NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049808

Metagenome / Metatranscriptome Family F049808

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049808
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 43 residues
Representative Sequence MATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWEEMERDE
Number of Associated Samples 129
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.32 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.15 %
Associated GOLD sequencing projects 127
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(19.178 % of family members)
Environment Ontology (ENVO) Unclassified
(25.342 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.096 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.03%    β-sheet: 2.74%    Coil/Unstructured: 71.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF00676E1_dh 87.67
PF07992Pyr_redox_2 4.11
PF02852Pyr_redox_dim 4.11
PF12228DUF3604 0.68
PF00196GerE 0.68
PF05199GMC_oxred_C 0.68
PF08669GCV_T_C 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG05672-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymesEnergy production and conversion [C] 87.67
COG1071TPP-dependent pyruvate or acetoin dehydrogenase subunit alphaEnergy production and conversion [C] 87.67
COG2303Choline dehydrogenase or related flavoproteinLipid transport and metabolism [I] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003998|Ga0055472_10118140All Organisms → cellular organisms → Bacteria761Open in IMG/M
3300004058|Ga0055498_10018037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1017Open in IMG/M
3300004114|Ga0062593_100740178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium967Open in IMG/M
3300004153|Ga0063455_100650696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium698Open in IMG/M
3300005093|Ga0062594_100151285All Organisms → cellular organisms → Bacteria1521Open in IMG/M
3300005093|Ga0062594_101579664All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300005163|Ga0066823_10158883All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300005164|Ga0066815_10062302All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005171|Ga0066677_10428629All Organisms → cellular organisms → Bacteria756Open in IMG/M
3300005174|Ga0066680_10413241All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300005205|Ga0068999_10132829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300005455|Ga0070663_100853096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium784Open in IMG/M
3300005457|Ga0070662_101397270All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005468|Ga0070707_100854579All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300005471|Ga0070698_100770465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium906Open in IMG/M
3300005471|Ga0070698_101661506All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005518|Ga0070699_100683022All Organisms → cellular organisms → Bacteria938Open in IMG/M
3300005518|Ga0070699_101762727All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005526|Ga0073909_10297273All Organisms → cellular organisms → Bacteria733Open in IMG/M
3300005544|Ga0070686_101288859All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300005545|Ga0070695_100075903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2213Open in IMG/M
3300005549|Ga0070704_100007358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6553Open in IMG/M
3300005561|Ga0066699_10655061All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300005615|Ga0070702_100507112All Organisms → cellular organisms → Bacteria887Open in IMG/M
3300005718|Ga0068866_10771426All Organisms → cellular organisms → Bacteria666Open in IMG/M
3300005719|Ga0068861_101768569All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium612Open in IMG/M
3300005719|Ga0068861_101902969All Organisms → cellular organisms → Bacteria592Open in IMG/M
3300005841|Ga0068863_102499590All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300006028|Ga0070717_11467545All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300006046|Ga0066652_100631795All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300006046|Ga0066652_101169136All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300006046|Ga0066652_101328159All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300006058|Ga0075432_10022587All Organisms → cellular organisms → Bacteria2152Open in IMG/M
3300006175|Ga0070712_100748712All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300006573|Ga0074055_11290595All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300006579|Ga0074054_12083657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium962Open in IMG/M
3300006580|Ga0074049_12885625All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300006603|Ga0074064_11463784All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1033Open in IMG/M
3300006846|Ga0075430_100605615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium904Open in IMG/M
3300006894|Ga0079215_10077844All Organisms → cellular organisms → Bacteria1388Open in IMG/M
3300006894|Ga0079215_10730956All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300006894|Ga0079215_11450312All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300006914|Ga0075436_100601540All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300009012|Ga0066710_104595618All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300009012|Ga0066710_104682115All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300009098|Ga0105245_11866702All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300009111|Ga0115026_11636379All Organisms → cellular organisms → Bacteria540Open in IMG/M
3300009137|Ga0066709_103501882All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300009171|Ga0105101_10404404All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300009553|Ga0105249_10455614All Organisms → cellular organisms → Bacteria1318Open in IMG/M
3300009817|Ga0105062_1032272All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300009817|Ga0105062_1053553All Organisms → cellular organisms → Bacteria743Open in IMG/M
3300009818|Ga0105072_1006288All Organisms → cellular organisms → Bacteria2025Open in IMG/M
3300010321|Ga0134067_10439496All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium530Open in IMG/M
3300010373|Ga0134128_11348174All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300011107|Ga0151490_1146888All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300011429|Ga0137455_1178880All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300012200|Ga0137382_10979163All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium608Open in IMG/M
3300012208|Ga0137376_10348026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1287Open in IMG/M
3300012349|Ga0137387_10485156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium897Open in IMG/M
3300012359|Ga0137385_11557810All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300012403|Ga0134049_1255649All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300012893|Ga0157284_10305390All Organisms → cellular organisms → Bacteria523Open in IMG/M
3300012897|Ga0157285_10081404All Organisms → cellular organisms → Bacteria856Open in IMG/M
3300012908|Ga0157286_10071039All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium952Open in IMG/M
3300012948|Ga0126375_11324458All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300012958|Ga0164299_11469922All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium530Open in IMG/M
3300012958|Ga0164299_11541537All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300012960|Ga0164301_11328474All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300014268|Ga0075309_1086833All Organisms → cellular organisms → Bacteria750Open in IMG/M
3300014295|Ga0075305_1044832All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300014299|Ga0075303_1004111All Organisms → cellular organisms → Bacteria1673Open in IMG/M
3300014318|Ga0075351_1113330All Organisms → cellular organisms → Bacteria601Open in IMG/M
3300015358|Ga0134089_10538812All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300015359|Ga0134085_10089603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1269Open in IMG/M
3300017792|Ga0163161_10767504All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300018028|Ga0184608_10516238All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300018031|Ga0184634_10253198All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300018031|Ga0184634_10273082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium776Open in IMG/M
3300018074|Ga0184640_10008168All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3653Open in IMG/M
3300018077|Ga0184633_10095360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1535Open in IMG/M
3300018081|Ga0184625_10042145All Organisms → cellular organisms → Bacteria2270Open in IMG/M
3300018082|Ga0184639_10352494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium767Open in IMG/M
3300018469|Ga0190270_12465415All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300018482|Ga0066669_12367798All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium508Open in IMG/M
3300019259|Ga0184646_1346371All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300019356|Ga0173481_10114761All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1058Open in IMG/M
3300019361|Ga0173482_10194473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium826Open in IMG/M
3300019361|Ga0173482_10591411All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300019362|Ga0173479_10526586All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300019377|Ga0190264_10215002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1076Open in IMG/M
3300019377|Ga0190264_11414568All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300019458|Ga0187892_10097492All Organisms → cellular organisms → Bacteria1769Open in IMG/M
3300021081|Ga0210379_10242154All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium782Open in IMG/M
3300021951|Ga0222624_1516550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium857Open in IMG/M
3300021972|Ga0193737_1008904All Organisms → cellular organisms → Bacteria1358Open in IMG/M
3300025119|Ga0209126_1150706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300025155|Ga0209320_10361702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium591Open in IMG/M
3300025310|Ga0209172_10488403All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300025312|Ga0209321_10515800All Organisms → cellular organisms → Bacteria535Open in IMG/M
3300025326|Ga0209342_10264385All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300025580|Ga0210138_1124767All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300025908|Ga0207643_10514304All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300025973|Ga0210145_1036126All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300025981|Ga0207640_11690518All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300026075|Ga0207708_10100596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2237Open in IMG/M
3300026315|Ga0209686_1233352All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300027277|Ga0209846_1011902All Organisms → cellular organisms → Bacteria1473Open in IMG/M
3300027523|Ga0208890_1023220All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300027722|Ga0209819_10201125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium694Open in IMG/M
3300028379|Ga0268266_11752287All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300028589|Ga0247818_11339930All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300028592|Ga0247822_10121364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1901Open in IMG/M
3300028597|Ga0247820_10914263All Organisms → cellular organisms → Bacteria622Open in IMG/M
3300028704|Ga0307321_1022835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1108Open in IMG/M
3300028707|Ga0307291_1080421All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300028711|Ga0307293_10207416All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300028722|Ga0307319_10069856All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300028755|Ga0307316_10011521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2744Open in IMG/M
3300028784|Ga0307282_10557708All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300028793|Ga0307299_10181646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium791Open in IMG/M
3300028819|Ga0307296_10369925All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300028819|Ga0307296_10387064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium764Open in IMG/M
3300028828|Ga0307312_11066767All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300028876|Ga0307286_10004028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4360Open in IMG/M
3300028878|Ga0307278_10219562All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300028878|Ga0307278_10288085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium727Open in IMG/M
3300030114|Ga0311333_11109538All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300031199|Ga0307495_10253201All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031547|Ga0310887_11111479All Organisms → cellular organisms → Bacteria508Open in IMG/M
3300031834|Ga0315290_10314292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1372Open in IMG/M
3300031858|Ga0310892_10518013All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300031944|Ga0310884_11086628All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300031949|Ga0214473_10742991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1065Open in IMG/M
3300032164|Ga0315283_11421626All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300032177|Ga0315276_10898878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium945Open in IMG/M
3300033004|Ga0335084_12258283All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300033407|Ga0214472_11625829All Organisms → cellular organisms → Bacteria549Open in IMG/M
3300033416|Ga0316622_100129153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2595Open in IMG/M
3300033417|Ga0214471_11003840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300033417|Ga0214471_11274002All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300033434|Ga0316613_11158585All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300033502|Ga0326731_1133050All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300033551|Ga0247830_11308594All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300033813|Ga0364928_0175887All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300033815|Ga0364946_064281All Organisms → cellular organisms → Bacteria779Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil19.18%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.53%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.79%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.42%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil2.74%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil2.74%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.74%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.74%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.05%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.05%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.05%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.05%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.05%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.05%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.37%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.37%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.37%
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland0.68%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.68%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.68%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.68%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.68%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.68%
Bio-OozeEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze0.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004058Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005163Soil and rhizosphere microbial communities from Laval, Canada - mgHMBEnvironmentalOpen in IMG/M
3300005164Soil and rhizosphere microbial communities from Laval, Canada - mgLACEnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005205Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2EnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005457Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaGHost-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009111Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009171Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009818Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300011107Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012403Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300014268Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1EnvironmentalOpen in IMG/M
3300014295Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1EnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300015358Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019259Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019458Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaGEnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021972Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2EnvironmentalOpen in IMG/M
3300025119Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025326Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025580Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025973Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026315Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes)EnvironmentalOpen in IMG/M
3300027277Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027523Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes)EnvironmentalOpen in IMG/M
3300027722Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028589Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1EnvironmentalOpen in IMG/M
3300028592Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033407Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175EnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033434Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_bEnvironmentalOpen in IMG/M
3300033502Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fractionEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033813Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17EnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0055472_1011814023300003998Natural And Restored WetlandsMATTQVDAGAAGHGAEPRGKRSEDGQATYLIAIAEALWEEMERD
Ga0055498_1001803723300004058Natural And Restored WetlandsMATAQVEAGAAGHGAEPRGKRSEDGQATYLVAIAEALWEEMERDERV
Ga0062593_10074017823300004114SoilMATTQVEAGAAGHGAEPRGKRTEAGEATYLIAVAEALWEEMERDER
Ga0063455_10065069623300004153SoilMATKTLEAGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDERV
Ga0062594_10015128513300005093SoilMATRVVEAGAAGHGAEPRGKRSENGDATYLVAIAEALWEEMERD
Ga0062594_10157966423300005093SoilMASTTVESGAAGHGAEPRGKRSEDGQATYLIAVAEALWEEMERDERVIMLGE
Ga0066823_1015888313300005163SoilMATKQVDAGAAGHGAEPRGKRGDDGQATYLIAIAEALWEEMERDERVYM
Ga0066815_1006230213300005164SoilMSAQTVESGAAGHGAEPRGKRDDDGQATYLIAIAEALWEEMERDERVY
Ga0066677_1042862923300005171SoilMASATPTVDSAAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERD
Ga0066680_1041324113300005174SoilMAQAQQVEPAASGHGAEPRGKRTDAGEATYLIAIAEALWEEM
Ga0068999_1013282923300005205Natural And Restored WetlandsMATKAVEAGAAGHGAEPRGKRTDAGEATYLIAIAEALWEEMERDE
Ga0070663_10085309623300005455Corn RhizosphereMATMQADAGAAGHGAEPRGKRSDDGQATYLIAIAEALWEEMERD
Ga0070662_10139727023300005457Corn RhizosphereMATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAEALWEEME
Ga0070707_10085457923300005468Corn, Switchgrass And Miscanthus RhizosphereMTTATVESGAAGHGAEPRGKRTESGEATYLVAIAEALWEEMERDERV
Ga0070698_10077046523300005471Corn, Switchgrass And Miscanthus RhizosphereMATRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMERDE
Ga0070698_10166150623300005471Corn, Switchgrass And Miscanthus RhizosphereMATTQADAGAAGHGAEPRGKRSDDGQATYLVAIAEALWEEMERDERVFM
Ga0070699_10068302213300005518Corn, Switchgrass And Miscanthus RhizosphereMATKQVESGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDERVY
Ga0070699_10176272723300005518Corn, Switchgrass And Miscanthus RhizosphereMATQEKAAQVEAGAAGHGAEPRGKRSEAGEATYLIAIAEALWEEMERDERVYML
Ga0073909_1029727313300005526Surface SoilMATKQVDAGAAGHGAEPRGKRGDDGQATYLIAIAEALWEEMERD
Ga0070686_10128885923300005544Switchgrass RhizosphereMATMQADAGAAGHGAEPRGKRSDDGQATYLIAIAEALWEEME
Ga0070695_10007590313300005545Corn, Switchgrass And Miscanthus RhizosphereMATQQVETGAAGHGAEPRGKRSDDGQATYLIAVAEALWEEMERDER
Ga0070704_10000735813300005549Corn, Switchgrass And Miscanthus RhizosphereMATQQVETGAAGHGAEPRGKRSDDGQATYLIAVAEALWEEMERDERVFM
Ga0066699_1065506113300005561SoilMASATPTVDSAAAGHGAEPRGKRTEAGEATYLIAIAEALWEEM
Ga0070702_10050711223300005615Corn, Switchgrass And Miscanthus RhizosphereMAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERD
Ga0068866_1077142623300005718Miscanthus RhizosphereMATKQVDSGAAGHGAEPRGKRSDDGQATYLIAIAEALWEEMERD
Ga0068861_10176856913300005719Switchgrass RhizosphereMATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALW
Ga0068861_10190296923300005719Switchgrass RhizosphereMASTTVESGAAGHGAEPRGKRSEDGQATYLIAVAE
Ga0068863_10249959023300005841Switchgrass RhizosphereMATTQADAGAAGHGAEPRGKRSDDGQATYLIAIAEALWEEMERDE
Ga0070717_1146754513300006028Corn, Switchgrass And Miscanthus RhizosphereMTASTVESGAAGHGAEPRGKRTEQGEATYLVAIAEALW
Ga0066652_10063179513300006046SoilMASTTVESAAAGHGAEPRGKRTDAGEATYLIAIAEALWEEMERDGNVF
Ga0066652_10116913623300006046SoilMATTQVEAGAAGHGAEPRGKRTEAGEATYLIAVAEALWEEMERDERV
Ga0066652_10132815913300006046SoilVSVPAKNVESGAAGHGNEPRGKRGAGGEATYLIAIAEALWEEMERDGN
Ga0075432_1002258713300006058Populus RhizosphereVTAPQAPTEAGAAGHGAEPRGKRTEDGQATYLIAIAE
Ga0070712_10074871213300006175Corn, Switchgrass And Miscanthus RhizosphereMTASTVESGAAGHGAEPRGKRTEQGEATYLVAIAEALWEEMER
Ga0074055_1129059523300006573SoilMMATQQVEAGAAGHGAEPRGKRAEDGQATYLIAVAEA
Ga0074054_1208365723300006579SoilMATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWE
Ga0074049_1288562523300006580SoilMSAQTVESGAAGHGAEPRGKRDDDGQATYLIAIAE
Ga0074064_1146378423300006603SoilMATKQVDAGAAGHGAEPRGKRGDDGQATYLIAIAEALW
Ga0075430_10060561513300006846Populus RhizosphereMATTTVESGAAGHGAEPRGKRTEQGEATYLIAIAEALWE
Ga0079215_1007784413300006894Agricultural SoilMATKTVQAGAAGHGAEPRGKRSENGEATYLVAIAEA
Ga0079215_1073095623300006894Agricultural SoilMATAQVKAGAAGHGAEPRGKRSDDGQATYLIAIAEALWEEMERDERVYMLG
Ga0079215_1145031213300006894Agricultural SoilMAEATTLEAGAAGHGAEPRGKRTEDGQATYLVAIAEALW
Ga0075436_10060154013300006914Populus RhizosphereMTASTVESGAAGHGAEPRGKRTEQGEATYLIAIAEALWEEMERDERVF
Ga0066710_10459561823300009012Grasslands SoilMATRVEAGAAGHGAEPRGKRSESGEATYLIAIAEALWEEMERDD
Ga0066710_10468211523300009012Grasslands SoilMATAQVESGAAGHGAEPRGRRTEEGEATYLIAIAEALW
Ga0105245_1186670213300009098Miscanthus RhizosphereMATQQVETGAAGHGAEPRGKRSDDGQATYLIAVAEALWEE
Ga0115026_1163637923300009111WetlandMAAKTLEAGAAGHGAEPRGKRSEAGEATYLVAIAEALWEEMERD
Ga0066709_10350188223300009137Grasslands SoilMATAQVEAGAAGHGAEPRGKRTEDGQATYLIAIAEAMWEEME
Ga0105101_1040440423300009171Freshwater SedimentMAAKTLEAGAAGHGAEPRGKRSDAGEATYLIAIAEALWEEMERD
Ga0105249_1045561433300009553Switchgrass RhizosphereMATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAEAL
Ga0105062_103227213300009817Groundwater SandMATAQVESGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEME
Ga0105062_105355323300009817Groundwater SandMATAQVESGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDER
Ga0105072_100628813300009818Groundwater SandMATRAVEPSAAGHGAEPRGKRTDQGEATYLVAIAEALWEEME
Ga0134067_1043949623300010321Grasslands SoilMATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWEEMERDE
Ga0134128_1134817423300010373Terrestrial SoilMASTTVESGAAGHGAEPRGKRSEDGQATYLIAVAEALWEEMERDERVIMLGED
Ga0151490_114688823300011107SoilMAQKVEAAAAGHGAEPRGKRTDDGQATYLIAIAEALW
Ga0137455_117888023300011429SoilMATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAEALWE
Ga0137382_1097916313300012200Vadose Zone SoilMAAQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEA
Ga0137376_1034802623300012208Vadose Zone SoilMATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWEEMERDERVFMLG
Ga0137387_1048515613300012349Vadose Zone SoilMATQQVEAAAAGHGAEPRGKRGEDGQATYLIAIAE
Ga0137385_1155781023300012359Vadose Zone SoilMATAQVEAGAAGHGAEPRGKRTEDGQATYLIAIAEAMWEE
Ga0134049_125564923300012403Grasslands SoilMASTQVEAGAAGHGAEPRGNRAEDGQATYLIAIAEALWEEMERDERLYLLGE
Ga0157284_1030539023300012893SoilMATTQVEAGAAGHGAEPRGKRTEAGEATYLIAVAEALWEEMER
Ga0157285_1008140413300012897SoilMASTTVESGAAGHGAEPRGKRSEDGQATYLIAVAEALWEE
Ga0157286_1007103913300012908SoilMATRTVESGAAGHGAEPRGKRTEQGEATYLVAIAEALWEEMERDERV
Ga0126375_1132445823300012948Tropical Forest SoilMATQQVEAGAAGHGAEPRGKRSEDGQATYLIAVAEALWEEMERDE
Ga0164299_1146992223300012958SoilMATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWEEM
Ga0164299_1154153723300012958SoilMATQQVETGAAGHGAEPRGKRSDDGQATYLIAVAEALWEEMERDERVF
Ga0164301_1132847423300012960SoilMASTTVDTGAAGHGAEPRGKRSEDGQATYLIAVAEALWE
Ga0075309_108683323300014268Natural And Restored WetlandsVAQGTTSPKVDSGAAGHGAEPRGKRSDDGQATYLVAIAEALWE
Ga0075305_104483223300014295Natural And Restored WetlandsMTAQTVEAAAAGHGAEPRGKRTEDGQATYLIAIAEALWEEMERDERVFMLG
Ga0075303_100411113300014299Natural And Restored WetlandsMATQQVEAAAAGHGAEPRGKRSEDGQATYLVAIAEAL
Ga0075351_111333023300014318Natural And Restored WetlandsMATAQVEAGAAGHGAEPRGKRSEDGQATYLVAIAEALWEE
Ga0134089_1053881213300015358Grasslands SoilMATQQVEAGAAGHGSEPRGKRSEDGQATYLIAIAEALWEEMER
Ga0134085_1008960313300015359Grasslands SoilMATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWEEMERDERVFM
Ga0163161_1076750413300017792Switchgrass RhizosphereMAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERDE
Ga0184608_1051623813300018028Groundwater SedimentMVTRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEEME
Ga0184634_1025319823300018031Groundwater SedimentMATSQVETGAAGHGAEPRGKRTEAGEATYLVAIAEALWEEMERD
Ga0184634_1027308223300018031Groundwater SedimentMATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMERD
Ga0184640_1000816813300018074Groundwater SedimentMATAQVESGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDERVYL
Ga0184633_1009536013300018077Groundwater SedimentMATSQVETGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERD
Ga0184625_1004214513300018081Groundwater SedimentMATRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEG
Ga0184639_1035249413300018082Groundwater SedimentMATSQVETGAAGHGAEPRGKRTEAGEATYLVAIAEALWEEME
Ga0190270_1246541523300018469SoilMARRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEGLWEE
Ga0066669_1236779823300018482Grasslands SoilMATQQVEAGAAGHGAEPRGKRSEDGQATYLIAIAE
Ga0184646_134637113300019259Groundwater SedimentMATRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEGLWEEM
Ga0173481_1011476123300019356SoilMATQQVEAAAAGHGAEPRGKRSDDGQATYLIAIAEALWEEMERDERVFM
Ga0173482_1019447313300019361SoilMATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEA
Ga0173482_1059141123300019361SoilMAKTAQVEGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERDERVYLLG
Ga0173479_1052658613300019362SoilMASTTVESGAAGHGAEPRGKRSEDGQATYLIAVAEALWEEMERDER
Ga0190264_1021500223300019377SoilMATTVKLEAGAAGHGAEPRGKRGDDGQATYLIAIAEALW
Ga0190264_1141456813300019377SoilVAQKVETGAAGHGAEPRGKRSDDGQATYLVAIAEALWEEMERDDRVYMLG
Ga0187892_1009749213300019458Bio-OozeMATSTVETGAAGHGAEPRGKRSATGEATYLIAIAEALWEEMERDE
Ga0210379_1024215413300021081Groundwater SedimentMVTRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMERDERVFLL
Ga0222624_151655013300021951Groundwater SedimentMATRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMER
Ga0193737_100890413300021972SoilMATRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMERDERVFLL
Ga0209126_115070613300025119SoilMATRTVEAGAAGHGAEPRGKRSEKGEATYLVAIAEALWEEMERDE
Ga0209320_1036170213300025155SoilMATRTLHAGAAGHGAEPRGKRTDAGEATYLIAIAEALWEEMERDERVF
Ga0209172_1048840313300025310Hot Spring SedimentMATRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEGLWEEMERDERVFLL
Ga0209321_1051580013300025312SoilVSQVVEAGAAGHGAEPRGKRTESGEATYLIAIAEALWEEME
Ga0209342_1026438513300025326SoilMATRTVEAGAAGHGAEPRGKRSEKGEATYLVAIAEALWEEMERDER
Ga0210138_112476713300025580Natural And Restored WetlandsMATQQVEAAAAGHGAEPRGKRSEDGQATYLVAIAEALWEEMERDDRVFML
Ga0207643_1051430423300025908Miscanthus RhizosphereMAKTAQVEGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMER
Ga0210145_103612623300025973Natural And Restored WetlandsMATPQVDAAAAGHGAEPRGKRSDDGQATYLVAIAEALWEEMERD
Ga0207640_1169051823300025981Corn RhizosphereMASTTIESGAAGHGAEPRGKRSEDGQATYLIAVAEA
Ga0207708_1010059633300026075Corn, Switchgrass And Miscanthus RhizosphereMATQQVETGAAGHGAEPRGKRSDDGQATYLIAVAEAL
Ga0209686_123335213300026315SoilMASATPTVDSAAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDGN
Ga0209846_101190233300027277Groundwater SandMATRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEA
Ga0208890_102322013300027523SoilMATKQVDSGAAGHGAEPRGKRGDDGQATYLIAIAEALWEEMERDER
Ga0209819_1020112523300027722Freshwater SedimentMATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAE
Ga0268266_1175228723300028379Switchgrass RhizosphereVASSTTVEAGAAGHGAEPRGKRTDDGQATYLIAVA
Ga0247818_1133993013300028589SoilMAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERDERVY
Ga0247822_1012136433300028592SoilMATTAKVEAGAAGHGAEPRGKRGDDGQATYLIAIAEALWEEMERDERVY
Ga0247820_1091426313300028597SoilMATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMEQ
Ga0307321_102283523300028704SoilMAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGL
Ga0307291_108042113300028707SoilMAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERDERVYLLGE
Ga0307293_1020741613300028711SoilMATRTVEASAAGHGAEPRGKRTDQGEATYLVAIAEALWE
Ga0307319_1006985613300028722SoilMAQAAPQVEAGAAGHGNEPRGKRTDAGEATYLIAVAEALWEEM
Ga0307316_1001152143300028755SoilMMATQQVEAAAAGHGAEPRGKRSEDGQATYLVAIAEALWEEMERDER
Ga0307282_1055770813300028784SoilMATAQVEAGAAGHGAEPRGKRTEDGQATYLIAIAEA
Ga0307299_1018164623300028793SoilMATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEAL
Ga0307296_1036992513300028819SoilMAQASPQVEAGAAGHGNEPRGKRTDAGEATYLIAIAE
Ga0307296_1038706423300028819SoilMATKTLEAGAAGHGAEPRGKRTDAGEATYLIAIAEALWE
Ga0307312_1106676713300028828SoilMATRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEE
Ga0307286_1000402813300028876SoilMAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERDERV
Ga0307278_1021956223300028878SoilMATAKVEAGAAGHGAEPRGKRTDAGEATYLIAIAEALWEEMERDERVYMLG
Ga0307278_1028808513300028878SoilMATKTLEAGAAGHGAEPRGKRTDAGEATYLIAIAEALWEEME
Ga0311333_1110953823300030114FenMTATQQVEAGAAGHGAEPRGKRTEDGQATYLIAIAEALWEEME
Ga0307495_1025320123300031199SoilMATTQVEAGAAGHGAEPRGKRTEAGEATYLIAVAEALWEEMERDERVYL
Ga0310887_1111147923300031547SoilMATQQVEAAAAGHGAEPRGKRSEDGQATYLVAIAEALWEEMERD
Ga0315290_1031429233300031834SedimentMAGAAQKVEGAAAGHGAEPRGKRSDEGEATYLIAIAEALW
Ga0310892_1051801323300031858SoilVTAPQAPTEAGAAGHGAEPRGKRTEDGQATYLIAIAEGLWEEMERDE
Ga0310884_1108662823300031944SoilVTAPQAPTEAGAAGHGAEPRGKRTEDGQATYLIAIAEGLWEEME
Ga0214473_1074299113300031949SoilMSATLEAGAAGHGAEPRGKRTEDGQATYLIAIAEALWEEME
Ga0315283_1142162623300032164SedimentMATQQVEAGAAGHGAEPRGKRSEDGQATYLIAIAEAL
Ga0315276_1089887823300032177SedimentMATQQVEAGAAGHGAEPRGKRSEDGQATYLIAIAEALWEEMERDDRVYLLG
Ga0335084_1225828313300033004SoilMTDTSTVESGAAGHGAEPRGKRTEQGEATYLIAIAEALWEEMERDERVF
Ga0214472_1162582913300033407SoilMATRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEGLWE
Ga0316622_10012915333300033416SoilMATKTLEAGAAGHGAEPRGKRTDAGEATYLVAIAEALWEEMERDERVFLL
Ga0214471_1100384013300033417SoilMATKTVEAGAAGHGAEPRGKRSENGEATYLVAIAE
Ga0214471_1127400213300033417SoilMTTRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEGLWEE
Ga0316613_1115858513300033434SoilMATTTLEAGAAGHGAEPRGKRTDAGEATYLIAIAEALWE
Ga0326731_113305013300033502Peat SoilMAQKVEAAAAGHGAEPRGKRTEDGQATYLIAIAEALWEEMERD
Ga0247830_1130859413300033551SoilMAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLW
Ga0364928_0175887_3_1433300033813SedimentMATRAVEAGAAGHGAEPRGKRTKQGEATYLVAIAEGLWEEMERDERV
Ga0364946_064281_2_1513300033815SedimentMATAQVESGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDELVYLL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.