| Basic Information | |
|---|---|
| Family ID | F049792 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LRSNKIVSIPLKEAISKNRVVDNEMIQIVDGLFEEIGVKEAASK |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.90 % |
| % of genes near scaffold ends (potentially truncated) | 75.34 % |
| % of genes from short scaffolds (< 2000 bps) | 70.55 % |
| Associated GOLD sequencing projects | 115 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (65.753 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (12.329 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.699 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF09594 | GT87 | 18.49 |
| PF03401 | TctC | 0.68 |
| PF04773 | FecR | 0.68 |
| PF08530 | PepX_C | 0.68 |
| PF01799 | Fer2_2 | 0.68 |
| PF07786 | HGSNAT_cat | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG2936 | Predicted acyl esterase | General function prediction only [R] | 0.68 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.68 |
| COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 65.75 % |
| Unclassified | root | N/A | 34.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000789|JGI1027J11758_12449600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 957 | Open in IMG/M |
| 3300001471|JGI12712J15308_10061086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300001867|JGI12627J18819_10418891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101192799 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 650 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101679908 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300004082|Ga0062384_100974582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 605 | Open in IMG/M |
| 3300004091|Ga0062387_100342807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 982 | Open in IMG/M |
| 3300004153|Ga0063455_100252887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300005437|Ga0070710_11395633 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005458|Ga0070681_11836558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 533 | Open in IMG/M |
| 3300005518|Ga0070699_101965597 | Not Available | 535 | Open in IMG/M |
| 3300005526|Ga0073909_10144004 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 987 | Open in IMG/M |
| 3300005541|Ga0070733_10094386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1905 | Open in IMG/M |
| 3300005542|Ga0070732_10491654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 743 | Open in IMG/M |
| 3300005542|Ga0070732_10512255 | Not Available | 727 | Open in IMG/M |
| 3300005542|Ga0070732_10991936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300005587|Ga0066654_10052928 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1800 | Open in IMG/M |
| 3300005602|Ga0070762_11274746 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 510 | Open in IMG/M |
| 3300005764|Ga0066903_100397965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2264 | Open in IMG/M |
| 3300005764|Ga0066903_101249600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1383 | Open in IMG/M |
| 3300005875|Ga0075293_1072628 | Not Available | 518 | Open in IMG/M |
| 3300005921|Ga0070766_10151721 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1419 | Open in IMG/M |
| 3300006028|Ga0070717_11133452 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300006052|Ga0075029_100294853 | Not Available | 1034 | Open in IMG/M |
| 3300006175|Ga0070712_101921777 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300006176|Ga0070765_101559662 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006237|Ga0097621_102284536 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 517 | Open in IMG/M |
| 3300007982|Ga0102924_1264198 | Not Available | 703 | Open in IMG/M |
| 3300009624|Ga0116105_1178471 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010043|Ga0126380_10625346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300010048|Ga0126373_12210783 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 611 | Open in IMG/M |
| 3300010358|Ga0126370_12455925 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300010358|Ga0126370_12476255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 517 | Open in IMG/M |
| 3300010360|Ga0126372_10684248 | Not Available | 998 | Open in IMG/M |
| 3300010379|Ga0136449_100263374 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3187 | Open in IMG/M |
| 3300010396|Ga0134126_12709703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300010398|Ga0126383_12056325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300011269|Ga0137392_10481388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1031 | Open in IMG/M |
| 3300012353|Ga0137367_10166257 | Not Available | 1606 | Open in IMG/M |
| 3300012359|Ga0137385_11363590 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300012925|Ga0137419_11288089 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012927|Ga0137416_10577166 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 977 | Open in IMG/M |
| 3300012944|Ga0137410_11058370 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012985|Ga0164308_11729997 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300014498|Ga0182019_10922646 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300014969|Ga0157376_10544360 | All Organisms → cellular organisms → Bacteria | 1148 | Open in IMG/M |
| 3300016371|Ga0182034_10761433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
| 3300017943|Ga0187819_10680958 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300017946|Ga0187879_10696501 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300017961|Ga0187778_10028771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3395 | Open in IMG/M |
| 3300017970|Ga0187783_11413106 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300017972|Ga0187781_10058119 | All Organisms → cellular organisms → Bacteria | 2661 | Open in IMG/M |
| 3300017975|Ga0187782_10908322 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300017995|Ga0187816_10424289 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300018006|Ga0187804_10461912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300018007|Ga0187805_10157560 | Not Available | 1033 | Open in IMG/M |
| 3300018046|Ga0187851_10251532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300018058|Ga0187766_11027040 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300018060|Ga0187765_10546038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300018085|Ga0187772_10074567 | All Organisms → cellular organisms → Bacteria → PVC group → Lentisphaerae → unclassified Lentisphaerota → Lentisphaerota bacterium | 2138 | Open in IMG/M |
| 3300018088|Ga0187771_10785260 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
| 3300019273|Ga0187794_1612125 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300020579|Ga0210407_10186369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1610 | Open in IMG/M |
| 3300020581|Ga0210399_10204896 | Not Available | 1641 | Open in IMG/M |
| 3300020581|Ga0210399_10351743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1230 | Open in IMG/M |
| 3300020583|Ga0210401_10955847 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300021088|Ga0210404_10044684 | Not Available | 2057 | Open in IMG/M |
| 3300021171|Ga0210405_10817590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 713 | Open in IMG/M |
| 3300021178|Ga0210408_10550521 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 916 | Open in IMG/M |
| 3300021181|Ga0210388_10624057 | Not Available | 942 | Open in IMG/M |
| 3300021407|Ga0210383_10218775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1631 | Open in IMG/M |
| 3300021407|Ga0210383_11050468 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300021420|Ga0210394_10611213 | Not Available | 958 | Open in IMG/M |
| 3300021433|Ga0210391_10532908 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300021474|Ga0210390_10734535 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300021477|Ga0210398_10955309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300021478|Ga0210402_10068867 | All Organisms → cellular organisms → Bacteria | 3126 | Open in IMG/M |
| 3300022532|Ga0242655_10113777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 758 | Open in IMG/M |
| 3300022533|Ga0242662_10331658 | Not Available | 515 | Open in IMG/M |
| 3300025922|Ga0207646_11884953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300025992|Ga0208775_1004580 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300027164|Ga0208994_1010874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1196 | Open in IMG/M |
| 3300027727|Ga0209328_10229561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300027738|Ga0208989_10035660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1724 | Open in IMG/M |
| 3300027745|Ga0209908_10095370 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
| 3300027783|Ga0209448_10115812 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300027812|Ga0209656_10375754 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300027821|Ga0209811_10153014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 856 | Open in IMG/M |
| 3300027842|Ga0209580_10340346 | Not Available | 747 | Open in IMG/M |
| 3300027842|Ga0209580_10503600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300027853|Ga0209274_10393936 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300027855|Ga0209693_10458349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300027867|Ga0209167_10401314 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300027867|Ga0209167_10813371 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027884|Ga0209275_10064148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1802 | Open in IMG/M |
| 3300027884|Ga0209275_10539225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300027898|Ga0209067_10042023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2326 | Open in IMG/M |
| 3300027908|Ga0209006_10963968 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300028536|Ga0137415_11010136 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300029999|Ga0311339_11487787 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300030057|Ga0302176_10190340 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300030618|Ga0311354_11349365 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300031028|Ga0302180_10617530 | Not Available | 520 | Open in IMG/M |
| 3300031128|Ga0170823_10889904 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300031668|Ga0318542_10455628 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300031912|Ga0306921_10992757 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 947 | Open in IMG/M |
| 3300031962|Ga0307479_12006246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300032180|Ga0307471_102422041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 663 | Open in IMG/M |
| 3300032770|Ga0335085_12017912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300032805|Ga0335078_11549681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 737 | Open in IMG/M |
| 3300032898|Ga0335072_11384917 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.33% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 7.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 7.53% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.85% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.16% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.11% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.42% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.74% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.74% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.05% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.05% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.37% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.37% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.68% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.68% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.68% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.68% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.68% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.68% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025992 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_104 (SPAdes) | Environmental | Open in IMG/M |
| 3300027164 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031258 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J11758_124496002 | 3300000789 | Soil | MAALKANKIVSITLQEAISKNRVVDDEILTVADGLFEEIGSKEAART* |
| JGI12712J15308_100610861 | 3300001471 | Forest Soil | DFGSMAALRANKIISITLKEAISKNRTVDPETIQMMDGLFQETSVKETANS* |
| JGI12627J18819_104188911 | 3300001867 | Forest Soil | FGCMAALRSNRIISIPLKEAISKNRVVDDEMIQIAAGLFEEIGVKEAAGE* |
| JGIcombinedJ26739_1011927991 | 3300002245 | Forest Soil | FGRMAALRANKIVSIPLIEAISRNRVVDDEMIQIVDGLFQKVADREPARR* |
| JGIcombinedJ26739_1016799082 | 3300002245 | Forest Soil | SLKEAISKNRIVDNDMIQSVDGLFEEIGVKEAASK* |
| Ga0062384_1009745822 | 3300004082 | Bog Forest Soil | RGEFGCMAALRSNKIVSITLLEAISRNRVVDNEMIQIVDGLFEKAADKQPV* |
| Ga0062387_1003428071 | 3300004091 | Bog Forest Soil | EFGCMAALRANKIVSIPLIEAISRNRTVDDEMIQIIDGLFQKTADREAAGR* |
| Ga0062389_1004341752 | 3300004092 | Bog Forest Soil | AALRSNKIVSIPLIEAISRNRTVDDEMIQIVDGLFQKVADREPA* |
| Ga0063455_1002528871 | 3300004153 | Soil | MAALKANKIVSVTLKEAISKNRVVDDEIIQVASGLFEEIGAKEAAGK* |
| Ga0070710_113956332 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | GEFGCMAALRSNKIVSIPLLEAISKNRVVDDEMIQIAGGLFEEIGEAATK* |
| Ga0070681_118365581 | 3300005458 | Corn Rhizosphere | AALRSNKIVSIPLLEAISKNRVVDDEMIQIAGGLFEEIGEAATK* |
| Ga0070699_1019655971 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSNRIVSIPLKEAISKNRVVDDEMIQIVGGLFEETGVREAAVK* |
| Ga0073909_101440041 | 3300005526 | Surface Soil | VSITLKEAISKNRVVDDEMIQITDGLFEEIGAKVASK* |
| Ga0070733_100943861 | 3300005541 | Surface Soil | LKEAISKNRVVDDEMIQIAAGLFEEIGVKEAAGE* |
| Ga0070733_101711052 | 3300005541 | Surface Soil | RSNKIVSIPLIEAISRNRVVDDEMIQIVEGLFQKADDRQAV* |
| Ga0070732_104916542 | 3300005542 | Surface Soil | RSNKIVSIPLKEAISKNRVVDNEMIQIVDGLFEEIGVKETAST* |
| Ga0070732_105122552 | 3300005542 | Surface Soil | VSIPLMEAISKNRVVDDEMIRIVGGLFEETGVRETAVK* |
| Ga0070732_109919361 | 3300005542 | Surface Soil | LRSNKIVSITLKEAISKNRVVDDEMIEIADGLFEEIGAKVASK* |
| Ga0066654_100529281 | 3300005587 | Soil | LRSNKIVSIPLLEAISKNRVVDDEMIQIAGGLFEEIGEAATK* |
| Ga0070762_112747461 | 3300005602 | Soil | ALRSNKIVSIPLKEAISKNRVVDNEMIQIVDGLFEEIGVKEVAGN* |
| Ga0070763_103000311 | 3300005610 | Soil | KIVSITLSEAISKNRVVDDEMIQIVDGLFEKASEKQLV* |
| Ga0066903_1003979653 | 3300005764 | Tropical Forest Soil | TLKEAISKNRVVDDEMIQIADGLFEEIGAKAAGK* |
| Ga0066903_1012496001 | 3300005764 | Tropical Forest Soil | FGRMAALKANKIVSIPLKEAISKNRVVDDEMIEIAGGLFEEISEKEAAVK* |
| Ga0075293_10726282 | 3300005875 | Rice Paddy Soil | MAALRSNKIVSIPLLEAISKNRVVDDEMIQIAGGLFEEIGEAATK* |
| Ga0070766_101517211 | 3300005921 | Soil | EFGCMAALRSNKIVSIPLKEAISKNRVVDNEMIQIVDGLFEEIGVKETASK* |
| Ga0070717_111334521 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | IPLKEAISKNRVVDNEMIQIVDGLFEEIGVREVAGK* |
| Ga0075029_1002948532 | 3300006052 | Watersheds | RANKIVSITLKEAISSNRTVDSEMIEMVDGLFEEINSK* |
| Ga0070712_1019217772 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KIVSIPLLEAISKNRVVDDEMIQIAGGLFEEIGEAATK* |
| Ga0070765_1002676341 | 3300006176 | Soil | GCMAALRSNKIVSIPLLEAISRNRTVDAEMIQIVDGLFQKVADREAV* |
| Ga0070765_1015596622 | 3300006176 | Soil | MAALRANRIVSVTLKEAISKNRVVDAEMIDIANGLFEEIGEVASK* |
| Ga0097621_1022845362 | 3300006237 | Miscanthus Rhizosphere | IVSIPLKEAISKNRVVDNEMIQIVDGLFEEIGEKETASQ* |
| Ga0102924_12641981 | 3300007982 | Iron-Sulfur Acid Spring | ALRSNRIVSIPLMEAISKNRVVDDEMIRIVGGLFEETGVRETAVK* |
| Ga0099827_100677371 | 3300009090 | Vadose Zone Soil | KILSIPLLEAISRNRTVDSEMIQIIDGLFQKTDTRETV* |
| Ga0116105_11784711 | 3300009624 | Peatland | RGEFGCMAALRSNKIVSIPLMEAISRNRIVDDEMIQIVDGLFQKSAERQAV* |
| Ga0116121_11362911 | 3300009644 | Peatland | KIVSIPLLEAISRNRVVDSEMIQIVDGLFERAPDKQAV* |
| Ga0116101_11106161 | 3300009759 | Peatland | IPLIDAISRNRTVDDEMIETLTGLFEKVADRETAA* |
| Ga0116219_100612083 | 3300009824 | Peatlands Soil | VSIPLLEAIAKNRVVDNEMIRMVDGLFEKTADKQAV* |
| Ga0116219_101302152 | 3300009824 | Peatlands Soil | FGCMAALRANKIVSVRLAEAISRNRVVDDEMIQIVDGLFQKADDKQAV* |
| Ga0126380_106253462 | 3300010043 | Tropical Forest Soil | LEEAISKNRVVDDEILTVADGLFEEIGSKEAART* |
| Ga0126373_122107832 | 3300010048 | Tropical Forest Soil | SIPLKEAIAKNRVVDNEMIDIASGLFEEIGEAANK* |
| Ga0074046_102607532 | 3300010339 | Bog Forest Soil | AALRANKIVSIPLAEAISRNRTVDDEMIHIVDGLFEKAAEKQPVGK* |
| Ga0126370_124559252 | 3300010358 | Tropical Forest Soil | SIPLKEAISKNRVVDDEMIEIAGGLFEEISEKEAAVK* |
| Ga0126370_124762552 | 3300010358 | Tropical Forest Soil | GCMAALRSNKIVSITLKEAISKNRVVDDEMIQIADGLFEEIGAKAAGK* |
| Ga0126372_106842482 | 3300010360 | Tropical Forest Soil | PLTEAICKNRVVDDEVIEIADGLFEEIGVKEVAGK* |
| Ga0136449_1002633741 | 3300010379 | Peatlands Soil | GCMAALRANKIVSIPLIEAISRNRTVDDEMIQMVDGLFQKVADREAAGR* |
| Ga0134126_127097032 | 3300010396 | Terrestrial Soil | ALRSNKIVSIPLLEAISKNRVVDDEMIQIVGGLFEEIGEAATK* |
| Ga0126383_120563252 | 3300010398 | Tropical Forest Soil | GEFGCMAALRANKIVSITLKEAISKNRVVDDEVIQIADGLFEEVVVKAASK* |
| Ga0137392_104813881 | 3300011269 | Vadose Zone Soil | FGCMAALRSNKIVSIPLKEAISRNRVVDDEMIEMVHGLFEKTSTKEAVSN* |
| Ga0137367_101662572 | 3300012353 | Vadose Zone Soil | SNKIVSITLKEAISKNRVVDAEMIEIANGLFEEHTAKEAVSK* |
| Ga0137385_113635901 | 3300012359 | Vadose Zone Soil | VSIPLKEAISKNRVVDNEMIQIVDGLFEETGVKEAAGK* |
| Ga0137419_112880892 | 3300012925 | Vadose Zone Soil | LRSNKIVTISLKEAISKNRVVDNEMIQIVDGLFEETGVKEAAGQ* |
| Ga0137416_105771662 | 3300012927 | Vadose Zone Soil | AALRSNKIVSIPLKEAISRNRVVDDEMIEMVGGLFEKTSIKEAVSS* |
| Ga0137410_110583702 | 3300012944 | Vadose Zone Soil | SMAALRANKIISIPLKEAISRNRTVDDEMILTVDGLFDKVASKETVAQ* |
| Ga0164308_117299972 | 3300012985 | Soil | AALRSNKIVSIPLLEAISKNRVVDDEMIQIASGLFEEIGEAATK* |
| Ga0182019_109226462 | 3300014498 | Fen | ALRSNKIVSVSLKEAISKNRVVDNEMIQMVDGLFEEIGVKEPANK* |
| Ga0181516_102718951 | 3300014655 | Bog | IVSIPLIEAISRNRVVDDEMIEMVSGLFEKAADRETV* |
| Ga0157376_105443601 | 3300014969 | Miscanthus Rhizosphere | RGEFGCMAALRSNKIVSIPLKEAISKNRVVDNEMIQIVDGLFEEIGEKETASQ* |
| Ga0182034_107614332 | 3300016371 | Soil | KIISIPLKEAISKNRILDDEIIRIADGLFQEVVVKAAGT |
| Ga0187819_106809582 | 3300017943 | Freshwater Sediment | GEFGCMAALRSNKIVSIPLLEAISRNRVVDTEMIQIVDGLFEKAADKTAV |
| Ga0187879_102582082 | 3300017946 | Peatland | EFGCMAALRSNKIVSIPLLEAISRNRVVDNEMIQIVDGLFERSNDKQPV |
| Ga0187879_106965012 | 3300017946 | Peatland | EFGCMAALRSNKIVSITLKEAISRNRVVDDEMIQIVDGLFERAAEKQPA |
| Ga0187778_100287714 | 3300017961 | Tropical Peatland | LRANKIVSIPLKEAISKNRVVDDEMIQIAEGLFEEVGVKAADR |
| Ga0187783_114131062 | 3300017970 | Tropical Peatland | FGCMAALRANKIVSIPLKEAISKNRTVDNEMIQIVDGLFEEIGVKEAASK |
| Ga0187781_100581193 | 3300017972 | Tropical Peatland | SNKIVSIPLKEAISKNRVVDDEMIQIADGLFEEIVVKEAAVK |
| Ga0187782_109083221 | 3300017975 | Tropical Peatland | IVSIPLKEAIAKNRTVDHEMIQIVDGLFEEVNAKEPVGD |
| Ga0187816_104242892 | 3300017995 | Freshwater Sediment | GCMAALRSNKIVSIPLKEAIAKNRTVDNEMIQIVDGLFEEVGTKEAVGD |
| Ga0187804_104619121 | 3300018006 | Freshwater Sediment | MAALRENKIVSIPLKEAISKNRVVDDGMIQMVEGLFEEIGVREVASK |
| Ga0187805_101575602 | 3300018007 | Freshwater Sediment | ISITLKEAISTNRVVDAETIEIANGLFEEIGEVASK |
| Ga0187883_100626563 | 3300018037 | Peatland | NKIVSIPLLEAISRNRVVDNEMIQIVDGLFERSNDKQPV |
| Ga0187851_102515322 | 3300018046 | Peatland | HRGEFGCMAALRSNKIVSIPLKEAIAKNRVVDNEMIQIVDGLFEEIGVKEPAGK |
| Ga0187859_107771461 | 3300018047 | Peatland | ALRANKIVSITLSEAISSNRVVDNEMIQIVDGLFEKASDKQLI |
| Ga0187766_110270402 | 3300018058 | Tropical Peatland | CMAALRNNKIVSIPLKEAIAKNRTVDNEMIQIVDGLFEEIGVKETASK |
| Ga0187765_105460382 | 3300018060 | Tropical Peatland | FGCMAALRSNKIVSITLKEAIAKNRVVDDEMIQIADGLLEEVVVKAAIK |
| Ga0187772_100745671 | 3300018085 | Tropical Peatland | IVSIPLKEAIARNRTVDDEMIEIAEGLFEEVGVKEAASK |
| Ga0187771_107852602 | 3300018088 | Tropical Peatland | SIPLKEAIAKNRTVDNEMIQIVDGLFEETGVKEAASK |
| Ga0187794_16121252 | 3300019273 | Peatland | FGCMAALRANKIVSIPLKEAIARNRTVDNDMIEVADGLLEPVSAAKETVAK |
| Ga0182025_13567963 | 3300019786 | Permafrost | KIVSITLSEAISSNRVVDDEMIQIVDGLFEKAADKQLV |
| Ga0210407_101863692 | 3300020579 | Soil | EFGRMAALRSNKIVSIPLRDAIARNRTVDDEIIQVAEGILDTTASDKEAVRR |
| Ga0210399_102048961 | 3300020581 | Soil | MAALRSNKIVSIPLQEAISKNRVVDHEMIQIVDGLFEEIGVKETASS |
| Ga0210399_103517432 | 3300020581 | Soil | LRSNKIVSIPLKEAIAKNRVVDNEMIQIVDGLFEEIGEKETARK |
| Ga0210401_109558471 | 3300020583 | Soil | VSIPLKEAISKNRVVDNEMIQIVDGLFEEIGVKEVAGN |
| Ga0210404_100446841 | 3300021088 | Soil | KIVSISLKEAIAKNRVVDNEMIQIVDGLFEEIGVKETAGK |
| Ga0210405_108175902 | 3300021171 | Soil | RSNKIVSIPLKEAIAKNRVVDNEMIQIVDGLFEEPAKEPARK |
| Ga0210408_105505212 | 3300021178 | Soil | PLKEAIAKNRVVDNEMIQIVDGLFEEIGEKETARK |
| Ga0210388_106240571 | 3300021181 | Soil | VSIPLKEAISKNRVVDNEMIQIVDGLFEEIGVKETASK |
| Ga0210383_102187751 | 3300021407 | Soil | LRSNKIVSIPLKEAISKNRVVDNEMIQIVDGLFEEIGVKEAASK |
| Ga0210383_110504682 | 3300021407 | Soil | CMAALRANRIVSVTLKEAISKNRVVDAEMIDIANGLFEEIGEVASK |
| Ga0210394_106112132 | 3300021420 | Soil | PLKEAIAKNRVVDNEMIQIVDGLFEETGVKEAAGQ |
| Ga0210391_105329082 | 3300021433 | Soil | FGCMAALRANKIVTIPLKEAISRNRTVDQEMIQIVDGLFEETSVKEAASS |
| Ga0210390_107345351 | 3300021474 | Soil | NKIVTIPLKEAISRNRTVDQEMIQIVDGLFEETSVKEAASS |
| Ga0210398_109553091 | 3300021477 | Soil | RSNKIVSIPLKEAIAKNRVVDNEMIQIVDGLFEEIGEKETARK |
| Ga0210402_100688674 | 3300021478 | Soil | MAALRNNKITSIPLKDAIARNRTVDDEMIEIADGLFEEIGVKEAAGD |
| Ga0242655_101137771 | 3300022532 | Soil | KIVSITLKEAISKNRVVDDEMIEIADGLFEEIGAKVASK |
| Ga0242662_103316582 | 3300022533 | Soil | LRSNKITSIPLKEAIAKNRVVDDEMIQSVDGLFEEVASRETAAD |
| Ga0208936_10265581 | 3300025404 | Peatland | MAALRSNKIVSIPLLEAISRNRVVDNEMIQIVDGLFERAADKQPV |
| Ga0207646_118849532 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | SLKEAISKNRVVDDEMIRITDGLFEEIGVKETASR |
| Ga0208775_10045801 | 3300025992 | Rice Paddy Soil | GRMAALRSNKIVSIPLLEAISKNRVVDDEMIQIAGGLFEEIGEAATK |
| Ga0208994_10108742 | 3300027164 | Forest Soil | ISITLKEAISKNRTVDPETIQMMDGLFQETSVKETANS |
| Ga0208199_10872272 | 3300027497 | Peatlands Soil | GCMAALRANKIVSVRLAEAISRNRVVDDEMIQIVDGLFQKADDKQAV |
| Ga0209333_10828142 | 3300027676 | Forest Soil | AALRANKIVSIPLIEAISRNRVVDDEMIQIVDGLFQKVADREPARR |
| Ga0209328_102295611 | 3300027727 | Forest Soil | ALRSNKIVSIPLKEAISRNRIVDDEMIAMVDGLFEKTSTKETVTN |
| Ga0208989_100356603 | 3300027738 | Forest Soil | GCMAALRSNKIVSIPLKEAISRNRVVDDEMIAMVDGLFERTSTKEAVGN |
| Ga0209908_100953702 | 3300027745 | Thawing Permafrost | KIVSIPLQEAISKNRVVDHEMIQIIDGLFEEIGVKEAASR |
| Ga0209448_101158122 | 3300027783 | Bog Forest Soil | LSPTAGTGEAIAKNRVVDNEMIQIVDGLFEETGVKEAAGQ |
| Ga0209656_103757542 | 3300027812 | Bog Forest Soil | MAALRSNKIVSIPLKEAIAKNRVVDNEMIQIVDGLFEEIGAKEPAGK |
| Ga0209811_101530141 | 3300027821 | Surface Soil | VSITLKEAISKNRVVDDEMIQITDGLFEEIGAKVASK |
| Ga0209580_103403462 | 3300027842 | Surface Soil | VSIPLMEAISKNRVVDDEMIRIVGGLFEETGVRETAVK |
| Ga0209580_105036001 | 3300027842 | Surface Soil | ALRSNKIVSITLKEAISKNRVVDDEMIEIADGLFEEIGAKVASK |
| Ga0209274_103939362 | 3300027853 | Soil | RGEFGCMAALRANKIISIPLKEAISKNRVVDDEMIQTMDGLFEEIGAK |
| Ga0209693_104583492 | 3300027855 | Soil | NKIVSIPLKEAIAKNRVVDNEMIQIVDGLFEEPAKEPARK |
| Ga0209167_104013141 | 3300027867 | Surface Soil | AALRANKIVSIPLKDAIARNRVVDSEMIEIVDGLFEEIGVKETAGR |
| Ga0209167_108133712 | 3300027867 | Surface Soil | GEFGCMAALRANKIVSVTLKEAISKNRVVDAEMIDIANGLFEEIGEVASK |
| Ga0209590_100347183 | 3300027882 | Vadose Zone Soil | KILSIPLLEAISRNRTVDSEMIQIIDGLFQKTDTRETV |
| Ga0209275_100084761 | 3300027884 | Soil | NKIVSIPLIEAISRNRIVDDEMIRIVDGLFQKVADRETV |
| Ga0209275_100641481 | 3300027884 | Soil | RANKIVSIPLIEAISRNRVVDDETIQIVDGLFQKVADREPARR |
| Ga0209275_105392252 | 3300027884 | Soil | NKIISIPLKEAISKNRVVDDEMIQTMDGLFEEIGAK |
| Ga0209067_100420233 | 3300027898 | Watersheds | GCMAALRSNKIVSITLKEAISKNRVVDDEMIQIADGLFEEIGAKVASK |
| Ga0209006_106411341 | 3300027908 | Forest Soil | LRANKIVSITLSEAISKNRVVDDEMIQIVDGLFEKASEKQLV |
| Ga0209006_109639681 | 3300027908 | Forest Soil | RMAALRANKIISISLKEAISKNRVVDDEMIQIVDGLFEEIGVKEAAGK |
| Ga0265356_10154551 | 3300028017 | Rhizosphere | GCMAALRANKIVSIPLIEAISRNRVVDDEMIQIVDGLFQKADDRQAV |
| Ga0137415_110101362 | 3300028536 | Vadose Zone Soil | GCMAALRSNKIVSIPLKEAISRNRVVDDEMIEMVGGLFEKTSIKEAVSS |
| Ga0308309_103906622 | 3300028906 | Soil | GCMAALRSNKIVSIPLLEAISRNRTVDAEMIQIVDGLFQKVADREAV |
| Ga0311343_102059823 | 3300029953 | Bog | RSNKIVSIPLLEAISKNRVVDDEMIQIVDGLFEKAADKSVV |
| Ga0311339_114877872 | 3300029999 | Palsa | EFGRMAALRANKIISIPLKEAIARNRTVDDEMIQTVEGLFEGVASKEAVGD |
| Ga0302176_101903402 | 3300030057 | Palsa | FGRMAALRSNRIISIPLKEAIARNRTVDDEMIDIVEGLFEGVAPDREAAGR |
| Ga0311354_113493652 | 3300030618 | Palsa | ALRNNKIVSIPLLDAIARNRTVDDEMIQIMDGLFEKSTLKEVVGD |
| Ga0311345_106821281 | 3300030688 | Bog | ALRSNKIVSIPLLEAISKNRVVDDEMIQIVDGLFEKAADKSVV |
| Ga0265750_10860681 | 3300030813 | Soil | KIVSIPLIEAISRNRVVDDEMIQIVDGLFQKADDRQAV |
| Ga0302180_106175302 | 3300031028 | Palsa | LRNNKIVSIPLLDAIARNRTVDDEMIQIMDGLFEKSTLKEVVGD |
| Ga0265760_100348432 | 3300031090 | Soil | ANKIVSITLSEAISKNRVVDAEMIQIVDGLFEKASEKQLV |
| Ga0170823_108899042 | 3300031128 | Forest Soil | FGCMAALRSNKIFSIPLLEAISRNRTVDSEMIQIVDGLFQKTVDREAAGR |
| Ga0302324_1015946401 | 3300031236 | Palsa | FGRMAALRSNRIISISLKEAISRNRIVDDEMIDIVEGLFEGAAADREAAGR |
| Ga0302318_104342112 | 3300031258 | Bog | KIVSIPLLEAISRNRTVDNEMIQIVDGLFEKTVDKEKAPA |
| Ga0318542_104556281 | 3300031668 | Soil | ITLKEAIAKNRVVDAEMIEIAEGLFEEVTVKAASK |
| Ga0310686_1023230551 | 3300031708 | Soil | NKIVSIPLIEAISRNRTVDDEMIQIVDGLFQKVADRQPV |
| Ga0310686_1033587412 | 3300031708 | Soil | NKIVSIPLLDAISRNRTVDEEMIATIEGLFEKVAEREAARG |
| Ga0310686_1074041993 | 3300031708 | Soil | RANKIVSIQLAEAISRNRVVDDEMIRIVDGLFEKAIDKQPA |
| Ga0310686_1158675062 | 3300031708 | Soil | VSIQLAEAISRNRIVDDEMIRIVDGLFEKAVDKQPA |
| Ga0307474_105769341 | 3300031718 | Hardwood Forest Soil | SNKIVSIPLLEAISRNRTVDNEMIQIVDGLFQKADDRQAAGR |
| Ga0307474_108587281 | 3300031718 | Hardwood Forest Soil | LRANKIVSIPLLEAISHNRVVDDEMIQIVDGLFQKVADREPAER |
| Ga0306921_109927572 | 3300031912 | Soil | SEFGCMAALRANRIVSITLKEAISKNRVVDDEVIKIADGLFEEVVVKAASK |
| Ga0307479_120062462 | 3300031962 | Hardwood Forest Soil | YGSMAALRANKIVSIPLKEAIARNRTVDDETIQMVDGLFEEITHKEVVES |
| Ga0307471_1024220411 | 3300032180 | Hardwood Forest Soil | CMAALRSNKIVSIPLLEAISRNRTVDSEMIQIVDGLFQKTGEREVV |
| Ga0335085_120179121 | 3300032770 | Soil | RANKIVSIPLKEAISKNRVVDNEMIQIVDGLFEEIGVKETATK |
| Ga0335078_115496812 | 3300032805 | Soil | GCMAALRANKIVSIPLKEAISQNRVVDDEMIEIASGLFEEIGANAVTR |
| Ga0335072_113849172 | 3300032898 | Soil | SIPLKEAISKNRTVDAEMIQIVDGLFEEIGVKEAAHS |
| ⦗Top⦘ |