| Basic Information | |
|---|---|
| Family ID | F049722 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MKMEEQNGKPKREDVCPGKKNKLDLATARARIAETKGPEFWRSLEE |
| Number of Associated Samples | 133 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 44.52 % |
| % of genes near scaffold ends (potentially truncated) | 99.32 % |
| % of genes from short scaffolds (< 2000 bps) | 91.10 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (52.055 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (10.274 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.918 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.110 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.68% β-sheet: 0.00% Coil/Unstructured: 74.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF14522 | Cytochrome_C7 | 73.97 |
| PF00171 | Aldedh | 9.59 |
| PF01425 | Amidase | 1.37 |
| PF04362 | Iron_traffic | 0.68 |
| PF13304 | AAA_21 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 9.59 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 9.59 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 9.59 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.37 |
| COG2924 | Fe-S cluster biosynthesis and repair protein YggX | Posttranslational modification, protein turnover, chaperones [O] | 1.37 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 52.05 % |
| All Organisms | root | All Organisms | 47.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908043|A2_c1_ConsensusfromContig29754 | Not Available | 749 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100439504 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
| 3300002912|JGI25386J43895_10159403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300004080|Ga0062385_10462992 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300004114|Ga0062593_102522644 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300004479|Ga0062595_100844919 | Not Available | 762 | Open in IMG/M |
| 3300005293|Ga0065715_10457682 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300005337|Ga0070682_101549908 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005437|Ga0070710_10889323 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300005444|Ga0070694_101546221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 562 | Open in IMG/M |
| 3300005458|Ga0070681_10269356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1615 | Open in IMG/M |
| 3300005468|Ga0070707_102120015 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005538|Ga0070731_10332536 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300005544|Ga0070686_100598804 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300005545|Ga0070695_101675049 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300005591|Ga0070761_10643299 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005598|Ga0066706_10798398 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005610|Ga0070763_10059224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1842 | Open in IMG/M |
| 3300005921|Ga0070766_10860177 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300005995|Ga0066790_10068152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1534 | Open in IMG/M |
| 3300005995|Ga0066790_10229654 | Not Available | 792 | Open in IMG/M |
| 3300006031|Ga0066651_10543884 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300006032|Ga0066696_10848928 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300006032|Ga0066696_10911390 | Not Available | 559 | Open in IMG/M |
| 3300006047|Ga0075024_100413343 | Not Available | 689 | Open in IMG/M |
| 3300006050|Ga0075028_100148071 | Not Available | 1237 | Open in IMG/M |
| 3300006050|Ga0075028_100736158 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 596 | Open in IMG/M |
| 3300006052|Ga0075029_100289428 | Not Available | 1043 | Open in IMG/M |
| 3300006052|Ga0075029_101249885 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006057|Ga0075026_100774998 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300006059|Ga0075017_100046645 | All Organisms → cellular organisms → Bacteria | 2899 | Open in IMG/M |
| 3300006237|Ga0097621_100111005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2317 | Open in IMG/M |
| 3300006354|Ga0075021_10030326 | All Organisms → cellular organisms → Bacteria | 3069 | Open in IMG/M |
| 3300006354|Ga0075021_11187173 | Not Available | 501 | Open in IMG/M |
| 3300006755|Ga0079222_10110673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1470 | Open in IMG/M |
| 3300006794|Ga0066658_10103565 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 3300006794|Ga0066658_10739334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300006904|Ga0075424_102148292 | Not Available | 588 | Open in IMG/M |
| 3300009012|Ga0066710_104649070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300009088|Ga0099830_10209152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1530 | Open in IMG/M |
| 3300009148|Ga0105243_12159052 | Not Available | 593 | Open in IMG/M |
| 3300009174|Ga0105241_11508728 | Not Available | 647 | Open in IMG/M |
| 3300009177|Ga0105248_12023361 | Not Available | 654 | Open in IMG/M |
| 3300009521|Ga0116222_1143342 | Not Available | 1028 | Open in IMG/M |
| 3300009631|Ga0116115_1149368 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009665|Ga0116135_1309933 | Not Available | 625 | Open in IMG/M |
| 3300009700|Ga0116217_10326240 | Not Available | 983 | Open in IMG/M |
| 3300009792|Ga0126374_10239007 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300009839|Ga0116223_10908718 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300010047|Ga0126382_12273962 | Not Available | 523 | Open in IMG/M |
| 3300010343|Ga0074044_11129166 | Not Available | 512 | Open in IMG/M |
| 3300010358|Ga0126370_11350347 | Not Available | 670 | Open in IMG/M |
| 3300010373|Ga0134128_10762266 | Not Available | 1073 | Open in IMG/M |
| 3300010379|Ga0136449_101351293 | Not Available | 1105 | Open in IMG/M |
| 3300010400|Ga0134122_10766566 | Not Available | 916 | Open in IMG/M |
| 3300010403|Ga0134123_10052703 | All Organisms → cellular organisms → Bacteria | 3070 | Open in IMG/M |
| 3300011269|Ga0137392_11168072 | Not Available | 628 | Open in IMG/M |
| 3300012096|Ga0137389_10109278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2210 | Open in IMG/M |
| 3300012096|Ga0137389_10299884 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1360 | Open in IMG/M |
| 3300012096|Ga0137389_10553077 | Not Available | 988 | Open in IMG/M |
| 3300012189|Ga0137388_10073408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2858 | Open in IMG/M |
| 3300012205|Ga0137362_10847327 | Not Available | 782 | Open in IMG/M |
| 3300012349|Ga0137387_11191316 | Not Available | 538 | Open in IMG/M |
| 3300012361|Ga0137360_10099173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2225 | Open in IMG/M |
| 3300012362|Ga0137361_11392528 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300012924|Ga0137413_10669274 | Not Available | 784 | Open in IMG/M |
| 3300012925|Ga0137419_10733209 | Not Available | 804 | Open in IMG/M |
| 3300012929|Ga0137404_12160267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300012977|Ga0134087_10619224 | Not Available | 563 | Open in IMG/M |
| 3300012988|Ga0164306_10679802 | Not Available | 816 | Open in IMG/M |
| 3300014745|Ga0157377_10130544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1534 | Open in IMG/M |
| 3300015241|Ga0137418_10172571 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1888 | Open in IMG/M |
| 3300015356|Ga0134073_10143749 | Not Available | 748 | Open in IMG/M |
| 3300015371|Ga0132258_12365057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1332 | Open in IMG/M |
| 3300017656|Ga0134112_10246007 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300017792|Ga0163161_10651741 | Not Available | 872 | Open in IMG/M |
| 3300017924|Ga0187820_1080418 | Not Available | 916 | Open in IMG/M |
| 3300017943|Ga0187819_10666951 | Not Available | 587 | Open in IMG/M |
| 3300017955|Ga0187817_10404666 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300017966|Ga0187776_11180187 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300017995|Ga0187816_10128784 | Not Available | 1091 | Open in IMG/M |
| 3300018016|Ga0187880_1394047 | Not Available | 580 | Open in IMG/M |
| 3300018019|Ga0187874_10459108 | Not Available | 512 | Open in IMG/M |
| 3300018033|Ga0187867_10806725 | Not Available | 509 | Open in IMG/M |
| 3300018040|Ga0187862_10806732 | Not Available | 543 | Open in IMG/M |
| 3300018062|Ga0187784_10804279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 750 | Open in IMG/M |
| 3300018085|Ga0187772_10258168 | Not Available | 1185 | Open in IMG/M |
| 3300018085|Ga0187772_10655310 | Not Available | 750 | Open in IMG/M |
| 3300018086|Ga0187769_10845409 | Not Available | 692 | Open in IMG/M |
| 3300018086|Ga0187769_10989129 | Not Available | 636 | Open in IMG/M |
| 3300018468|Ga0066662_11438402 | Not Available | 715 | Open in IMG/M |
| 3300020579|Ga0210407_11123256 | Not Available | 595 | Open in IMG/M |
| 3300020580|Ga0210403_10955811 | Not Available | 673 | Open in IMG/M |
| 3300020580|Ga0210403_11363176 | Not Available | 539 | Open in IMG/M |
| 3300021171|Ga0210405_10299147 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300021178|Ga0210408_11188030 | Not Available | 583 | Open in IMG/M |
| 3300021180|Ga0210396_11639300 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300021181|Ga0210388_10960108 | Not Available | 734 | Open in IMG/M |
| 3300021402|Ga0210385_10898217 | Not Available | 680 | Open in IMG/M |
| 3300021406|Ga0210386_11410561 | Not Available | 583 | Open in IMG/M |
| 3300021478|Ga0210402_11887332 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300022518|Ga0224548_1038780 | Not Available | 526 | Open in IMG/M |
| 3300022731|Ga0224563_1019313 | Not Available | 597 | Open in IMG/M |
| 3300023030|Ga0224561_1019706 | Not Available | 579 | Open in IMG/M |
| 3300024290|Ga0247667_1110644 | Not Available | 506 | Open in IMG/M |
| 3300025504|Ga0208356_1088385 | Not Available | 593 | Open in IMG/M |
| 3300025627|Ga0208220_1107865 | Not Available | 742 | Open in IMG/M |
| 3300025914|Ga0207671_10389085 | Not Available | 1108 | Open in IMG/M |
| 3300025921|Ga0207652_11327592 | Not Available | 622 | Open in IMG/M |
| 3300025931|Ga0207644_10717500 | Not Available | 834 | Open in IMG/M |
| 3300025932|Ga0207690_10305498 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1246 | Open in IMG/M |
| 3300025934|Ga0207686_10022802 | All Organisms → cellular organisms → Bacteria | 3608 | Open in IMG/M |
| 3300025939|Ga0207665_10448156 | Not Available | 990 | Open in IMG/M |
| 3300025941|Ga0207711_10454774 | All Organisms → cellular organisms → Bacteria | 1192 | Open in IMG/M |
| 3300026298|Ga0209236_1022022 | All Organisms → cellular organisms → Bacteria | 3540 | Open in IMG/M |
| 3300026301|Ga0209238_1029104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2061 | Open in IMG/M |
| 3300026305|Ga0209688_1034743 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300026306|Ga0209468_1001060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12486 | Open in IMG/M |
| 3300026316|Ga0209155_1225326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300026323|Ga0209472_1062531 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1558 | Open in IMG/M |
| 3300026469|Ga0257169_1033034 | Not Available | 777 | Open in IMG/M |
| 3300026514|Ga0257168_1151493 | Not Available | 517 | Open in IMG/M |
| 3300026523|Ga0209808_1236890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300026528|Ga0209378_1106625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1228 | Open in IMG/M |
| 3300026529|Ga0209806_1303044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300027565|Ga0209219_1037608 | Not Available | 1207 | Open in IMG/M |
| 3300027862|Ga0209701_10487137 | Not Available | 672 | Open in IMG/M |
| 3300027869|Ga0209579_10246149 | Not Available | 960 | Open in IMG/M |
| 3300027895|Ga0209624_10635674 | Not Available | 707 | Open in IMG/M |
| 3300027915|Ga0209069_10176295 | Not Available | 1077 | Open in IMG/M |
| 3300028016|Ga0265354_1021576 | Not Available | 613 | Open in IMG/M |
| 3300028807|Ga0307305_10483546 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300028906|Ga0308309_11140183 | Not Available | 673 | Open in IMG/M |
| 3300028906|Ga0308309_11318532 | Not Available | 620 | Open in IMG/M |
| 3300029636|Ga0222749_10688506 | Not Available | 559 | Open in IMG/M |
| 3300031708|Ga0310686_110135183 | Not Available | 593 | Open in IMG/M |
| 3300031720|Ga0307469_10199769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1560 | Open in IMG/M |
| 3300031962|Ga0307479_10721818 | Not Available | 975 | Open in IMG/M |
| 3300032160|Ga0311301_10020916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 18410 | Open in IMG/M |
| 3300032180|Ga0307471_100902185 | Not Available | 1051 | Open in IMG/M |
| 3300032783|Ga0335079_12323008 | Not Available | 509 | Open in IMG/M |
| 3300032805|Ga0335078_11724782 | Not Available | 685 | Open in IMG/M |
| 3300032892|Ga0335081_10374780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1842 | Open in IMG/M |
| 3300032892|Ga0335081_10858901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300032893|Ga0335069_10416286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1574 | Open in IMG/M |
| 3300033433|Ga0326726_10017720 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6203 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.22% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 6.85% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.42% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.74% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.74% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.05% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.05% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.05% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.05% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.05% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.37% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.37% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.37% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.68% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.68% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.68% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908043 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Host-Associated | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A2_c1_00971070 | 2124908043 | Soil | MEEIKKREDVCPSKRDTLDLETARARIEETKGPEFWRS |
| JGIcombinedJ26739_1004395042 | 3300002245 | Forest Soil | MEEENNKQQREEVCPGKKDKLDLRTARARIAETKGPEYWRSLEEL |
| JGI25386J43895_101594032 | 3300002912 | Grasslands Soil | MNMDRQNGKSXREEXCPGKKXKLDLATARACIAQTKGPEYWRSLEELAGSAE |
| Ga0062385_104629922 | 3300004080 | Bog Forest Soil | MKMEPENAKPHREEVCPGKKDKLDLATAQARIAEAKGPEYWRSLEELAGST |
| Ga0062593_1025226441 | 3300004114 | Soil | MKIEETRKREDGCPGKHEKLDLATARARIEKTKGPEFWRSLE |
| Ga0062595_1008449192 | 3300004479 | Soil | MEEQPVKPQREDVCPSKQGTLDLDAARARVAETNGPEYWRS |
| Ga0065715_104576821 | 3300005293 | Miscanthus Rhizosphere | MEEQPVKPQREDVCPSKQGTLDLDAARARVAETNGPEYWRSLEELAGSPDF |
| Ga0070682_1015499082 | 3300005337 | Corn Rhizosphere | LLDLSPIVMKMEEQNGKAHQHQEDVCPGKKGKLDFETVRAQIAETKGPEFWRSLEELAGSEEFR |
| Ga0070710_108893232 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MEEQKTTKREDVCPSKRNTLDLDTARAQIERTQGPEYWRSLEELAGS |
| Ga0070694_1015462211 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MKTENNNPRRQDICPTKKGKLDLDAACDRIAGTQGPEYWRSLEELAGSPDFQ |
| Ga0070681_102693563 | 3300005458 | Corn Rhizosphere | MKMEQQPGKPHREDVCPSKKGTLDLDAARAKLAEAQGPEYWRSLE |
| Ga0070707_1021200151 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKMEEQNGKPKREDVCPGKKNKLDLATARARIAETKGPEFWRSLEE |
| Ga0070731_103325361 | 3300005538 | Surface Soil | LKVIEEENKKPHREEVCPGKKDKLDLKAVSEQIAATRGPEYWRSLE |
| Ga0070686_1005988042 | 3300005544 | Switchgrass Rhizosphere | MKIEETRKREDGCPGKHEKLDLATARARLEKTKGPEFWRSLE |
| Ga0070695_1016750491 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MEDQNTKPRREDVCPSKKGTLDLDAARARVAGTKGPEYWRSLEEL |
| Ga0070761_106432991 | 3300005591 | Soil | MEEENNRQHREEVCPGKKDKLDLKTVRAQIAQTKGPEYWRSLEEL |
| Ga0066706_107983982 | 3300005598 | Soil | MNIDRQNGKSRREEVCPGKKDKLDLATARARIEQTKGPEYWRSLEELAGS |
| Ga0070763_100592241 | 3300005610 | Soil | MKSVDQDGKQHREDVCPGKKDKLDLKTARAQIAGTKGPEYWRSLEELAGSAE |
| Ga0070766_108601771 | 3300005921 | Soil | MEEENNKQHREEVCPGKKDKLDLKTVRAQIAQTKGPEYWRSLEELA |
| Ga0066790_100681523 | 3300005995 | Soil | MKTKEQNGKARRQNEEVCPSKRGTLDLNTAHARIAETQGPEFWRSLEELAGSAEF |
| Ga0066790_102296541 | 3300005995 | Soil | MKMEEKPAKPHREDVCPSKKGALDLDAARARVAETNGPEYWRSLEE |
| Ga0066651_105438841 | 3300006031 | Soil | MNMDRQNGKSRREEVCPGKKDKLDLATARARIEQTKGPEYWRSLEELAGSAE |
| Ga0066696_108489281 | 3300006032 | Soil | MKLEKKNGKPRREDICPTKAGKLGLDAARTRLAEATGAEYWRSLEELAGSPDFQE |
| Ga0066696_109113902 | 3300006032 | Soil | MEPQNGKSRREEVCPGKKDKLDLATARACIAQTKGPE |
| Ga0075024_1004133431 | 3300006047 | Watersheds | MKMEDPNTTPHREDVCPSKKGSLDLDAARAKLGETQGPEY |
| Ga0075028_1001480711 | 3300006050 | Watersheds | MKTEEKNGNPRREDICPTKRGKLDLDAARARIAETKGPEY |
| Ga0075028_1007361581 | 3300006050 | Watersheds | MKKEQENNPRREDVCPTKKGKLDLDAAREKLAGTNGLEYWRSLEELAGS |
| Ga0075029_1002894281 | 3300006052 | Watersheds | MKMEEQTAKPHREDVCPSKKGTLDLDAARARVAETKGPEYWRSLE |
| Ga0075029_1012498852 | 3300006052 | Watersheds | MEPERHKQHPEDVCPGKKKSLDLSTAEARIAETRGPEFWRSLEELAG |
| Ga0075026_1007749981 | 3300006057 | Watersheds | MSMEDQNTKPRREEVCPSKKGTLDLDAARARVAETQGPEYWRSLE |
| Ga0075017_1000466451 | 3300006059 | Watersheds | MKEEKQNAKAHREEVCPTKKGKLDLDAARNQIAGTNGPEYWRSLE |
| Ga0097621_1001110051 | 3300006237 | Miscanthus Rhizosphere | MDEQNGKAHQEDICPGKKGKLDLETVRAQIAETQGPEFWR |
| Ga0075021_100303265 | 3300006354 | Watersheds | MKIADQDLKPHREEVCPGKKDKLDLKTARAQIAQTKGPEYWRSLEELAGSSE |
| Ga0075021_111871731 | 3300006354 | Watersheds | MKMDEANGKKHREEVCPGKKDKLDVATARSQIANASGPEYWRSLE |
| Ga0079222_101106733 | 3300006755 | Agricultural Soil | MKMEENNGKRHREEVCPGKKDKLDLQTVREKIAQAKGPEYWR |
| Ga0066658_101035651 | 3300006794 | Soil | MNIDQQNGKSRREEVCPGKKDKLDLATARACIAQT |
| Ga0066658_107393341 | 3300006794 | Soil | MNMDRQNGKSRREEVCPGKKDKLDLATARACIAQTKGP |
| Ga0075424_1021482921 | 3300006904 | Populus Rhizosphere | MKMDEQNVKPHREDVCPSKKGKLDLSAARDRIARTQG |
| Ga0066710_1046490701 | 3300009012 | Grasslands Soil | MNMDRQNGKSRREEVCPGKKDKLDLATARACIAQTK |
| Ga0099830_102091521 | 3300009088 | Vadose Zone Soil | MKKEEKQNAKPHREDVCPTKKGKLDLDAARDRIAGTQGPEYW |
| Ga0105243_121590521 | 3300009148 | Miscanthus Rhizosphere | MKIEETRKREDGCPGKHEKLDLATARARLEKTKGPEFWRSLEEL |
| Ga0105241_115087282 | 3300009174 | Corn Rhizosphere | MKNQSTKPRRKDVCPSKKGALDLDAARARVAETQGPEYWR |
| Ga0105248_120233611 | 3300009177 | Switchgrass Rhizosphere | MKIEETRKREDGCPGKHEKLDLATARARLEKTKGPEFWRSLEELAGSD |
| Ga0116222_11433422 | 3300009521 | Peatlands Soil | MEEQKNKRAHEDVCPGKKHQLDLKTARAQIAETNGPEYWRSLEELAGS |
| Ga0116115_11493681 | 3300009631 | Peatland | MSMDKVGKQHREEICPGKRNKLDLEQVRERVAGTKGPEFWRSLEELAGNSEFQDM |
| Ga0116135_13099331 | 3300009665 | Peatland | MKEENNQRRREEVCPGKKDKLDLQTVRAQIAQTKGPEYWRSLEELA |
| Ga0116217_103262401 | 3300009700 | Peatlands Soil | MKMKEQDGKPQREDVCPDKRNQLDLETARARIAETKG |
| Ga0126374_102390071 | 3300009792 | Tropical Forest Soil | MSDSSKNNARPEEVCPGKKGKLDLASVRERVAATKGPEYWRSL |
| Ga0116223_109087182 | 3300009839 | Peatlands Soil | MEENNKPHREDVCPGKKGKLDLRTARAQIAGTNGPEYWRSLEELAGSSEFQ |
| Ga0126382_122739621 | 3300010047 | Tropical Forest Soil | MKMEEQNGKAHQEDICPGKKGKLDLETVRAQIAETKGPEFWRSLEELAGTEEF |
| Ga0074044_111291661 | 3300010343 | Bog Forest Soil | MKTEPQNGKAHREEVCPGKKGKLDLESVRDRVAQTQGPEFWRSLEELAGS |
| Ga0126370_113503472 | 3300010358 | Tropical Forest Soil | MKKEQQNPGREDICPGKRSKLDLKAARACLRETRGPEFWRSLEEL |
| Ga0134128_107622661 | 3300010373 | Terrestrial Soil | MKMEEQNGKPHQEEVCPGKKDKLNLESANALIAETKGPEFWRSLEELAGSGE |
| Ga0136449_1013512932 | 3300010379 | Peatlands Soil | MKMPEQDGKQHREEVCPGKKATLDLETVRARVAETKGPEFWRSLEELAGS |
| Ga0134122_107665662 | 3300010400 | Terrestrial Soil | MEDQNTKPRSEDVCPSKKGTLDLEAARARVAETQGPEYWRSLEELAG |
| Ga0134123_100527031 | 3300010403 | Terrestrial Soil | MKMEEQPEKPRREDVCPSKKGALDLDAARDRLAEAQGPEYWRSLEELAG |
| Ga0137392_111680721 | 3300011269 | Vadose Zone Soil | MTMKEQNDKREEICPGKKGKLDLETARARIAETKGPEFWRSLEEL |
| Ga0137389_101092783 | 3300012096 | Vadose Zone Soil | MKEEKQNAKPHREDVCPTKKGKLDLDAARDRIAGTQGPEYWRSLEELAGSP |
| Ga0137389_102998841 | 3300012096 | Vadose Zone Soil | MKMEEQNAKPHREEVCPSKKGTLDLDAARARVAETKGPEYWRSLEELAGS |
| Ga0137389_105530772 | 3300012096 | Vadose Zone Soil | MKMEEQRGRPTREDVCPGKRNKLDLETARARIAETKGLEFWRSLEELAGSPE |
| Ga0137388_100734081 | 3300012189 | Vadose Zone Soil | MEMEEEKNNSRREDVCPTKKGKLDLDAARDRIAATKGPEYWRSL |
| Ga0137362_108473271 | 3300012205 | Vadose Zone Soil | MEPQNGKPRREEVCPGKKDKLDLATARACIAQTKGPEYW |
| Ga0137387_111913161 | 3300012349 | Vadose Zone Soil | MNIDQQNGKSRREEVGPGKKDKLDLSTARACIAQTK |
| Ga0137360_100991731 | 3300012361 | Vadose Zone Soil | MNMDRQNGKSRREEVCPGKKDKLDLATARACIAQTKGPEYWRSLEELAGS |
| Ga0137361_113925282 | 3300012362 | Vadose Zone Soil | MNMDRQNEKSRREEVCPGKKDKLDLATARACIAQTKGPEYWRSLEELAGS |
| Ga0137413_106692741 | 3300012924 | Vadose Zone Soil | MEDKNTKPHREDVCPSKKGTLDLDAARDRLAETNGPEYWRS |
| Ga0137419_107332091 | 3300012925 | Vadose Zone Soil | MKMEERKDNARRQDVCPTKKGKLDLDAARDRIAGTKG |
| Ga0137404_121602671 | 3300012929 | Vadose Zone Soil | MDRQNGKSRREEVCPGKKDKLDLATARACIAQTKGPEYW |
| Ga0134087_106192242 | 3300012977 | Grasslands Soil | MNIDRQNGKSRREEVCPGKKDKLELATARARIEQTKGPEYWRSLEELAG |
| Ga0164306_106798021 | 3300012988 | Soil | MKMEEQPEKPRREDVCPSKKGALDLDAARDRLAEAQGPEYWRSLEE |
| Ga0157377_101305443 | 3300014745 | Miscanthus Rhizosphere | MKMEEQNGKAHQHQEDVCPGKKGKLDFETVRAQIAETKGPEFWRSLEELAGSE |
| Ga0137418_101725711 | 3300015241 | Vadose Zone Soil | MKMEERKDNARRQDVCPTKKGKLDLDAARDRIAGTKGPEYWRSLEEL |
| Ga0134073_101437492 | 3300015356 | Grasslands Soil | MEPQNGKSRREEVCPGKKDKLDLATARACIAQTKGPEYWRSLEELAGSA |
| Ga0132258_123650573 | 3300015371 | Arabidopsis Rhizosphere | MSMEDQNTKPRSEDVCPSKKGTLDLDAARARVAETSGPEYWRSLEELAGSPDFQ |
| Ga0134112_102460072 | 3300017656 | Grasslands Soil | MNMDRQNGKSRREEICPGKKSKIDLATARARIEQTK |
| Ga0163161_106517412 | 3300017792 | Switchgrass Rhizosphere | MKMEEQPEKPRREDVCPSKKGALDLDAARDRLAEAQGPEYWRSL |
| Ga0187820_10804181 | 3300017924 | Freshwater Sediment | MGEQNIKPHREDVCPSKKGTLDLDAARAKLAETKGPEYWR |
| Ga0187819_106669511 | 3300017943 | Freshwater Sediment | MKSDEQNGNGHREEVCPGKKGKLDLETVRARIGQTKGPEFWRSLEELAGSAEF |
| Ga0187817_104046661 | 3300017955 | Freshwater Sediment | MKFDPQNGKAQREDVCPSKKHLDLETVRARIAETKGPEF |
| Ga0187776_111801872 | 3300017966 | Tropical Peatland | MKREEQNREAVCPSKKGQLDLETARARIAETKGPEFWRSLEELAG |
| Ga0187816_101287842 | 3300017995 | Freshwater Sediment | MEPQNKHREEVCPGKKGKLDLETARKRIAQTKGPEFWR |
| Ga0187880_13940472 | 3300018016 | Peatland | MSMDKVGKQHREEICPGKRNKLDLEQVRERVAGTKGPEFWRSLEELAGNSEF |
| Ga0187874_104591082 | 3300018019 | Peatland | MEEQKNKRAHEDVCPGKKDKLDLQTVRAQIAQTKGPEYWRS |
| Ga0187867_108067251 | 3300018033 | Peatland | MEEQKNKRAHEDVCPGKKDKLDLQTVRAQIAQTKGPE |
| Ga0187862_108067321 | 3300018040 | Peatland | MSMDKVGKQHREEICPGKRNKLDLEQVRERVAGTKGPEFWRSLEEL |
| Ga0187784_108042792 | 3300018062 | Tropical Peatland | KKMEDDRAKQHREEVCPGKKNSLGRKTAEARIAETKGPEFWRSLEELAGSE |
| Ga0187772_102581682 | 3300018085 | Tropical Peatland | MKNEPQNGHREEVCPGKKLLDLDTVRAHIAETKGPEFWR |
| Ga0187772_106553101 | 3300018085 | Tropical Peatland | MNEQNSTSRAEAVCPGKKDKLSLETARARIAQTKGPEFW |
| Ga0187769_108454091 | 3300018086 | Tropical Peatland | MKQMADNNAKQRREDVCPGKKNSLDLKTAEARIAETKGPEFWRSLEELA |
| Ga0187769_109891292 | 3300018086 | Tropical Peatland | MNEQNNTSRAEAVCPGKKDKLDLATARARIAETKGPEFWR |
| Ga0066662_114384022 | 3300018468 | Grasslands Soil | MEDPNKHEHREEVCPGKKDKLSLESVRAQLAETKGPEYWRSLEELAG |
| Ga0210407_111232562 | 3300020579 | Soil | MKMEEQAAKPQREDVCPSKKGTLDLDAARARVAETNGPEYWRS |
| Ga0210403_109558111 | 3300020580 | Soil | MEEENNKQHREEVCPGKKDKLNLETARAQIAGTKGPEYWRSLEELAGSAEF |
| Ga0210403_113631761 | 3300020580 | Soil | MKEKEQNAKPHREDVCPTKKGKLDLDAARDRIAGTKGPEYWRSLEELAGSADFQE |
| Ga0210405_102991473 | 3300021171 | Soil | MEEENNQQHREEVCPGKKGKLDLQTVRAQIAQTKGPEYW |
| Ga0210408_111880301 | 3300021178 | Soil | MEEQKNKHREEVCPGKTDKLDLITARAQIAQTKGPEYWR |
| Ga0210396_116393001 | 3300021180 | Soil | MEEQNNKQHREEVCPGKKDKLNLETARAQIAGTKGPEYWRSLEELAGSAEFQ |
| Ga0210388_109601082 | 3300021181 | Soil | MEEENDKQHREEVCPGKKDKLDLKTVRAQIAQTKGPEYWR |
| Ga0210385_108982171 | 3300021402 | Soil | MEEENKKPHREEVCPGKKDKLDLKAVSAQIAATKGPEY |
| Ga0210386_114105612 | 3300021406 | Soil | VSSVRFWKFYNEMEEHKNKREDVCPGKKDKLDLKTARAQIAETKGPEYWRSLEELAGSSAFQ |
| Ga0210402_118873321 | 3300021478 | Soil | MEDKNKPHREDVCPSKKGTLDLDAARAKLAETNGPEYWRSLEELAGS |
| Ga0224548_10387801 | 3300022518 | Soil | MEEQNKKPHREEVCPGKKDKLDLKAVSAQIAATKGPEYWRSLEE |
| Ga0224563_10193131 | 3300022731 | Soil | MKEETKQRHREEVCPSKKDKLDLQTVRAQIAQTKGPEYWRSLEELAGSA |
| Ga0224561_10197062 | 3300023030 | Soil | MKEETKQRHREEVCPSKKDKLDLQTVRAQIAQTKGPEYWRSL |
| Ga0247667_11106441 | 3300024290 | Soil | MEEQPEKPRREDVCPSKKGTLDLDAARARVAETQGPEYWRSLEEL |
| Ga0208356_10883852 | 3300025504 | Arctic Peat Soil | VAMMEKDNRKQHIEAVCPSKKDKLDLETARARIAETKG |
| Ga0208220_11078652 | 3300025627 | Arctic Peat Soil | MMEKEKNNGSHHEPVCPSKTNKLDIETARARIAETKGPEYWRSLEELAGST |
| Ga0207671_103890852 | 3300025914 | Corn Rhizosphere | MSMEDQNTKPRREDVCPSKKGTLDLDAARARVAETSGPEYWRSLEEL |
| Ga0207652_113275921 | 3300025921 | Corn Rhizosphere | MKMEEQPEKPRREDVCPSKKGALDLDAARDRLAEAQGPEYWRSLEELAGSP |
| Ga0207644_107175001 | 3300025931 | Switchgrass Rhizosphere | MKMEENNGKRHREEVCPGKKDKLDLQTVREKIAQA |
| Ga0207690_103054981 | 3300025932 | Corn Rhizosphere | MKMEEQPEKPRREDVCPSKKGALDLDAARDRMAAAQGPEY |
| Ga0207686_100228021 | 3300025934 | Miscanthus Rhizosphere | MEEQPEKPRREDVCPSKKGALDLDAARDRLAEAQGPEYWRSLEELAGSPDYQ |
| Ga0207665_104481562 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNMDQQNGKSRREEVCPGKKDKLDLATARARIEQTKGPEYWRS |
| Ga0207711_104547742 | 3300025941 | Switchgrass Rhizosphere | MKIEETRKREDGCPGKHEKLDLATARARLEKTKGPEFW |
| Ga0209236_10220221 | 3300026298 | Grasslands Soil | MEPQNGKSRREEVCPGKKDKLDLATARACIAQTKGPEYWRSLEEL |
| Ga0209238_10291041 | 3300026301 | Grasslands Soil | MEPQNGKSRREEVCPGKKDKLDLATARACIAQTKGPEYWRSLE |
| Ga0209688_10347432 | 3300026305 | Soil | MNMDRQNGKSRREEVCPGKKDKLDLATARACIAQTKGPEYWRSLEELAGSAE |
| Ga0209468_10010601 | 3300026306 | Soil | MEPQNGKSRREDVCPGKKDKLDLATARACIAQTKGPEYWRSLEELAGS |
| Ga0209155_12253262 | 3300026316 | Soil | MNMDRQNGKSRREEVCPGKKDKLDLATARACIAQTKGPEYWRSLEELAGSA |
| Ga0209472_10625314 | 3300026323 | Soil | MNMDRQNGKSRREEVCPGKKDKLDLATARACIAQTKGPEYWRSLEELAGSAEFQ |
| Ga0257169_10330342 | 3300026469 | Soil | MKMEERKDNARRQDVCPTKKGKLDLDAARDRIAGTKGPEY |
| Ga0257168_11514932 | 3300026514 | Soil | MKMEDKNSKPHREDVCPSKKGTLDLDAARARLAESKGPEYW |
| Ga0209808_12368902 | 3300026523 | Soil | MNMDRQNGKSRREEVCPGKKDKLDLATARACIAQTKGPEYWRSLEEL |
| Ga0209378_11066251 | 3300026528 | Soil | MNMDRQNGKSRREEVCPGKKDKLDLATARACIAQTKGPEYW |
| Ga0209806_13030442 | 3300026529 | Soil | MNMDRQNGKSRREEVCPGKKDKLDLATARACIAQTKG |
| Ga0209219_10376081 | 3300027565 | Forest Soil | MEEENNKQHREEVCPGQKGKLDLKTARAQIAETKGPEYW |
| Ga0209701_104871371 | 3300027862 | Vadose Zone Soil | MKEEKQNAKPHREDVCPTKKGKLDLDAARDRIAGTQGPEYWRSLEELA |
| Ga0209579_102461492 | 3300027869 | Surface Soil | LKVIEEENKKPHREEVCPGKKDKLDLKAVSEQIAATRGPEYWRSLEEL |
| Ga0209624_106356742 | 3300027895 | Forest Soil | MEEHKHTPRREDLCPGKLDKLDLKTARAQIAGTTGPEYWRSLE |
| Ga0209069_101762952 | 3300027915 | Watersheds | MEEQNNKQHREDVCPGKKDKLNLETARARIAGTKGPEYWRSLE |
| Ga0265354_10215761 | 3300028016 | Rhizosphere | MEEQNNKQHREEVCPGKKDKLNLETARAQIAGTKGPEYW |
| Ga0307305_104835462 | 3300028807 | Soil | MKMEEKVNPRREDVCPTKKGKLDLDAARERIAGTNGP |
| Ga0308309_111401831 | 3300028906 | Soil | MKMEDQDENAHREAVCPSKKGSLHLDAARAALAETKGPEFWRSLEELA |
| Ga0308309_113185321 | 3300028906 | Soil | MKSADQDGKQHREDVCPGKKDKLDLKTARAQIAGTKGPEYWRSLE |
| Ga0222749_106885061 | 3300029636 | Soil | MMEEKNGKQHVEAVCPSKKDKLDLETARARIAETKGPEYW |
| Ga0310686_1101351831 | 3300031708 | Soil | MEEQNNKQHREDVCPGKKDKLNLETARAQIAGTKGPEYWRSL |
| Ga0307469_101997691 | 3300031720 | Hardwood Forest Soil | MKMEEQDDKGRPEAVCPSKKSALDLDDARARLAETKGPEFW |
| Ga0307479_107218181 | 3300031962 | Hardwood Forest Soil | MEEKNGKQHVEAVCPSKKDKLDLETAGARIAETKGPEYWR |
| Ga0311301_100209161 | 3300032160 | Peatlands Soil | MEEQKNKQHREEVCPGKKDKLDLKTARAQIAGTKGPEYWRSLEELAGG |
| Ga0307471_1009021853 | 3300032180 | Hardwood Forest Soil | MKMEKQNGKRRGENVCPGKKNKLDLETARARIADTRGP |
| Ga0335079_123230081 | 3300032783 | Soil | MKMEEQDGKEHREAVCPSKKGTLDMDAARAVLAETKGP |
| Ga0335078_117247821 | 3300032805 | Soil | MMKNDNQNANRHREEICPGKKGKLDLETARARIGQTKGPEFWRSLEELAG |
| Ga0335081_103747803 | 3300032892 | Soil | MEEQNKHREEVCPGKKGKLSFDEARDRIAQTQGPE |
| Ga0335081_108589011 | 3300032892 | Soil | MTDINNKPRAEEVCPGKKDKLDLETARARIAETKGPEFWRSLEELA |
| Ga0335069_104162861 | 3300032893 | Soil | MKMEDKNKPHREDVCPSKKGTLDLDAARAKLAETNGPEY |
| Ga0326726_100177205 | 3300033433 | Peat Soil | MTMEDQNAKPRREDVCPSKKGKLDLDAARDRLAETQGPE |
| ⦗Top⦘ |