHERFVDTWLLKRGTWVCIGTDATPVLH |
| Ga0302225_106166711 | 3300028780 | Palsa | VERGKSYIRRERFVDTWLKKGANWVCVGTDATPVLH |
| Ga0302227_103826082 | 3300028795 | Palsa | ATGVMRVKGVERGKSYTRRERFVDTWLKKGTNWVCVGTDATPVLR |
| Ga0302221_100528223 | 3300028806 | Palsa | NTAIATGIFRAKGVEGGKAYSRRERFIDTWVEKGGRWVCVATDATPILH |
| Ga0308309_110664662 | 3300028906 | Soil | IEAGKSYVRRERFVDTWIYKDGKWVCVASNATPVLR |
| Ga0311340_102298343 | 3300029943 | Palsa | GVLRVKGSEHGKSYSRRERFVDTWLLRGANWVCVGTDATPILH |
| Ga0302182_101544291 | 3300030054 | Palsa | TLFGSVAIATGVMRVKGVERGKSYTRRERFVDTWLKKGTNWVCVGTDATPVLR |
| Ga0311360_110016902 | 3300030339 | Bog | AMRAGKPYVRRERFVDTWMQKNGNWVCVATNATPIVH |
| Ga0311370_118048512 | 3300030503 | Palsa | GAEMWRFATRVMRVKGVEDGEPYTRRERFVDTWLFKHVSWACVGTDAPPVLH |
| Ga0311354_113878941 | 3300030618 | Palsa | EKGKSYLRRERFVDTWVNKGGRWVCVGTDATPVLH |
| Ga0310038_100456671 | 3300030707 | Peatlands Soil | MRVKGVEAGKPYTRRERFVDTWLLKKGTWVCVGTDATPVLH |
| Ga0170824_1013589592 | 3300031231 | Forest Soil | LRVKGVEDGKNYTRRERFVDTWLRKGDSWLCIATNATPITH |
| Ga0302307_106118802 | 3300031233 | Palsa | GSVAIATGVMRVKGVERGKSYTRRERFVDTWLKKGTNWVCVGTDATPVLR |
| Ga0265329_102957412 | 3300031242 | Rhizosphere | AIATGVMRVKGIESGKPYTRRERFVDTWVYKAGNWVCVGTNATPVLH |
| Ga0307476_100926914 | 3300031715 | Hardwood Forest Soil | MRVKGVENGKSYTRRERFVDTWLYKKGNWVCVGTDATPVLR |
| Ga0307469_114340811 | 3300031720 | Hardwood Forest Soil | TGVLRVKGVEGGKSYSRRERFVDTWLHKGDNWVCIATNATPIIH |
| Ga0307475_101305733 | 3300031754 | Hardwood Forest Soil | GTTAIATGVFRAKGVEGRKPYVRRERFVDTWVYKGGNWVCVATNATPVLH |
| Ga0318576_102022222 | 3300031796 | Soil | QGEVAVATGVMRPKGNERGKTYIRPERFVDTWLHKNGTWVCIATDATPIK |
| Ga0308174_102402443 | 3300031939 | Soil | TGVFRAKGLDKGKPYTRRERFIDTWILKDGQWVCVGTNATPILH |
| Ga0307479_116372552 | 3300031962 | Hardwood Forest Soil | VHVFGTRVFRPKGVEARKPNVRRERFVDTWVYKSGKWVCV |
| Ga0307471_1012919112 | 3300032180 | Hardwood Forest Soil | RAKGVENGKPYVRRERFVDTWVYKSGKWVCVATNATPVLH |
| Ga0307472_1004060392 | 3300032205 | Hardwood Forest Soil | AKGVEGGKSYVRRERFVDTWLYKNGKWVCVASNATPVLH |
| Ga0335084_103141481 | 3300033004 | Soil | IAAGVLKVKGVENGKPYTRREQFVDTWVNKGGKWVCVATDATPVLH |
| Ga0334790_114834_2_112 | 3300033887 | Soil | VEGGKPYTRRERFVDTWVFKHGTWVCIGTDATPVLH |
| ⦗Top⦘ |