Metagenome / Metatranscriptome Family F049848

Overview

Basic Information

• Family ID: F049848
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 146
• Average Sequence Length: 38 residues
• Representative Sequence: MDPDLARRNVRLGWLLFGVFLLLFAGTFGVALLYLAFD
• Number of Associated Samples: 124
• Number of Associated Scaffolds: 146

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 56.85 %
• % of genes near scaffold ends (potentially truncated): 14.38 %
• % of genes from short scaffolds (< 2000 bps): 83.56 %
• Associated GOLD sequencing projects: 116
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (63.014 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.384 % of family members)
• Environment Ontology (ENVO): Unclassified (30.137 % of family members)
• Earth Microbiome Project Ontology (EMPO): Free-living → Non-saline → Soil (non-saline) (45.890 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 53.03%
  β-sheet: 0.00%
  Coil/Unstructured: 46.97%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 146 Family Scaffolds
PF01040	UbiA	39.04
PF01425	Amidase	23.29
PF00115	COX1	3.42
PF13561	adh_short_C2	0.68
PF00196	GerE	0.68
PF13442	Cytochrome_CBB3	0.68
PF04909	Amidohydro_2	0.68
PF01474	DAHP_synth_2	0.68
PF13485	Peptidase_MA_2	0.68
PF08443	RimK	0.68
PF00440	TetR_N	0.68
PF13239	2TM	0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 146 Family Scaffolds
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	23.29
COG3200	3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase, class II	Amino acid transport and metabolism [E]	0.68

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	63.01 %
Unclassified	root	N/A	36.99 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	63.01 %
Unclassified	root	N/A	36.99 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	63.01 %
Unclassified	root	N/A	36.99 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.99 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	27.40 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.99 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	24.66 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.37 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.99 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	8.90 %
Thermoleophilia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	3.42 %
Rubrobacteria	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria	2.05 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.37 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.99 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	8.22 %
Solirubrobacterales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	2.05 %
Gaiellales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales	2.05 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.37 %
Micromonosporales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales	0.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.99 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	8.22 %
Gaiellaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae	2.05 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.37 %
Solirubrobacteraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae	0.68 %
Micromonosporaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae	0.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.99 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	8.22 %
Gaiella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella	2.05 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.37 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.68 %
Phytohabitans	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans	0.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	36.99 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	8.22 %
Gaiella occulta	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta	2.05 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1.37 %
Phytohabitans suffuscus	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans suffuscus	0.68 %
Solirubrobacter	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	0.68 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.68 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2140918007|ConsensusfromContig67995	All Organisms → cellular organisms → Bacteria	880
3300000364|INPhiseqgaiiFebDRAFT_100381633	Not Available	513
3300000956|JGI10216J12902_108908175	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1239
3300001686|C688J18823_10285925	Not Available	1086
3300004063|Ga0055483_10176285	All Organisms → cellular organisms → Bacteria → Proteobacteria	688
3300005327|Ga0070658_10006695	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	9331
3300005524|Ga0070737_10098256	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter	1358
3300005529|Ga0070741_10075404	All Organisms → cellular organisms → Bacteria	3757
3300005529|Ga0070741_10911203	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	760
3300005538|Ga0070731_10000812	All Organisms → cellular organisms → Bacteria	37133
3300005538|Ga0070731_10544686	All Organisms → cellular organisms → Bacteria	773
3300005540|Ga0066697_10755330	All Organisms → cellular organisms → Bacteria	530
3300005557|Ga0066704_10714498	All Organisms → cellular organisms → Bacteria	630
3300005586|Ga0066691_10294948	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	956
3300005764|Ga0066903_100120125	All Organisms → cellular organisms → Bacteria	3649
3300005764|Ga0066903_101274711	All Organisms → cellular organisms → Bacteria	1371
3300005764|Ga0066903_101711421	All Organisms → cellular organisms → Bacteria	1198
3300005764|Ga0066903_103647534	All Organisms → cellular organisms → Bacteria	829
3300005764|Ga0066903_105781564	All Organisms → cellular organisms → Bacteria	650
3300005834|Ga0068851_10291254	All Organisms → cellular organisms → Bacteria	936
3300005891|Ga0075283_1020561	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1036
3300005893|Ga0075278_1005347	All Organisms → cellular organisms → Bacteria	1578
3300006028|Ga0070717_11276238	Not Available	668
3300006031|Ga0066651_10330682	Not Available	818
3300006032|Ga0066696_10848071	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	582
3300006046|Ga0066652_101553305	Not Available	611
3300006173|Ga0070716_101690405	Not Available	522
3300006174|Ga0075014_100165135	Not Available	1093
3300006175|Ga0070712_101071278	All Organisms → cellular organisms → Bacteria	699
3300006603|Ga0074064_11779955	Not Available	527
3300006800|Ga0066660_11132138	All Organisms → cellular organisms → Bacteria	618
3300006804|Ga0079221_10637791	Not Available	727
3300006804|Ga0079221_10823269	All Organisms → cellular organisms → Bacteria	669
3300006852|Ga0075433_11785915	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	529
3300006904|Ga0075424_100024672	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia	6190
3300006954|Ga0079219_12145869	Not Available	536
3300007820|Ga0104324_130156	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2394
3300009012|Ga0066710_104272265	All Organisms → cellular organisms → Bacteria	534
3300009012|Ga0066710_104733372	All Organisms → cellular organisms → Bacteria	509
3300009090|Ga0099827_11503302	All Organisms → cellular organisms → Bacteria	586
3300009090|Ga0099827_11900389	Not Available	519
3300009137|Ga0066709_101396347	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans suffuscus	1019
3300009137|Ga0066709_101743250	All Organisms → cellular organisms → Bacteria	879
3300009143|Ga0099792_11256420	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	504
3300009148|Ga0105243_12585522	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	547
3300009525|Ga0116220_10349732	Not Available	655
3300010376|Ga0126381_100742381	All Organisms → cellular organisms → Bacteria	1406
3300010396|Ga0134126_10964007	All Organisms → cellular organisms → Bacteria	957
3300010398|Ga0126383_11707861	Not Available	718
3300010937|Ga0137776_1193500	Not Available	550
3300012014|Ga0120159_1176256	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	579
3300012198|Ga0137364_10578197	Not Available	846
3300012200|Ga0137382_10231514	Not Available	1276
3300012204|Ga0137374_10000011	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	154488
3300012208|Ga0137376_11703355	Not Available	521
3300012354|Ga0137366_10644253	All Organisms → cellular organisms → Bacteria	758
3300012356|Ga0137371_10100801	All Organisms → cellular organisms → Bacteria	2249
3300012357|Ga0137384_10320420	All Organisms → cellular organisms → Bacteria	1287
3300012361|Ga0137360_11826217	Not Available	513
3300012362|Ga0137361_11898009	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	512
3300012923|Ga0137359_10726530	Not Available	864
3300012927|Ga0137416_11997999	Not Available	532
3300012929|Ga0137404_10221524	Not Available	1612
3300012931|Ga0153915_11462343	All Organisms → cellular organisms → Bacteria	799
3300012977|Ga0134087_10688790	All Organisms → cellular organisms → Bacteria	540
3300012985|Ga0164308_11084758	Not Available	716
3300012989|Ga0164305_11422878	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	611
3300013104|Ga0157370_10268373	All Organisms → cellular organisms → Bacteria	1577
3300013772|Ga0120158_10020004	All Organisms → cellular organisms → Bacteria	5536
3300013772|Ga0120158_10083580	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1993
3300013772|Ga0120158_10130287	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1435
3300014497|Ga0182008_10616263	Not Available	611
3300014497|Ga0182008_10749395	Not Available	562
3300014829|Ga0120104_1006965	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1984
3300015164|Ga0167652_1008160	Not Available	2346
3300015195|Ga0167658_1002982	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	6461
3300015241|Ga0137418_10713950	Not Available	766
3300015241|Ga0137418_11138907	All Organisms → cellular organisms → Bacteria	553
3300015242|Ga0137412_10165965	All Organisms → cellular organisms → Bacteria	1776
3300015356|Ga0134073_10426063	Not Available	505
3300015371|Ga0132258_10397215	All Organisms → cellular organisms → Bacteria	3424
3300015373|Ga0132257_101723410	Not Available	804
3300017947|Ga0187785_10068905	Not Available	1361
3300017959|Ga0187779_10072975	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2029
3300017961|Ga0187778_10168713	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1386
3300017973|Ga0187780_10369195	Not Available	1015
3300017974|Ga0187777_10558027	All Organisms → cellular organisms → Bacteria	804
3300017999|Ga0187767_10045531	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta	1068
3300018071|Ga0184618_10005601	All Organisms → cellular organisms → Bacteria → Terrabacteria group	3515
3300018089|Ga0187774_10117935	Not Available	1340
3300018089|Ga0187774_10807734	All Organisms → cellular organisms → Bacteria	634
3300018433|Ga0066667_11730862	Not Available	562
3300018468|Ga0066662_10286451	All Organisms → cellular organisms → Bacteria	1373
3300018468|Ga0066662_12776365	Not Available	519
3300019888|Ga0193751_1225727	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta	603
3300020070|Ga0206356_11355569	Not Available	1182
3300020081|Ga0206354_10094964	Not Available	505
3300020082|Ga0206353_10137406	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	2994
3300021344|Ga0193719_10224833	Not Available	798
3300021418|Ga0193695_1090224	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	661
3300024347|Ga0179591_1154077	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2384
3300025556|Ga0210120_1069090	All Organisms → cellular organisms → Bacteria	695
3300025664|Ga0208849_1089830	Not Available	863
3300025909|Ga0207705_10791131	Not Available	736
3300025909|Ga0207705_11147226	Not Available	597
3300025910|Ga0207684_11747884	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	500
3300025912|Ga0207707_10516538	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1017
3300025912|Ga0207707_11166258	Not Available	625
3300025952|Ga0210077_1014742	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1697
3300025952|Ga0210077_1034916	All Organisms → cellular organisms → Bacteria	1050
3300025988|Ga0208141_1017208	Not Available	659
3300025994|Ga0208142_1038310	All Organisms → cellular organisms → Bacteria	541
3300026008|Ga0208529_1007971	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	918
3300026008|Ga0208529_1019343	All Organisms → cellular organisms → Bacteria	638
3300026020|Ga0208531_1020107	Not Available	601
3300026335|Ga0209804_1247358	All Organisms → cellular organisms → Bacteria	673
3300026523|Ga0209808_1197326	All Organisms → cellular organisms → Bacteria	675
3300026550|Ga0209474_10334850	All Organisms → cellular organisms → Bacteria	861
3300027460|Ga0207506_1004303	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales	1046
3300027562|Ga0209735_1142295	Not Available	521
3300027706|Ga0209581_1013554	All Organisms → cellular organisms → Bacteria	4801
3300027787|Ga0209074_10226291	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	715
3300027869|Ga0209579_10000019	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	495453
3300027869|Ga0209579_10420095	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	725
3300027882|Ga0209590_10644683	Not Available	680
3300027905|Ga0209415_10061864	All Organisms → cellular organisms → Bacteria	4591
3300028047|Ga0209526_10708222	Not Available	633
3300028536|Ga0137415_11129656	Not Available	597
3300028558|Ga0265326_10025248	Not Available	1695
3300028819|Ga0307296_10335170	Not Available	826
3300031235|Ga0265330_10209883	Not Available	822
3300031247|Ga0265340_10437013	Not Available	577
3300031249|Ga0265339_10114513	Not Available	1392
3300031543|Ga0318516_10537980	All Organisms → cellular organisms → Bacteria	669
3300031939|Ga0308174_11258539	Not Available	632
3300031996|Ga0308176_11884539	All Organisms → cellular organisms → Bacteria	638
3300032074|Ga0308173_11227636	Not Available	701
3300032770|Ga0335085_10050944	All Organisms → cellular organisms → Bacteria	5598
3300032828|Ga0335080_11083866	All Organisms → cellular organisms → Bacteria	811
3300032829|Ga0335070_10531463	All Organisms → cellular organisms → Bacteria	1112
3300032893|Ga0335069_10038129	All Organisms → cellular organisms → Bacteria	6435
3300032893|Ga0335069_11839178	Not Available	642
3300032954|Ga0335083_10114823	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2618
3300033233|Ga0334722_10091213	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	2324
3300033808|Ga0314867_007031	All Organisms → cellular organisms → Bacteria	2638
3300034268|Ga0372943_0844675	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → Gaiella occulta	608

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Environmental	Environmental	89.04%
Host-Associated	Host-Associated	10.96%

Class

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	82.88%
Plants	Host-Associated → Plants	10.96%
Aquatic	Environmental → Aquatic	6.16%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	82.88%
Rhizosphere	Host-Associated → Plants → Rhizosphere	8.90%
Marine	Environmental → Aquatic → Marine	2.74%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.05%
Freshwater	Environmental → Aquatic → Freshwater	1.37%
Sediment	Environmental → Aquatic → Sediment	1.37%
Thermal Springs	Environmental → Aquatic → Thermal Springs	0.68%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	58.22%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	15.07%
Loam	Environmental → Terrestrial → Soil → Loam	9.59%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	4.11%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.74%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.37%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.37%
Lake	Environmental → Aquatic → Freshwater → Lake	0.68%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	0.68%
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	0.68%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.68%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	33.56%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	15.07%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	13.01%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	4.79%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	4.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.79%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.11%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	4.11%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.42%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	2.74%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.05%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.37%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	1.37%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.37%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.68%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.68%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	0.68%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.68%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.68%

Habitat

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	14.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.22%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	5.48%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	5.48%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.79%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	4.79%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	4.79%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	4.11%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	3.42%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	3.42%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	2.74%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.74%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.74%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	2.74%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	2.05%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.05%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	2.05%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.37%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.37%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.37%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	1.37%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.37%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.37%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.37%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.37%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	1.37%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.37%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	0.68%
Freshwater Wetlands	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands	0.68%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment	0.68%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.68%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.68%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.68%
Arctic Peat Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil	0.68%
Soil	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil	0.68%
Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland	0.68%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.68%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.68%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.68%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.68%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2140918007	Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all	Environmental
3300000364	Soil microbial communities from Great Prairies - Iowa, Native Prairie soil	Environmental
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental
3300001686	Grasslands soil microbial communities from Hopland, California, USA	Environmental
3300004063	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2	Environmental
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated
3300005524	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen10_05102014_R1	Environmental
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental
3300005538	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1	Environmental
3300005540	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146	Environmental
3300005557	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153	Environmental
3300005586	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140	Environmental
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated
3300005891	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304	Environmental
3300005893	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202	Environmental
3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Environmental
3300006031	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100	Environmental
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental
3300006046	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101	Environmental
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental
3300006174	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014	Environmental
3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Environmental
3300006603	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)	Environmental
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental
3300006804	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200	Environmental
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300007820	Permafrost core soil microbial communities from Svalbard, Norway - sample 2-12-2 Soapdenovo	Environmental
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental
3300009090	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG	Environmental
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009143	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2	Environmental
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009525	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG	Environmental
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010937	Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139	Environmental
3300012014	Permafrost microbial communities from Nunavut, Canada - A10_80cm_6M	Environmental
3300012198	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG	Environmental
3300012200	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG	Environmental
3300012204	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG	Environmental
3300012208	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG	Environmental
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental
3300012356	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG	Environmental
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental
3300012361	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG	Environmental
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental
3300012923	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG	Environmental
3300012927	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)	Environmental
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental
3300012931	Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG	Environmental
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental
3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Host-Associated
3300013772	Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M	Environmental
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated
3300014829	Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M	Environmental
3300015164	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface)	Environmental
3300015195	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)	Environmental
3300015241	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)	Environmental
3300015242	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)	Environmental
3300015356	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG	Environmental
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated
3300017947	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG	Environmental
3300017959	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG	Environmental
3300017961	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG	Environmental
3300017973	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG	Environmental
3300017974	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG	Environmental
3300017999	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG	Environmental
3300018071	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1	Environmental
3300018089	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG	Environmental
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300019888	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2	Environmental
3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)	Environmental
3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)	Environmental
3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)	Environmental
3300021344	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2	Environmental
3300021418	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2	Environmental
3300024347	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)	Environmental
3300025556	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 (SPAdes)	Environmental
3300025664	Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 deep-072012 (SPAdes)	Environmental
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental
3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)	Environmental
3300025952	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 (SPAdes)	Environmental
3300025988	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101 (SPAdes)	Environmental
3300025994	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_304 (SPAdes)	Environmental
3300026008	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 (SPAdes)	Environmental
3300026020	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 (SPAdes)	Environmental
3300026335	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)	Environmental
3300026523	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)	Environmental
3300026550	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)	Environmental
3300027460	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes)	Environmental
3300027562	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes)	Environmental
3300027706	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes)	Environmental
3300027787	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)	Environmental
3300027869	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)	Environmental
3300027882	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)	Environmental
3300027905	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)	Environmental
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental
3300028536	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)	Environmental
3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Host-Associated
3300028819	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153	Environmental
3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Host-Associated
3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Host-Associated
3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Host-Associated
3300031543	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20	Environmental
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental
3300032770	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5	Environmental
3300032828	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4	Environmental
3300032829	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3	Environmental
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental
3300033233	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom	Environmental
3300033808	Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20	Environmental
3300034268	Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
A_all_C_03512830	2140918007	Soil	MDPGLARRNVRLGWLLFGVFLLLFAGTWGVALLYTAFD
INPhiseqgaiiFebDRAFT_1003816332	3300000364	Soil	MDVELARKNVRLGWLLFGIFVVLFAGTFAVAYLYLAFD*
JGI10216J12902_1089081752	3300000956	Soil	VDADLSRRNVRLGLLLFGIFLLLFAGTFAVAYLYLAFD*
C688J18823_102859252	3300001686	Soil	MDADLARRNARLGWLLFGVFLVLLAGTVGVGLLYLAFD*
Ga0055483_101762852	3300004063	Natural And Restored Wetlands	VTMVDHELARKNVRLGWMLFGVFLLIFAGTIGVAILYLHFQ*
Ga0070658_100066958	3300005327	Corn Rhizosphere	LTDSELARKNNRLGWLLFAIFLLLFAGTWGIAFLYLHFD*
Ga0070737_100982562	3300005524	Surface Soil	MDRELAQRNVRLGWLLFGVFWLLFGGTIGIAVLYLHFQ*
Ga0070741_100754042	3300005529	Surface Soil	MDTELARKNVRLGWLLFGLFWVLFAGCFAVAFIYLAFD*
Ga0070741_109112032	3300005529	Surface Soil	MDQDLARRNVRLGWLLFGVFLLLFAGSIGVALLYLHFQ*
Ga0070731_100008123	3300005538	Surface Soil	MNPELARKNARLGWLLFGVFLLLFAGCIGIAFLYLHFS*
Ga0070731_105446862	3300005538	Surface Soil	MDPGLARRNTRLGWMLFGVFILIFAGTIGVALLYLHFQ*
Ga0066697_107553301	3300005540	Soil	LARRNLRLGWLLFGVFLLLFAGTIGIALLYLHFQ*
Ga0066704_107144982	3300005557	Soil	MDTELARRNVRLGWVLLGAFLVLFAGTFGVALLYLAFD*
Ga0066691_102949482	3300005586	Soil	MDPDLARRNVRLGWLLFGLFCLLFAGTFGVALLYLAFD*
Ga0066903_1001201254	3300005764	Tropical Forest Soil	MDPELARRNVRLGLMLFGVFVLLFAGCIGIALLYLHFK*
Ga0066903_1012747112	3300005764	Tropical Forest Soil	VDKELARKNARLGWLLFGIFLVLFAGSWGIALLYLQFD*
Ga0066903_1017114212	3300005764	Tropical Forest Soil	MDTELARRNVRLGWALFALFIVIFAGTFLVGWLYLQFD*
Ga0066903_1036475342	3300005764	Tropical Forest Soil	MDPDLARRNVRFGWLLFAIFVVLFAGTFGIALLYLAFD*
Ga0066903_1057815642	3300005764	Tropical Forest Soil	MDDDLARRNNRLGWLLFGIFVVLFAGTFLVGWLYLTFD*
Ga0068851_102912542	3300005834	Corn Rhizosphere	MDAELARKNNRLGWLLFAIFLLLFAGTWGIAFLYLHFD*
Ga0075283_10205612	3300005891	Rice Paddy Soil	MDPELARRNVRLGLMLFGVFVLLFAGCVGIALLYLHFQ*
Ga0075278_10053472	3300005893	Rice Paddy Soil	MGQELARRNVRLGWMLFGVFLLLFAGTIGVALLYLHFQ*
Ga0070717_112762381	3300006028	Corn, Switchgrass And Miscanthus Rhizosphere	MDTELARKNARLGWLLFALFCLLFAGTFAVAFIYLAFS*
Ga0066651_103306822	3300006031	Soil	MDPGLARRNARLGWLLFGAFMLLFAGTFGVALLYLAFD*
Ga0066696_108480712	3300006032	Soil	RPRSGALRRMDPGLARRNARLGWLLFGAFMLLFAGTFGVALLYLAFD*
Ga0066652_1015533052	3300006046	Soil	MDPELARRNVRLGWLLFGAVLLLFAGCIGVAYLYLHFQ*
Ga0070716_1016904052	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	MDPELARKNVVLGWALLGVFLLLFAGCIGVAYLYLHFQ*
Ga0075014_1001651352	3300006174	Watersheds	MDRELARKNARLGWLLFALFWFLFAGTFVIAFLYLAYD*
Ga0070712_1010712782	3300006175	Corn, Switchgrass And Miscanthus Rhizosphere	MAPDLVRRNARLGWLLFGVFLLLFAGTFGVALLYLAFD*
Ga0074064_117799552	3300006603	Soil	VDPELARKNVRFGWLLFALFLLLFAGCIGIAYLYLHFD*
Ga0066660_111321382	3300006800	Soil	MDPGLSSRNARLGWLLFGAFVLLFAGTFGVALLYL
Ga0079221_106377912	3300006804	Agricultural Soil	MDTELARRNARLGWLLFGIFIVLFAGTFLVGWLYLTFD*
Ga0079221_108232692	3300006804	Agricultural Soil	MDPDLARRNVRLGLMLFGVFVLLFAGCFAIALLYLHFD*
Ga0075433_117859152	3300006852	Populus Rhizosphere	MDDDLARRNARLGWLLFGIFLLLFAGTFLIGWLYLTFD*
Ga0075424_1000246723	3300006904	Populus Rhizosphere	MDEDLARRNARLGWLLFGIFILLFAGTFLIGWLYLTFD*
Ga0079219_121458692	3300006954	Agricultural Soil	MDTELARKNVRLGWLLFGVFWLIFAGCWGVALLYLAFD*
Ga0104324_1301563	3300007820	Soil	MDPGLARRNVRLGWMLFGVFCLLFAGTFGIALLYLAFD*
Ga0066710_1042722652	3300009012	Grasslands Soil	LDDDERALANVRLGWLLFGVFVLLFAGCIGVAFLYLHFQ
Ga0066710_1047333722	3300009012	Grasslands Soil	LDPELARRNVRLGLMLFGVFVLLFAGCFAIALLYLHFD
Ga0099827_115033022	3300009090	Vadose Zone Soil	MDPELVRKNARLGWLLFALFWVLFAGTFGVALLYMQFD*
Ga0099827_119003892	3300009090	Vadose Zone Soil	MDPDLARRNVRLGWLLFGVFLVLFAGTWGVALLYTAFD*
Ga0066709_1013963472	3300009137	Grasslands Soil	VATLLAARRPGNPIGWLLFGIFLLLFAGTWGVALLYLQFD*
Ga0066709_1017432502	3300009137	Grasslands Soil	MDPDLARRNVRLGWLLVGVFLLLFAGTFGVALLYLAFD*
Ga0099792_112564202	3300009143	Vadose Zone Soil	MDPDLVRRNARLGWLLFGVFLLLFAGTFGVALLYLAFD*
Ga0105243_125855222	3300009148	Miscanthus Rhizosphere	PELERRNLILGGARFGVYLLLFAGTIGVALLYLAFD*
Ga0116220_103497322	3300009525	Peatlands Soil	MDDDLARRNARLGWLLFGVFAVLFAGSFGVAFLYLHFS*
Ga0126381_1007423811	3300010376	Tropical Forest Soil	LARKNVRLGWMLFGVFVLLFAGCVGVALLYLHFK*
Ga0134126_109640072	3300010396	Terrestrial Soil	MDPELARRNVRFGSMLFGVFVLIFAGSIGVAFLYLHFQ*
Ga0126383_117078611	3300010398	Tropical Forest Soil	MDPELARRNARLGWFLWSVFLLLFAGCIGIAFLYLHFSH
Ga0137776_11935001	3300010937	Sediment	MDQDLARRNNRLGWLLFGVFLLLFAGTFAIAFLYLHFD*
Ga0120159_11762561	3300012014	Permafrost	RRHGDFLMDPDLARRNVRLGWLLVGVFLLLFAGTFGVALLYLAFD*
Ga0137364_105781972	3300012198	Vadose Zone Soil	MDPDLARRNVRLGWLLFGVFLLLFAGTFGVALLYLAFD*
Ga0137382_102315142	3300012200	Vadose Zone Soil	MDPDLARRNVRLGWLIFGVFCLLFAGTFGVALLYVAFD*
Ga0137374_10000011124	3300012204	Vadose Zone Soil	VNDRRNLLLGWGLFVLGLVVFAGTFGIALLYLAFD*
Ga0137376_117033552	3300012208	Vadose Zone Soil	VDPELARRNVRLGAFLFAIFLLLFAGCIGIAFLYLHFS*
Ga0137366_106442532	3300012354	Vadose Zone Soil	VDPELARKNVRLGSMLFSVFLLLFAGSIGVAFLYLHFQ*
Ga0137371_101008012	3300012356	Vadose Zone Soil	MDPDLAGRNVRLGWLLTGVFLLLFAGTFGVALLYLAFD*
Ga0137384_103204201	3300012357	Vadose Zone Soil	VTGNGLARRNARLGWLLFAIFWLLFAGSFGVAFIYLA
Ga0137360_118262172	3300012361	Vadose Zone Soil	MDQDLARRNVRLGWLLFGVFLVLFAGTWGVALLYTAFD*
Ga0137361_118980092	3300012362	Vadose Zone Soil	MDPDLVRRNVRLGWLLFGVFLLLFAGTFGVALLYLAFD*
Ga0137359_107265302	3300012923	Vadose Zone Soil	MDPGLARRNVRLGWLLFGVFCLLFAGTFGVALLYLAFD*
Ga0137416_119979992	3300012927	Vadose Zone Soil	MDPDLVRRNARLGWLLFGVFLVLFAGTFGVALLYLAFD*
Ga0137404_102215242	3300012929	Vadose Zone Soil	MDPDLVRRNVRLGWLLVGVFLLLFAGTFGVALLYLAFD*
Ga0153915_114623432	3300012931	Freshwater Wetlands	MDIDLARKNVRLGWLIFGIFWVLFAGTFVVALLYLHFD*
Ga0134087_106887902	3300012977	Grasslands Soil	MDPGLARRNARLGWLLFGVFCLLLAGTVGVGLLYLAFD*
Ga0164308_110847582	3300012985	Soil	MDPELARRNVRLGWMLFGGFALIFAGSIGDALLYLHYQ*
Ga0164305_114228782	3300012989	Soil	MDPALARKNVRLGLLLFGVFLLLFAGTFVVGLLYLHFD*
Ga0157370_102683732	3300013104	Corn Rhizosphere	MDPELARRNVRFGLMLLGVFVLLFAGCFAIALLYLHFD*
Ga0120158_100200044	3300013772	Permafrost	MDPGLARRNVRLGWMLFGVFCLLFAGTFGVALLYLAFD*
Ga0120158_100835803	3300013772	Permafrost	MDRELARKNVRLGWLLFGIFLLLFAGTFGVALLYLAFD*
Ga0120158_101302872	3300013772	Permafrost	MDPDLARRNVRLGWVLVGVFLLLFAGTFGVALLYLAFD*
Ga0182008_106162632	3300014497	Rhizosphere	MDPALARKNVRLGWLLFGVFLLLFAGTFVVGLLYLHFD*
Ga0182008_107493951	3300014497	Rhizosphere	PELARKNLRLGWLLFAVFLVLFAGTWGVALLYLHFD*
Ga0120104_10069652	3300014829	Permafrost	MDPDLARRNARLGWLLFGVFLLLFAGTFGVALLYLAFD*
Ga0167652_10081602	3300015164	Glacier Forefield Soil	MDPDLALRNVRLGWLLFGVFCLLFVGTFGVALLYLAFD*
Ga0167658_10029828	3300015195	Glacier Forefield Soil	MDPDLARRNVRLGWMLFGVFCVLFAGTFGIALLYLAFD*
Ga0137418_107139501	3300015241	Vadose Zone Soil	RRHGGALMDPDLVRRNARLGSLLFGVFLLLFAGTFGVALLYLAFD*
Ga0137418_111389072	3300015241	Vadose Zone Soil	MDPDLARRNVRLGWLLFGVFCLLFAGTFGIALLYLAFD*
Ga0137412_101659652	3300015242	Vadose Zone Soil	MGPDLARRNARLGWLLFGVFLLLFAGTWGVALLYTAFD*
Ga0134073_104260632	3300015356	Grasslands Soil	MGAELARRNNRLGWLLFGVFLLLFAGTWGIAFLYLHFD*
Ga0132258_103972153	3300015371	Arabidopsis Rhizosphere	MDPALARKNVRLGWLLFGVFLLLFAGTFVVGLLYLQFD*
Ga0132257_1017234102	3300015373	Arabidopsis Rhizosphere	MDPELGRKNTRFGLALFALFLLLFAACIGIAFLYLHFD*
Ga0187785_100689052	3300017947	Tropical Peatland	MDRDLARRNNRLGWLLFGVFLLLFAGTFAIAFLYLHFD
Ga0187779_100729752	3300017959	Tropical Peatland	MDPDLARRNNRLGWLLFGVFLLLFAGTFAIAFLYLHFD
Ga0187778_101687132	3300017961	Tropical Peatland	MDPEIARRNVRLGWLLFGVFCLLFAGSVGVALLYLHYS
Ga0187780_103691952	3300017973	Tropical Peatland	MDRDLARRNNRLGWFLFGVFLLLFAGTFAIAFLYLHFD
Ga0187777_105580272	3300017974	Tropical Peatland	SAAAIAAGDVELARRNARFGWLLFAIFLLLFAGCIGIAFLYLHFS
Ga0187767_100455311	3300017999	Tropical Peatland	PRPGALMDPEIARRNVRLGWLLFGVFCLLFAGSVGVALLYLHYS
Ga0184618_100056012	3300018071	Groundwater Sediment	MDPDLARRNVRLGWLLFGVFLLLFAGTFGVALLYLAFD
Ga0187774_101179352	3300018089	Tropical Peatland	MDRELARKNARLGWLLFALFWFLFAGTFVIAYLYLAFD
Ga0187774_108077342	3300018089	Tropical Peatland	VNNDLARRNLRLAWALFGLFWLIFAGTAVVAILYVQLS
Ga0066667_117308621	3300018433	Grasslands Soil	LMDPELARRNVRLGLLLFGLFVLLFTGTIGIAFLYLHFQ
Ga0066662_102864512	3300018468	Grasslands Soil	MDQELARRNNRLGWLLFGVFLVLLAGTVGVALLYLHFD
Ga0066662_127763651	3300018468	Grasslands Soil	MDPELARKNVRLGLLLWAIFLLLFAGCIGVAFLYLHFS
Ga0193751_12257272	3300019888	Soil	MDPELVRRNVRLGWLLFGVFLLLFAGTFGVALLYLAFD
Ga0206356_113555692	3300020070	Corn, Switchgrass And Miscanthus Rhizosphere	MDAELARKNNRLGWLLFAIFLLLFAGTWGIAFLYLHFD
Ga0206354_100949642	3300020081	Corn, Switchgrass And Miscanthus Rhizosphere	DPELARKNTRLGWLLFAFFWLAFGATWAVAYLYLHFD
Ga0206353_101374063	3300020082	Corn, Switchgrass And Miscanthus Rhizosphere	LTDSELARKNNRLGWLLFAIFLLLFAGTWGIAFLYLHFD
Ga0193719_102248332	3300021344	Soil	MGPDLARRNARLGWLLFGVFLVLFAGTWGVALLYTAFD
Ga0193695_10902242	3300021418	Soil	MDPELVRRNVRLGWLLFGVFFLLFAGTFGVALLYLAFD
Ga0179591_11540772	3300024347	Vadose Zone Soil	MGPDLARRNARLGWLLFGVFLLLFAGTWGVALLYTAFD
Ga0210120_10690902	3300025556	Natural And Restored Wetlands	MDTGLARRNTRLGWLLFALFWVFFAGTIGVAFLYLAFD
Ga0208849_10898302	3300025664	Arctic Peat Soil	MDDDLNRRNLRLGWLLFGVFWLLFAGCFGVAFLYLHFS
Ga0207705_107911312	3300025909	Corn Rhizosphere	MNPELARKNARLGWLLFAVFLLLFAGSWGIAFLYLHFD
Ga0207705_111472262	3300025909	Corn Rhizosphere	MNTELARKNARLGWLLFGLFLVLFAGTWGVALLYLHFD
Ga0207684_117478842	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	ELARRNVRLGWLLFAVYVVLFAGTIGVALLYLAFD
Ga0207707_105165382	3300025912	Corn Rhizosphere	MDPALARKNVRLGLLLFGVFLLLFAGTFVVGLLYLHFD
Ga0207707_111662582	3300025912	Corn Rhizosphere	MDPALARRNTRLGWLLFGLFLLVFAGTFGVALLYLAFD
Ga0210077_10147423	3300025952	Natural And Restored Wetlands	VDPNLARRNARLGWLLFALFWVFFAGTIGVAFLYLAFD
Ga0210077_10349162	3300025952	Natural And Restored Wetlands	VTMVDHELARKNVRLGWMLFGVFLLIFAGTIGVAILYLHFQ
Ga0208141_10172082	3300025988	Rice Paddy Soil	MDPDLARRNTRLGWLLFALFWVFFAGTIGVAILYLAFD
Ga0208142_10383102	3300025994	Rice Paddy Soil	MDPELARRNVRLGLMLFGVFVLLFAGCVGIALLYLHFQ
Ga0208529_10079712	3300026008	Rice Paddy Soil	MDPDLARRNVRLGWLLFGLFVVLFGGTFAVAFIYLAFD
Ga0208529_10193432	3300026008	Rice Paddy Soil	MGQELARRNVRLGWMLFGVFLLLFAGTIGVALLYLHFQ
Ga0208531_10201071	3300026020	Rice Paddy Soil	MDPDLARRNVRLGWLLFGLFVVLFGGTFAVAFIYLAF
Ga0209804_12473581	3300026335	Soil	MDPGLSSRNARLGWLLFGAFVLLFAGTFGVALLYLAF
Ga0209808_11973262	3300026523	Soil	MNENDLARSNLRLGWLLFGVFLLLFAGTIGIALLYLHFQ
Ga0209474_103348502	3300026550	Soil	MDPELARRNVRLGLLLFGLFVLLFTGTIGIAFLYLHFQ
Ga0207506_10043032	3300027460	Soil	MDPELARQNATLGWLLVAGVLLVFAGCIGVAFLYLHFK
Ga0209735_11422952	3300027562	Forest Soil	MGPDLVRRNARLGWLLFGVFLLLFAGTFGVALLYLAFD
Ga0209581_10135542	3300027706	Surface Soil	MDRELAQRNVRLGWLLFGVFWLLFGGTIGIAVLYLHFQ
Ga0209074_102262912	3300027787	Agricultural Soil	MDTELARRNARLGWLLFGIFIVLFAGTFLVGWLYLTFD
Ga0209579_10000019302	3300027869	Surface Soil	MNPELARKNARLGWLLFGVFLLLFAGCIGIAFLYLHFS
Ga0209579_104200952	3300027869	Surface Soil	MDPGLARRNTRLGWMLFGVFILIFAGTIGVALLYLHFQ
Ga0209590_106446832	3300027882	Vadose Zone Soil	MDQDLARRNVRLGWLLFGVFLVLFAGTWGVALLYTAFD
Ga0209415_100618643	3300027905	Peatlands Soil	VTPMDDDLARRNARLGWLLFGVFAVLFAGSFGVAFLYLHFS
Ga0209526_107082221	3300028047	Forest Soil	MDPDLARRNVRLGWLLFGVFCVLFAGTFGIALLYLAFD
Ga0137415_111296562	3300028536	Vadose Zone Soil	MDPDLVRRNARLGWLLFGVFLVLFAGTFGVALLYLAFD
Ga0265326_100252482	3300028558	Rhizosphere	MDPEIARKNVRLGWFLFAVFWILFAGSFGIAFLYLHFS
Ga0307296_103351702	3300028819	Soil	MDTDLARRNVRLGWLLFGVFLLLFVGTFGVALLYLAFD
Ga0265330_102098831	3300031235	Rhizosphere	GPRPRAVMPMDDNLARRNARLGWLLFGVFLLLFAGSFGVAFLYLHFS
Ga0265340_104370132	3300031247	Rhizosphere	DPDLARKNVRLGWFLFAVFWILFAGCFGIAFLYLHFS
Ga0265339_101145132	3300031249	Rhizosphere	RAVMPMDDNLARRNARLGWLLFGIFVLLFAGSFGVAFLYLHFS
Ga0318516_105379802	3300031543	Soil	MDPELARKNVRLGWLLFAVFVLLFVGCFGIALLYLHFQ
Ga0308174_112585392	3300031939	Soil	MDPDLAKKNVRLGWLLFLVFVVLFAGSWGVALLYLHFD
Ga0308176_118845392	3300031996	Soil	MDPELARRNVRLGLMLFGVFILLFAGCVGIALLYLHFK
Ga0308173_112276362	3300032074	Soil	MDPDLAKKNVRLGWLLFLVFVVLFAGTWGVALLYLHFD
Ga0335085_100509445	3300032770	Soil	MDHDLARRNNRLGWLLFGVFLLLFAGTFAIAFLYLHFD
Ga0335080_110838662	3300032828	Soil	ELARRNVRLGWLLFGLFLLIFAGCIGIALLYLHFQ
Ga0335070_105314632	3300032829	Soil	MDSELARRNARLGWLLFGVFCLLFAGSIGVAVHSPAFA
Ga0335069_100381294	3300032893	Soil	MDPDLARRNARLAWLLFAAFWLIFAGSIGVAFLYLHFD
Ga0335069_118391782	3300032893	Soil	VDPELARKNAQLGWFLFALFLLLFAGCIGIAFLYLHFQ
Ga0335083_101148232	3300032954	Soil	MDRDLARRNNRLGWLLFGVFLLLFAGTFAIALLYLHFD
Ga0334722_100912132	3300033233	Sediment	MAPELARKNLRLGWLLFGVFLVLFAGTFVVGLLYLQFD
Ga0314867_007031_1131_1247	3300033808	Peatland	MDPELTRRNARLGWLLFAVFCLLFAGSIGVAFIYLAFN
Ga0372943_0844675_53_169	3300034268	Soil	MDPDLARRNVRLGWLLFGVFCLLFAGTFGVALLYLAFD