| Basic Information | |
|---|---|
| Family ID | F049808 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWEEMERDE |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.32 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 93.15 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.178 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.342 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.096 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.03% β-sheet: 2.74% Coil/Unstructured: 71.23% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF00676 | E1_dh | 87.67 |
| PF07992 | Pyr_redox_2 | 4.11 |
| PF02852 | Pyr_redox_dim | 4.11 |
| PF12228 | DUF3604 | 0.68 |
| PF00196 | GerE | 0.68 |
| PF05199 | GMC_oxred_C | 0.68 |
| PF08669 | GCV_T_C | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0567 | 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes | Energy production and conversion [C] | 87.67 |
| COG1071 | TPP-dependent pyruvate or acetoin dehydrogenase subunit alpha | Energy production and conversion [C] | 87.67 |
| COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003998|Ga0055472_10118140 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300004058|Ga0055498_10018037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1017 | Open in IMG/M |
| 3300004114|Ga0062593_100740178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 967 | Open in IMG/M |
| 3300004153|Ga0063455_100650696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 698 | Open in IMG/M |
| 3300005093|Ga0062594_100151285 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300005093|Ga0062594_101579664 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300005163|Ga0066823_10158883 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005164|Ga0066815_10062302 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005171|Ga0066677_10428629 | All Organisms → cellular organisms → Bacteria | 756 | Open in IMG/M |
| 3300005174|Ga0066680_10413241 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005205|Ga0068999_10132829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 518 | Open in IMG/M |
| 3300005455|Ga0070663_100853096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
| 3300005457|Ga0070662_101397270 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300005468|Ga0070707_100854579 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300005471|Ga0070698_100770465 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 906 | Open in IMG/M |
| 3300005471|Ga0070698_101661506 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005518|Ga0070699_100683022 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300005518|Ga0070699_101762727 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300005526|Ga0073909_10297273 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005544|Ga0070686_101288859 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005545|Ga0070695_100075903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2213 | Open in IMG/M |
| 3300005549|Ga0070704_100007358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6553 | Open in IMG/M |
| 3300005561|Ga0066699_10655061 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300005615|Ga0070702_100507112 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300005718|Ga0068866_10771426 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005719|Ga0068861_101768569 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 612 | Open in IMG/M |
| 3300005719|Ga0068861_101902969 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005841|Ga0068863_102499590 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006028|Ga0070717_11467545 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300006046|Ga0066652_100631795 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300006046|Ga0066652_101169136 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300006046|Ga0066652_101328159 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300006058|Ga0075432_10022587 | All Organisms → cellular organisms → Bacteria | 2152 | Open in IMG/M |
| 3300006175|Ga0070712_100748712 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300006573|Ga0074055_11290595 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300006579|Ga0074054_12083657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 962 | Open in IMG/M |
| 3300006580|Ga0074049_12885625 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300006603|Ga0074064_11463784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1033 | Open in IMG/M |
| 3300006846|Ga0075430_100605615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 904 | Open in IMG/M |
| 3300006894|Ga0079215_10077844 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300006894|Ga0079215_10730956 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300006894|Ga0079215_11450312 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006914|Ga0075436_100601540 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300009012|Ga0066710_104595618 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300009012|Ga0066710_104682115 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009098|Ga0105245_11866702 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300009111|Ga0115026_11636379 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300009137|Ga0066709_103501882 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009171|Ga0105101_10404404 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300009553|Ga0105249_10455614 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300009817|Ga0105062_1032272 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300009817|Ga0105062_1053553 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300009818|Ga0105072_1006288 | All Organisms → cellular organisms → Bacteria | 2025 | Open in IMG/M |
| 3300010321|Ga0134067_10439496 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 530 | Open in IMG/M |
| 3300010373|Ga0134128_11348174 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300011107|Ga0151490_1146888 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300011429|Ga0137455_1178880 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300012200|Ga0137382_10979163 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 608 | Open in IMG/M |
| 3300012208|Ga0137376_10348026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1287 | Open in IMG/M |
| 3300012349|Ga0137387_10485156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 897 | Open in IMG/M |
| 3300012359|Ga0137385_11557810 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012403|Ga0134049_1255649 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012893|Ga0157284_10305390 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300012897|Ga0157285_10081404 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300012908|Ga0157286_10071039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 952 | Open in IMG/M |
| 3300012948|Ga0126375_11324458 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300012958|Ga0164299_11469922 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 530 | Open in IMG/M |
| 3300012958|Ga0164299_11541537 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012960|Ga0164301_11328474 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300014268|Ga0075309_1086833 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300014295|Ga0075305_1044832 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300014299|Ga0075303_1004111 | All Organisms → cellular organisms → Bacteria | 1673 | Open in IMG/M |
| 3300014318|Ga0075351_1113330 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300015358|Ga0134089_10538812 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300015359|Ga0134085_10089603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1269 | Open in IMG/M |
| 3300017792|Ga0163161_10767504 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300018028|Ga0184608_10516238 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
| 3300018031|Ga0184634_10253198 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300018031|Ga0184634_10273082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 776 | Open in IMG/M |
| 3300018074|Ga0184640_10008168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3653 | Open in IMG/M |
| 3300018077|Ga0184633_10095360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1535 | Open in IMG/M |
| 3300018081|Ga0184625_10042145 | All Organisms → cellular organisms → Bacteria | 2270 | Open in IMG/M |
| 3300018082|Ga0184639_10352494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
| 3300018469|Ga0190270_12465415 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300018482|Ga0066669_12367798 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 508 | Open in IMG/M |
| 3300019259|Ga0184646_1346371 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300019356|Ga0173481_10114761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1058 | Open in IMG/M |
| 3300019361|Ga0173482_10194473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 826 | Open in IMG/M |
| 3300019361|Ga0173482_10591411 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300019362|Ga0173479_10526586 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300019377|Ga0190264_10215002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1076 | Open in IMG/M |
| 3300019377|Ga0190264_11414568 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300019458|Ga0187892_10097492 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300021081|Ga0210379_10242154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 782 | Open in IMG/M |
| 3300021951|Ga0222624_1516550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 857 | Open in IMG/M |
| 3300021972|Ga0193737_1008904 | All Organisms → cellular organisms → Bacteria | 1358 | Open in IMG/M |
| 3300025119|Ga0209126_1150706 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 627 | Open in IMG/M |
| 3300025155|Ga0209320_10361702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300025310|Ga0209172_10488403 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300025312|Ga0209321_10515800 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300025326|Ga0209342_10264385 | All Organisms → cellular organisms → Bacteria | 1508 | Open in IMG/M |
| 3300025580|Ga0210138_1124767 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300025908|Ga0207643_10514304 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300025973|Ga0210145_1036126 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025981|Ga0207640_11690518 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026075|Ga0207708_10100596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2237 | Open in IMG/M |
| 3300026315|Ga0209686_1233352 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027277|Ga0209846_1011902 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300027523|Ga0208890_1023220 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300027722|Ga0209819_10201125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
| 3300028379|Ga0268266_11752287 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300028589|Ga0247818_11339930 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300028592|Ga0247822_10121364 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1901 | Open in IMG/M |
| 3300028597|Ga0247820_10914263 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300028704|Ga0307321_1022835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1108 | Open in IMG/M |
| 3300028707|Ga0307291_1080421 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300028711|Ga0307293_10207416 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300028722|Ga0307319_10069856 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300028755|Ga0307316_10011521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2744 | Open in IMG/M |
| 3300028784|Ga0307282_10557708 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300028793|Ga0307299_10181646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 791 | Open in IMG/M |
| 3300028819|Ga0307296_10369925 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300028819|Ga0307296_10387064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
| 3300028828|Ga0307312_11066767 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300028876|Ga0307286_10004028 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4360 | Open in IMG/M |
| 3300028878|Ga0307278_10219562 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300028878|Ga0307278_10288085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 727 | Open in IMG/M |
| 3300030114|Ga0311333_11109538 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300031199|Ga0307495_10253201 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031547|Ga0310887_11111479 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031834|Ga0315290_10314292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1372 | Open in IMG/M |
| 3300031858|Ga0310892_10518013 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300031944|Ga0310884_11086628 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031949|Ga0214473_10742991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1065 | Open in IMG/M |
| 3300032164|Ga0315283_11421626 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300032177|Ga0315276_10898878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
| 3300033004|Ga0335084_12258283 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300033407|Ga0214472_11625829 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300033416|Ga0316622_100129153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2595 | Open in IMG/M |
| 3300033417|Ga0214471_11003840 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 642 | Open in IMG/M |
| 3300033417|Ga0214471_11274002 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300033434|Ga0316613_11158585 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300033502|Ga0326731_1133050 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300033551|Ga0247830_11308594 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300033813|Ga0364928_0175887 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300033815|Ga0364946_064281 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.18% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.85% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.79% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.42% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.74% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.74% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 2.74% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.74% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.05% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.05% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.37% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.37% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.68% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.68% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004058 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005205 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009171 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300011107 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAC (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012403 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014268 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014295 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLB_D1 | Environmental | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019259 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021951 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
| 3300025119 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025312 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4 | Environmental | Open in IMG/M |
| 3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025580 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025973 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300027277 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027523 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA (SPAdes) | Environmental | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028704 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033416 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033434 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_CT_b | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033813 | Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17 | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055472_101181402 | 3300003998 | Natural And Restored Wetlands | MATTQVDAGAAGHGAEPRGKRSEDGQATYLIAIAEALWEEMERD |
| Ga0055498_100180372 | 3300004058 | Natural And Restored Wetlands | MATAQVEAGAAGHGAEPRGKRSEDGQATYLVAIAEALWEEMERDERV |
| Ga0062593_1007401782 | 3300004114 | Soil | MATTQVEAGAAGHGAEPRGKRTEAGEATYLIAVAEALWEEMERDER |
| Ga0063455_1006506962 | 3300004153 | Soil | MATKTLEAGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDERV |
| Ga0062594_1001512851 | 3300005093 | Soil | MATRVVEAGAAGHGAEPRGKRSENGDATYLVAIAEALWEEMERD |
| Ga0062594_1015796642 | 3300005093 | Soil | MASTTVESGAAGHGAEPRGKRSEDGQATYLIAVAEALWEEMERDERVIMLGE |
| Ga0066823_101588831 | 3300005163 | Soil | MATKQVDAGAAGHGAEPRGKRGDDGQATYLIAIAEALWEEMERDERVYM |
| Ga0066815_100623021 | 3300005164 | Soil | MSAQTVESGAAGHGAEPRGKRDDDGQATYLIAIAEALWEEMERDERVY |
| Ga0066677_104286292 | 3300005171 | Soil | MASATPTVDSAAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERD |
| Ga0066680_104132411 | 3300005174 | Soil | MAQAQQVEPAASGHGAEPRGKRTDAGEATYLIAIAEALWEEM |
| Ga0068999_101328292 | 3300005205 | Natural And Restored Wetlands | MATKAVEAGAAGHGAEPRGKRTDAGEATYLIAIAEALWEEMERDE |
| Ga0070663_1008530962 | 3300005455 | Corn Rhizosphere | MATMQADAGAAGHGAEPRGKRSDDGQATYLIAIAEALWEEMERD |
| Ga0070662_1013972702 | 3300005457 | Corn Rhizosphere | MATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAEALWEEME |
| Ga0070707_1008545792 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTTATVESGAAGHGAEPRGKRTESGEATYLVAIAEALWEEMERDERV |
| Ga0070698_1007704652 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MATRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMERDE |
| Ga0070698_1016615062 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MATTQADAGAAGHGAEPRGKRSDDGQATYLVAIAEALWEEMERDERVFM |
| Ga0070699_1006830221 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MATKQVESGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDERVY |
| Ga0070699_1017627272 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MATQEKAAQVEAGAAGHGAEPRGKRSEAGEATYLIAIAEALWEEMERDERVYML |
| Ga0073909_102972731 | 3300005526 | Surface Soil | MATKQVDAGAAGHGAEPRGKRGDDGQATYLIAIAEALWEEMERD |
| Ga0070686_1012888592 | 3300005544 | Switchgrass Rhizosphere | MATMQADAGAAGHGAEPRGKRSDDGQATYLIAIAEALWEEME |
| Ga0070695_1000759031 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MATQQVETGAAGHGAEPRGKRSDDGQATYLIAVAEALWEEMERDER |
| Ga0070704_1000073581 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MATQQVETGAAGHGAEPRGKRSDDGQATYLIAVAEALWEEMERDERVFM |
| Ga0066699_106550611 | 3300005561 | Soil | MASATPTVDSAAAGHGAEPRGKRTEAGEATYLIAIAEALWEEM |
| Ga0070702_1005071122 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERD |
| Ga0068866_107714262 | 3300005718 | Miscanthus Rhizosphere | MATKQVDSGAAGHGAEPRGKRSDDGQATYLIAIAEALWEEMERD |
| Ga0068861_1017685691 | 3300005719 | Switchgrass Rhizosphere | MATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALW |
| Ga0068861_1019029692 | 3300005719 | Switchgrass Rhizosphere | MASTTVESGAAGHGAEPRGKRSEDGQATYLIAVAE |
| Ga0068863_1024995902 | 3300005841 | Switchgrass Rhizosphere | MATTQADAGAAGHGAEPRGKRSDDGQATYLIAIAEALWEEMERDE |
| Ga0070717_114675451 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MTASTVESGAAGHGAEPRGKRTEQGEATYLVAIAEALW |
| Ga0066652_1006317951 | 3300006046 | Soil | MASTTVESAAAGHGAEPRGKRTDAGEATYLIAIAEALWEEMERDGNVF |
| Ga0066652_1011691362 | 3300006046 | Soil | MATTQVEAGAAGHGAEPRGKRTEAGEATYLIAVAEALWEEMERDERV |
| Ga0066652_1013281591 | 3300006046 | Soil | VSVPAKNVESGAAGHGNEPRGKRGAGGEATYLIAIAEALWEEMERDGN |
| Ga0075432_100225871 | 3300006058 | Populus Rhizosphere | VTAPQAPTEAGAAGHGAEPRGKRTEDGQATYLIAIAE |
| Ga0070712_1007487121 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MTASTVESGAAGHGAEPRGKRTEQGEATYLVAIAEALWEEMER |
| Ga0074055_112905952 | 3300006573 | Soil | MMATQQVEAGAAGHGAEPRGKRAEDGQATYLIAVAEA |
| Ga0074054_120836572 | 3300006579 | Soil | MATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWE |
| Ga0074049_128856252 | 3300006580 | Soil | MSAQTVESGAAGHGAEPRGKRDDDGQATYLIAIAE |
| Ga0074064_114637842 | 3300006603 | Soil | MATKQVDAGAAGHGAEPRGKRGDDGQATYLIAIAEALW |
| Ga0075430_1006056151 | 3300006846 | Populus Rhizosphere | MATTTVESGAAGHGAEPRGKRTEQGEATYLIAIAEALWE |
| Ga0079215_100778441 | 3300006894 | Agricultural Soil | MATKTVQAGAAGHGAEPRGKRSENGEATYLVAIAEA |
| Ga0079215_107309562 | 3300006894 | Agricultural Soil | MATAQVKAGAAGHGAEPRGKRSDDGQATYLIAIAEALWEEMERDERVYMLG |
| Ga0079215_114503121 | 3300006894 | Agricultural Soil | MAEATTLEAGAAGHGAEPRGKRTEDGQATYLVAIAEALW |
| Ga0075436_1006015401 | 3300006914 | Populus Rhizosphere | MTASTVESGAAGHGAEPRGKRTEQGEATYLIAIAEALWEEMERDERVF |
| Ga0066710_1045956182 | 3300009012 | Grasslands Soil | MATRVEAGAAGHGAEPRGKRSESGEATYLIAIAEALWEEMERDD |
| Ga0066710_1046821152 | 3300009012 | Grasslands Soil | MATAQVESGAAGHGAEPRGRRTEEGEATYLIAIAEALW |
| Ga0105245_118667021 | 3300009098 | Miscanthus Rhizosphere | MATQQVETGAAGHGAEPRGKRSDDGQATYLIAVAEALWEE |
| Ga0115026_116363792 | 3300009111 | Wetland | MAAKTLEAGAAGHGAEPRGKRSEAGEATYLVAIAEALWEEMERD |
| Ga0066709_1035018822 | 3300009137 | Grasslands Soil | MATAQVEAGAAGHGAEPRGKRTEDGQATYLIAIAEAMWEEME |
| Ga0105101_104044042 | 3300009171 | Freshwater Sediment | MAAKTLEAGAAGHGAEPRGKRSDAGEATYLIAIAEALWEEMERD |
| Ga0105249_104556143 | 3300009553 | Switchgrass Rhizosphere | MATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAEAL |
| Ga0105062_10322721 | 3300009817 | Groundwater Sand | MATAQVESGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEME |
| Ga0105062_10535532 | 3300009817 | Groundwater Sand | MATAQVESGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDER |
| Ga0105072_10062881 | 3300009818 | Groundwater Sand | MATRAVEPSAAGHGAEPRGKRTDQGEATYLVAIAEALWEEME |
| Ga0134067_104394962 | 3300010321 | Grasslands Soil | MATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWEEMERDE |
| Ga0134128_113481742 | 3300010373 | Terrestrial Soil | MASTTVESGAAGHGAEPRGKRSEDGQATYLIAVAEALWEEMERDERVIMLGED |
| Ga0151490_11468882 | 3300011107 | Soil | MAQKVEAAAAGHGAEPRGKRTDDGQATYLIAIAEALW |
| Ga0137455_11788802 | 3300011429 | Soil | MATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAEALWE |
| Ga0137382_109791631 | 3300012200 | Vadose Zone Soil | MAAQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEA |
| Ga0137376_103480262 | 3300012208 | Vadose Zone Soil | MATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWEEMERDERVFMLG |
| Ga0137387_104851561 | 3300012349 | Vadose Zone Soil | MATQQVEAAAAGHGAEPRGKRGEDGQATYLIAIAE |
| Ga0137385_115578102 | 3300012359 | Vadose Zone Soil | MATAQVEAGAAGHGAEPRGKRTEDGQATYLIAIAEAMWEE |
| Ga0134049_12556492 | 3300012403 | Grasslands Soil | MASTQVEAGAAGHGAEPRGNRAEDGQATYLIAIAEALWEEMERDERLYLLGE |
| Ga0157284_103053902 | 3300012893 | Soil | MATTQVEAGAAGHGAEPRGKRTEAGEATYLIAVAEALWEEMER |
| Ga0157285_100814041 | 3300012897 | Soil | MASTTVESGAAGHGAEPRGKRSEDGQATYLIAVAEALWEE |
| Ga0157286_100710391 | 3300012908 | Soil | MATRTVESGAAGHGAEPRGKRTEQGEATYLVAIAEALWEEMERDERV |
| Ga0126375_113244582 | 3300012948 | Tropical Forest Soil | MATQQVEAGAAGHGAEPRGKRSEDGQATYLIAVAEALWEEMERDE |
| Ga0164299_114699222 | 3300012958 | Soil | MATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWEEM |
| Ga0164299_115415372 | 3300012958 | Soil | MATQQVETGAAGHGAEPRGKRSDDGQATYLIAVAEALWEEMERDERVF |
| Ga0164301_113284742 | 3300012960 | Soil | MASTTVDTGAAGHGAEPRGKRSEDGQATYLIAVAEALWE |
| Ga0075309_10868332 | 3300014268 | Natural And Restored Wetlands | VAQGTTSPKVDSGAAGHGAEPRGKRSDDGQATYLVAIAEALWE |
| Ga0075305_10448322 | 3300014295 | Natural And Restored Wetlands | MTAQTVEAAAAGHGAEPRGKRTEDGQATYLIAIAEALWEEMERDERVFMLG |
| Ga0075303_10041111 | 3300014299 | Natural And Restored Wetlands | MATQQVEAAAAGHGAEPRGKRSEDGQATYLVAIAEAL |
| Ga0075351_11133302 | 3300014318 | Natural And Restored Wetlands | MATAQVEAGAAGHGAEPRGKRSEDGQATYLVAIAEALWEE |
| Ga0134089_105388121 | 3300015358 | Grasslands Soil | MATQQVEAGAAGHGSEPRGKRSEDGQATYLIAIAEALWEEMER |
| Ga0134085_100896031 | 3300015359 | Grasslands Soil | MATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEALWEEMERDERVFM |
| Ga0163161_107675041 | 3300017792 | Switchgrass Rhizosphere | MAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERDE |
| Ga0184608_105162381 | 3300018028 | Groundwater Sediment | MVTRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEEME |
| Ga0184634_102531982 | 3300018031 | Groundwater Sediment | MATSQVETGAAGHGAEPRGKRTEAGEATYLVAIAEALWEEMERD |
| Ga0184634_102730822 | 3300018031 | Groundwater Sediment | MATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMERD |
| Ga0184640_100081681 | 3300018074 | Groundwater Sediment | MATAQVESGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDERVYL |
| Ga0184633_100953601 | 3300018077 | Groundwater Sediment | MATSQVETGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERD |
| Ga0184625_100421451 | 3300018081 | Groundwater Sediment | MATRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEG |
| Ga0184639_103524941 | 3300018082 | Groundwater Sediment | MATSQVETGAAGHGAEPRGKRTEAGEATYLVAIAEALWEEME |
| Ga0190270_124654152 | 3300018469 | Soil | MARRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEGLWEE |
| Ga0066669_123677982 | 3300018482 | Grasslands Soil | MATQQVEAGAAGHGAEPRGKRSEDGQATYLIAIAE |
| Ga0184646_13463711 | 3300019259 | Groundwater Sediment | MATRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEGLWEEM |
| Ga0173481_101147612 | 3300019356 | Soil | MATQQVEAAAAGHGAEPRGKRSDDGQATYLIAIAEALWEEMERDERVFM |
| Ga0173482_101944731 | 3300019361 | Soil | MATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEA |
| Ga0173482_105914112 | 3300019361 | Soil | MAKTAQVEGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERDERVYLLG |
| Ga0173479_105265861 | 3300019362 | Soil | MASTTVESGAAGHGAEPRGKRSEDGQATYLIAVAEALWEEMERDER |
| Ga0190264_102150022 | 3300019377 | Soil | MATTVKLEAGAAGHGAEPRGKRGDDGQATYLIAIAEALW |
| Ga0190264_114145681 | 3300019377 | Soil | VAQKVETGAAGHGAEPRGKRSDDGQATYLVAIAEALWEEMERDDRVYMLG |
| Ga0187892_100974921 | 3300019458 | Bio-Ooze | MATSTVETGAAGHGAEPRGKRSATGEATYLIAIAEALWEEMERDE |
| Ga0210379_102421541 | 3300021081 | Groundwater Sediment | MVTRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMERDERVFLL |
| Ga0222624_15165501 | 3300021951 | Groundwater Sediment | MATRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMER |
| Ga0193737_10089041 | 3300021972 | Soil | MATRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMERDERVFLL |
| Ga0209126_11507061 | 3300025119 | Soil | MATRTVEAGAAGHGAEPRGKRSEKGEATYLVAIAEALWEEMERDE |
| Ga0209320_103617021 | 3300025155 | Soil | MATRTLHAGAAGHGAEPRGKRTDAGEATYLIAIAEALWEEMERDERVF |
| Ga0209172_104884031 | 3300025310 | Hot Spring Sediment | MATRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEGLWEEMERDERVFLL |
| Ga0209321_105158001 | 3300025312 | Soil | VSQVVEAGAAGHGAEPRGKRTESGEATYLIAIAEALWEEME |
| Ga0209342_102643851 | 3300025326 | Soil | MATRTVEAGAAGHGAEPRGKRSEKGEATYLVAIAEALWEEMERDER |
| Ga0210138_11247671 | 3300025580 | Natural And Restored Wetlands | MATQQVEAAAAGHGAEPRGKRSEDGQATYLVAIAEALWEEMERDDRVFML |
| Ga0207643_105143042 | 3300025908 | Miscanthus Rhizosphere | MAKTAQVEGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMER |
| Ga0210145_10361262 | 3300025973 | Natural And Restored Wetlands | MATPQVDAAAAGHGAEPRGKRSDDGQATYLVAIAEALWEEMERD |
| Ga0207640_116905182 | 3300025981 | Corn Rhizosphere | MASTTIESGAAGHGAEPRGKRSEDGQATYLIAVAEA |
| Ga0207708_101005963 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MATQQVETGAAGHGAEPRGKRSDDGQATYLIAVAEAL |
| Ga0209686_12333521 | 3300026315 | Soil | MASATPTVDSAAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDGN |
| Ga0209846_10119023 | 3300027277 | Groundwater Sand | MATRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEA |
| Ga0208890_10232201 | 3300027523 | Soil | MATKQVDSGAAGHGAEPRGKRGDDGQATYLIAIAEALWEEMERDER |
| Ga0209819_102011252 | 3300027722 | Freshwater Sediment | MATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAE |
| Ga0268266_117522872 | 3300028379 | Switchgrass Rhizosphere | VASSTTVEAGAAGHGAEPRGKRTDDGQATYLIAVA |
| Ga0247818_113399301 | 3300028589 | Soil | MAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERDERVY |
| Ga0247822_101213643 | 3300028592 | Soil | MATTAKVEAGAAGHGAEPRGKRGDDGQATYLIAIAEALWEEMERDERVY |
| Ga0247820_109142631 | 3300028597 | Soil | MATRAVEASAAGHGAEPRGKRTDQGEATYLVAIAEALWEEMEQ |
| Ga0307321_10228352 | 3300028704 | Soil | MAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGL |
| Ga0307291_10804211 | 3300028707 | Soil | MAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERDERVYLLGE |
| Ga0307293_102074161 | 3300028711 | Soil | MATRTVEASAAGHGAEPRGKRTDQGEATYLVAIAEALWE |
| Ga0307319_100698561 | 3300028722 | Soil | MAQAAPQVEAGAAGHGNEPRGKRTDAGEATYLIAVAEALWEEM |
| Ga0307316_100115214 | 3300028755 | Soil | MMATQQVEAAAAGHGAEPRGKRSEDGQATYLVAIAEALWEEMERDER |
| Ga0307282_105577081 | 3300028784 | Soil | MATAQVEAGAAGHGAEPRGKRTEDGQATYLIAIAEA |
| Ga0307299_101816462 | 3300028793 | Soil | MATQQVEAGAAGHGAEPRGKRGEDGQATYLIAIAEAL |
| Ga0307296_103699251 | 3300028819 | Soil | MAQASPQVEAGAAGHGNEPRGKRTDAGEATYLIAIAE |
| Ga0307296_103870642 | 3300028819 | Soil | MATKTLEAGAAGHGAEPRGKRTDAGEATYLIAIAEALWE |
| Ga0307312_110667671 | 3300028828 | Soil | MATRAVEAGAAGHGAEPRGKRTDQGEATYLVAIAEALWEE |
| Ga0307286_100040281 | 3300028876 | Soil | MAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLWEEMERDERV |
| Ga0307278_102195622 | 3300028878 | Soil | MATAKVEAGAAGHGAEPRGKRTDAGEATYLIAIAEALWEEMERDERVYMLG |
| Ga0307278_102880851 | 3300028878 | Soil | MATKTLEAGAAGHGAEPRGKRTDAGEATYLIAIAEALWEEME |
| Ga0311333_111095382 | 3300030114 | Fen | MTATQQVEAGAAGHGAEPRGKRTEDGQATYLIAIAEALWEEME |
| Ga0307495_102532012 | 3300031199 | Soil | MATTQVEAGAAGHGAEPRGKRTEAGEATYLIAVAEALWEEMERDERVYL |
| Ga0310887_111114792 | 3300031547 | Soil | MATQQVEAAAAGHGAEPRGKRSEDGQATYLVAIAEALWEEMERD |
| Ga0315290_103142923 | 3300031834 | Sediment | MAGAAQKVEGAAAGHGAEPRGKRSDEGEATYLIAIAEALW |
| Ga0310892_105180132 | 3300031858 | Soil | VTAPQAPTEAGAAGHGAEPRGKRTEDGQATYLIAIAEGLWEEMERDE |
| Ga0310884_110866282 | 3300031944 | Soil | VTAPQAPTEAGAAGHGAEPRGKRTEDGQATYLIAIAEGLWEEME |
| Ga0214473_107429911 | 3300031949 | Soil | MSATLEAGAAGHGAEPRGKRTEDGQATYLIAIAEALWEEME |
| Ga0315283_114216262 | 3300032164 | Sediment | MATQQVEAGAAGHGAEPRGKRSEDGQATYLIAIAEAL |
| Ga0315276_108988782 | 3300032177 | Sediment | MATQQVEAGAAGHGAEPRGKRSEDGQATYLIAIAEALWEEMERDDRVYLLG |
| Ga0335084_122582831 | 3300033004 | Soil | MTDTSTVESGAAGHGAEPRGKRTEQGEATYLIAIAEALWEEMERDERVF |
| Ga0214472_116258291 | 3300033407 | Soil | MATRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEGLWE |
| Ga0316622_1001291533 | 3300033416 | Soil | MATKTLEAGAAGHGAEPRGKRTDAGEATYLVAIAEALWEEMERDERVFLL |
| Ga0214471_110038401 | 3300033417 | Soil | MATKTVEAGAAGHGAEPRGKRSENGEATYLVAIAE |
| Ga0214471_112740021 | 3300033417 | Soil | MTTRAVEAGAAGHGAEPRGKRTEQGEATYLVAIAEGLWEE |
| Ga0316613_111585851 | 3300033434 | Soil | MATTTLEAGAAGHGAEPRGKRTDAGEATYLIAIAEALWE |
| Ga0326731_11330501 | 3300033502 | Peat Soil | MAQKVEAAAAGHGAEPRGKRTEDGQATYLIAIAEALWEEMERD |
| Ga0247830_113085941 | 3300033551 | Soil | MAKTAQVAKGLDGAAAGHGAEPRGKRTDDGLATYLIAIAEGLW |
| Ga0364928_0175887_3_143 | 3300033813 | Sediment | MATRAVEAGAAGHGAEPRGKRTKQGEATYLVAIAEGLWEEMERDERV |
| Ga0364946_064281_2_151 | 3300033815 | Sediment | MATAQVESGAAGHGAEPRGKRTEAGEATYLIAIAEALWEEMERDELVYLL |
| ⦗Top⦘ |