NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049712

Metagenome / Metatranscriptome Family F049712

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049712
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 39 residues
Representative Sequence MKAAVRQQLDPTIRSNDTRDFHTSLRAKIVGQEEGVQ
Number of Associated Samples 127
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.63 %
% of genes near scaffold ends (potentially truncated) 96.58 %
% of genes from short scaffolds (< 2000 bps) 89.04 %
Associated GOLD sequencing projects 119
AlphaFold2 3D model prediction Yes
3D model pTM-score0.33

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.411 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(24.657 % of family members)
Environment Ontology (ENVO) Unclassified
(28.767 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.315 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 23.08%    β-sheet: 0.00%    Coil/Unstructured: 76.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.33
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF10431ClpB_D2-small 36.99
PF02954HTH_8 4.11
PF07724AAA_2 1.37
PF01035DNA_binding_1 1.37
PF13493DUF4118 1.37
PF13545HTH_Crp_2 0.68
PF01063Aminotran_4 0.68
PF00873ACR_tran 0.68
PF13231PMT_2 0.68
PF00437T2SSE 0.68
PF13732DUF4162 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG0115Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyaseAmino acid transport and metabolism [E] 1.37
COG0350DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase)Replication, recombination and repair [L] 1.37
COG3695Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domainTranscription [K] 1.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms90.41 %
UnclassifiedrootN/A9.59 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_101974565All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300004080|Ga0062385_10597154All Organisms → cellular organisms → Bacteria697Open in IMG/M
3300004633|Ga0066395_10383255All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter788Open in IMG/M
3300004635|Ga0062388_101789432Not Available630Open in IMG/M
3300005167|Ga0066672_10042762All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter2558Open in IMG/M
3300005440|Ga0070705_101863791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300005538|Ga0070731_10023220All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4264Open in IMG/M
3300005556|Ga0066707_10130512All Organisms → cellular organisms → Bacteria1575Open in IMG/M
3300005559|Ga0066700_10754739All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_57_11660Open in IMG/M
3300005561|Ga0066699_10814403All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium657Open in IMG/M
3300005566|Ga0066693_10023878All Organisms → cellular organisms → Bacteria1879Open in IMG/M
3300005566|Ga0066693_10209558All Organisms → cellular organisms → Bacteria → Acidobacteria760Open in IMG/M
3300005598|Ga0066706_10021908All Organisms → cellular organisms → Bacteria3901Open in IMG/M
3300005607|Ga0070740_10221831All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300005841|Ga0068863_101269146All Organisms → cellular organisms → Bacteria → Acidobacteria743Open in IMG/M
3300006237|Ga0097621_102292469All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300006800|Ga0066660_10901911All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300006804|Ga0079221_10192306All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300006806|Ga0079220_11870200All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA531Open in IMG/M
3300006893|Ga0073928_10165103All Organisms → cellular organisms → Bacteria1771Open in IMG/M
3300006893|Ga0073928_10959210All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium584Open in IMG/M
3300007076|Ga0075435_100762077All Organisms → cellular organisms → Bacteria → Acidobacteria842Open in IMG/M
3300007265|Ga0099794_10775828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium512Open in IMG/M
3300009038|Ga0099829_10112452All Organisms → cellular organisms → Bacteria2134Open in IMG/M
3300009553|Ga0105249_11217940All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300009624|Ga0116105_1085401All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300009641|Ga0116120_1016636All Organisms → cellular organisms → Bacteria2751Open in IMG/M
3300010048|Ga0126373_10196448All Organisms → cellular organisms → Bacteria1952Open in IMG/M
3300010048|Ga0126373_11974709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella pittospori646Open in IMG/M
3300010343|Ga0074044_10716905All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300010361|Ga0126378_11204970All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA855Open in IMG/M
3300010361|Ga0126378_12788480All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300010398|Ga0126383_12042436All Organisms → cellular organisms → Bacteria → Acidobacteria660Open in IMG/M
3300010400|Ga0134122_11830165All Organisms → cellular organisms → Bacteria640Open in IMG/M
3300011269|Ga0137392_11217180Not Available611Open in IMG/M
3300011270|Ga0137391_11319275All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA568Open in IMG/M
3300011271|Ga0137393_11244860All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium631Open in IMG/M
3300012096|Ga0137389_11331864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium612Open in IMG/M
3300012202|Ga0137363_10248758All Organisms → cellular organisms → Bacteria1444Open in IMG/M
3300012203|Ga0137399_10723516All Organisms → cellular organisms → Bacteria → Acidobacteria838Open in IMG/M
3300012361|Ga0137360_10195264All Organisms → cellular organisms → Bacteria1635Open in IMG/M
3300012362|Ga0137361_11940875All Organisms → cellular organisms → Bacteria → Acidobacteria505Open in IMG/M
3300012683|Ga0137398_10584321All Organisms → cellular organisms → Bacteria → Acidobacteria772Open in IMG/M
3300012685|Ga0137397_10608527All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300012685|Ga0137397_10690847All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA758Open in IMG/M
3300012685|Ga0137397_11293043Not Available519Open in IMG/M
3300012685|Ga0137397_11359432All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA501Open in IMG/M
3300012918|Ga0137396_10982489All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300012923|Ga0137359_10166953All Organisms → cellular organisms → Bacteria1964Open in IMG/M
3300012923|Ga0137359_10397354All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300012925|Ga0137419_10273497All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300012927|Ga0137416_10280485All Organisms → cellular organisms → Bacteria1373Open in IMG/M
3300012929|Ga0137404_10234860All Organisms → cellular organisms → Bacteria1568Open in IMG/M
3300012944|Ga0137410_10136778All Organisms → cellular organisms → Bacteria1854Open in IMG/M
3300012944|Ga0137410_11189425All Organisms → cellular organisms → Bacteria656Open in IMG/M
3300012944|Ga0137410_11736299Not Available550Open in IMG/M
3300013503|Ga0120127_10043487All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300013503|Ga0120127_10113117Not Available619Open in IMG/M
3300014153|Ga0181527_1257608All Organisms → cellular organisms → Bacteria → Acidobacteria701Open in IMG/M
3300015193|Ga0167668_1051646All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300015241|Ga0137418_11211799Not Available530Open in IMG/M
3300015245|Ga0137409_11499826All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA522Open in IMG/M
3300016270|Ga0182036_11157382All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium642Open in IMG/M
3300016294|Ga0182041_11879351All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300016387|Ga0182040_10565892All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300016445|Ga0182038_11809129All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium551Open in IMG/M
3300017934|Ga0187803_10107057All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300017966|Ga0187776_10106876All Organisms → cellular organisms → Bacteria1674Open in IMG/M
3300017970|Ga0187783_11321141All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium520Open in IMG/M
3300017973|Ga0187780_11395329All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300017994|Ga0187822_10314543All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA556Open in IMG/M
3300018001|Ga0187815_10130570All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300018019|Ga0187874_10259044All Organisms → cellular organisms → Bacteria → Acidobacteria712Open in IMG/M
3300018060|Ga0187765_10158460All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300018431|Ga0066655_10742100All Organisms → cellular organisms → Bacteria → Acidobacteria666Open in IMG/M
3300018433|Ga0066667_11446379All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300019268|Ga0181514_1031522All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA534Open in IMG/M
3300019888|Ga0193751_1008415All Organisms → cellular organisms → Bacteria → Acidobacteria5550Open in IMG/M
3300019890|Ga0193728_1023608All Organisms → cellular organisms → Bacteria3072Open in IMG/M
3300020579|Ga0210407_10002473All Organisms → cellular organisms → Bacteria15822Open in IMG/M
3300020579|Ga0210407_10036659All Organisms → cellular organisms → Bacteria → Acidobacteria3648Open in IMG/M
3300020579|Ga0210407_11195076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300020580|Ga0210403_10248398All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300020582|Ga0210395_11396458All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA511Open in IMG/M
3300020583|Ga0210401_10178713All Organisms → cellular organisms → Bacteria1978Open in IMG/M
3300021046|Ga0215015_10006271All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300021086|Ga0179596_10450353All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300021168|Ga0210406_10854923All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA688Open in IMG/M
3300021170|Ga0210400_10087617All Organisms → cellular organisms → Bacteria2453Open in IMG/M
3300021405|Ga0210387_11233069All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA648Open in IMG/M
3300021432|Ga0210384_11086330All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300021479|Ga0210410_10330070All Organisms → cellular organisms → Bacteria1368Open in IMG/M
3300021559|Ga0210409_10159995All Organisms → cellular organisms → Bacteria2061Open in IMG/M
3300021560|Ga0126371_10836695All Organisms → cellular organisms → Bacteria1066Open in IMG/M
3300021560|Ga0126371_12188470All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium667Open in IMG/M
3300024222|Ga0247691_1041487All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA698Open in IMG/M
3300024288|Ga0179589_10104749All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300024330|Ga0137417_1033739All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300024330|Ga0137417_1430755All Organisms → cellular organisms → Bacteria8797Open in IMG/M
3300025898|Ga0207692_10380093All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300025929|Ga0207664_11587473All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300025939|Ga0207665_10413123All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300026222|Ga0209862_1056700All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales693Open in IMG/M
3300026285|Ga0209438_1027598All Organisms → cellular organisms → Bacteria1890Open in IMG/M
3300026297|Ga0209237_1224501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300026301|Ga0209238_1210327Not Available571Open in IMG/M
3300026301|Ga0209238_1211856All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium569Open in IMG/M
3300026317|Ga0209154_1119045All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_57_111117Open in IMG/M
3300026475|Ga0257147_1075827All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium518Open in IMG/M
3300026551|Ga0209648_10699102All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA554Open in IMG/M
3300027035|Ga0207776_1025648All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium768Open in IMG/M
3300027313|Ga0207780_1064518All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA620Open in IMG/M
3300027376|Ga0209004_1094713Not Available506Open in IMG/M
3300027643|Ga0209076_1125715All Organisms → cellular organisms → Bacteria723Open in IMG/M
3300027643|Ga0209076_1181123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300027671|Ga0209588_1085169All Organisms → cellular organisms → Bacteria1020Open in IMG/M
3300027674|Ga0209118_1099291All Organisms → cellular organisms → Bacteria823Open in IMG/M
3300027678|Ga0209011_1002120All Organisms → cellular organisms → Bacteria → Acidobacteria7040Open in IMG/M
3300027701|Ga0209447_10180128All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA579Open in IMG/M
3300027737|Ga0209038_10058043Not Available1159Open in IMG/M
3300027738|Ga0208989_10278671Not Available539Open in IMG/M
3300027857|Ga0209166_10425289All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA687Open in IMG/M
3300027875|Ga0209283_10415962All Organisms → cellular organisms → Bacteria875Open in IMG/M
3300027875|Ga0209283_10651541All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300027898|Ga0209067_10557380All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes655Open in IMG/M
3300028536|Ga0137415_10448460All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300031543|Ga0318516_10180260All Organisms → cellular organisms → Bacteria1217Open in IMG/M
3300031573|Ga0310915_10404599Not Available969Open in IMG/M
3300031715|Ga0307476_11314580Not Available527Open in IMG/M
3300031736|Ga0318501_10158695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1168Open in IMG/M
3300031754|Ga0307475_10675779All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300031879|Ga0306919_10366376All Organisms → cellular organisms → Bacteria1102Open in IMG/M
3300031912|Ga0306921_10385551All Organisms → cellular organisms → Bacteria1637Open in IMG/M
3300031942|Ga0310916_10374534All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300031954|Ga0306926_12613191Not Available551Open in IMG/M
3300031962|Ga0307479_10023261All Organisms → cellular organisms → Bacteria → Acidobacteria5866Open in IMG/M
3300031962|Ga0307479_10060604All Organisms → cellular organisms → Bacteria → Acidobacteria3647Open in IMG/M
3300032076|Ga0306924_10301382All Organisms → cellular organisms → Bacteria1839Open in IMG/M
3300032174|Ga0307470_10573627All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300032205|Ga0307472_101000424All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300032893|Ga0335069_10358612All Organisms → cellular organisms → Bacteria1720Open in IMG/M
3300032954|Ga0335083_11432909Not Available527Open in IMG/M
3300033402|Ga0326728_11087744All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA543Open in IMG/M
3300033405|Ga0326727_10600044All Organisms → cellular organisms → Bacteria916Open in IMG/M
3300033805|Ga0314864_0181678All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium545Open in IMG/M
3300033808|Ga0314867_006258All Organisms → cellular organisms → Bacteria2780Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil24.66%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil12.33%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.11%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.74%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.74%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.74%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.05%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.05%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.05%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.05%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.05%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.37%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland1.37%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.37%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.37%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost1.37%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.37%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland1.37%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.37%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.68%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.68%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.68%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.68%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.68%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300004080Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300005607Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017994Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024222Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32EnvironmentalOpen in IMG/M
3300024288Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungalEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026222Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027035Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes)EnvironmentalOpen in IMG/M
3300027313Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes)EnvironmentalOpen in IMG/M
3300027376Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M
3300033808Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10197456523300000955SoilMRPAVRQQLNPSIRSNDTRDFEGALRSKIVGQEEGVQAL
Ga0062385_1059715413300004080Bog Forest SoilMKAGARQQLDPTIRSTDTRDFEGALRSKIVGQAEGVQALV
Ga0066395_1038325533300004633Tropical Forest SoilMRAAARHQLDPSIRSTDTRDFESSLRAKIVGQAEGIQALVDMYQVFCAGLNS
Ga0062388_10178943213300004635Bog Forest SoilMKAAVRQQLDPTIRSIDTRDFESSLRAKVVGQAEGVQALVDMYQVF
Ga0066672_1004276223300005167SoilMTAAVRHQLDPSIRSNDTRDFHASLRAKIVGQEEGIQSLVAMY*
Ga0070705_10186379123300005440Corn, Switchgrass And Miscanthus RhizosphereMRPAVRQQLNPSIRSNDTRDFEGSLRSKIVGQEEGVQALVDL
Ga0070731_1002322013300005538Surface SoilMRPAVRQQLNPSIRSNDTRDFEGALRSKIVGQEEGVQALVD
Ga0066707_1013051223300005556SoilMKAAVRHQLDPTIRSNDTCDFESSLRAKIVGQEEGVQSL
Ga0066700_1075473913300005559SoilMKAAVRHQLDPTIRSNDTCDFHASLRAKIVGQEEGVQS
Ga0066699_1081440323300005561SoilMRAAVRHQLDPSIRSNDTRDFHASLRAKIVGQEEGIQSLV
Ga0066693_1002387813300005566SoilMRTAARHQLDPTIRSSDTRDFHGSLRAKIVGQEEGVQALV
Ga0066693_1020955813300005566SoilMRPAVRQQLNPSIRSNETRDFEGSLRSKIVGQQEGVQALVDLY
Ga0066706_1002190863300005598SoilMKPAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSL
Ga0070740_1022183123300005607Surface SoilMRSAARQQLDPTIRSTGTRDFETSLRSKIVGQEEGVQALV
Ga0068863_10126914623300005841Switchgrass RhizosphereMRAAVRQQLDPTIRSNDTRDFHGSLRAKIVGQEEG
Ga0097621_10229246913300006237Miscanthus RhizosphereMRPAVRQQLDPSIRSDDTRAFDQALRVKIVGQEEGVQALV
Ga0066660_1090191123300006800SoilMKAAVRHQLDPTIRSTDTRDFQGSLRAKIVGQEEGVQALV
Ga0079221_1019230623300006804Agricultural SoilMKSAARQQQLDPRIRSTDTRDFEGALRAKIVGQGEGVQALVDL
Ga0079220_1187020013300006806Agricultural SoilMKAGARQQLDPTILSNDTRDFHQSLRARIVGQEEGV
Ga0073928_1016510333300006893Iron-Sulfur Acid SpringMKPAVRQQLDPTIRSIDTREFESSLRAKVVGQTEGVQ
Ga0073928_1095921023300006893Iron-Sulfur Acid SpringMKAAVRQQLDPTIRSTTTRDFEASLRAKIVGQAEGVQSLVDMYQVFC
Ga0075435_10076207723300007076Populus RhizosphereMKPAVRQQLNPSIRSNDTRDFEGALGSKIVGQEEG
Ga0099794_1077582813300007265Vadose Zone SoilMKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGV
Ga0099829_1011245233300009038Vadose Zone SoilMKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSLVDMF
Ga0105249_1121794023300009553Switchgrass RhizosphereMRPAVRQQLDPSIRSDDTRAFDQALRVKIVGQEEGVQA
Ga0116105_108540113300009624PeatlandMKPAVRQQLDPTIRSIDTRKFESSLRSKVVGQTEGVQA
Ga0116120_101663613300009641PeatlandMKAAVRQQLDPGRRSAETLEFDGALRSKIVGQAEG
Ga0126373_1019644813300010048Tropical Forest SoilMRPAVRQQLNPSIRSNDTRDFEGAIRSKIVGQEEGVEAL
Ga0126373_1197470913300010048Tropical Forest SoilMRTAVRQQLDPNIRSDDTLAFDQALRAKIVGQEEGVQ
Ga0074044_1071690523300010343Bog Forest SoilMRAAVRQQLDPTIRSTDTHDFESSLRAKIVGQAEGVQALVDMYQVFCA
Ga0126378_1120497023300010361Tropical Forest SoilMRAAVRQQLDPSIRSNDTREFHQALRAKIVGQEEGVQALV
Ga0126378_1278848023300010361Tropical Forest SoilMRAAVRHQLDPSIRSNDTRGFHASLRAKIVGQEEGVQSLVD
Ga0126383_1204243613300010398Tropical Forest SoilMRPAVRQQLNPSIRSNDTRDFEGAIRSKIVGQEEG
Ga0134122_1183016523300010400Terrestrial SoilMRPAVRQQLDPSIRSDDTRAFDQALRVKIVGQEEGVQ
Ga0137392_1121718013300011269Vadose Zone SoilMNAMKAAARQQLDPTIRSNDTRDFHSSLRAKIVGQ
Ga0137391_1131927513300011270Vadose Zone SoilMNAMKAAARQQLDPTIRSNDTRDFHSSLRAKIVGQEE
Ga0137393_1124486013300011271Vadose Zone SoilMKAAVRHQLDPTIRSSDTRDFQGALRAKIVGQEEGVQA
Ga0137389_1133186423300012096Vadose Zone SoilMKAAVRHQLDPTIRSNDTRDFQGALRAKIVGQEEGVQALVDL
Ga0137363_1024875823300012202Vadose Zone SoilMRPAVRQQLNPSIRSNDTRDFEGSLRAKIVGQEEGV
Ga0137399_1072351613300012203Vadose Zone SoilMRAAARQQLDPTIRSKVARDFHGSMRAKIVGQVEG
Ga0137360_1019526423300012361Vadose Zone SoilMKAAVRHQLDPTIRSTDTRDFQGSLRAKIVGQEEGVQALVDL
Ga0137361_1194087513300012362Vadose Zone SoilMRAAARQQLDLTIRSKVTRDFHGSMRAKIIGQEEGVQALVDLHQVF
Ga0137398_1058432113300012683Vadose Zone SoilMRPAVRQQLNPSIRSNDTRDFEGSLRAKIVGQEEGVQ
Ga0137397_1060852723300012685Vadose Zone SoilMKSAVRQQLDPSIRSNDTRDFHSSLRAKIVGQEEGVQSLVD
Ga0137397_1069084723300012685Vadose Zone SoilMKAAARQQLDPTIRSNDTHDFHQSLRARIVGQEEGVQALV
Ga0137397_1129304313300012685Vadose Zone SoilMRPAVRQQLNPSIRSNETRDFEGSLRSKIVGQEEGVQSLVD
Ga0137397_1135943213300012685Vadose Zone SoilMRSAVRQQLDPSIRSNDTRDFHSSLRAKIVGQEEGVQ
Ga0137396_1098248913300012918Vadose Zone SoilMRAAARQQLDPTIRSKVARDFHGSMRAKIVGQEEG
Ga0137359_1016695333300012923Vadose Zone SoilMKAAVRHQLDPTIRSNDTRDFQGSLKTKIVGQEEGV
Ga0137359_1039735413300012923Vadose Zone SoilMRAAVRQQLDPSVRSTDSRDFETSLRAKIVGQEEGVQ
Ga0137419_1027349713300012925Vadose Zone SoilMRSAVRQQLDPSIRSNDTRDFHSSLRAKIVGQEEGVQSL
Ga0137416_1028048513300012927Vadose Zone SoilMKAAVRHQLDPTIRSTSTCDFEDALRSKIVGQVEGVQALVDMYQVF
Ga0137404_1023486023300012929Vadose Zone SoilMKAAVRHQLDPTIRSTDTRDFQGSLRAKIVGQEEGVQALVD
Ga0137410_1013677813300012944Vadose Zone SoilMRAAARQQLDPTIPSKVTRDFHGSMQAKIVGQEEAVQALV
Ga0137410_1118942513300012944Vadose Zone SoilMRAAARQQLDLTIRSKATRDFHGSMRAKIVGQEEGVQALVDLH*
Ga0137410_1173629913300012944Vadose Zone SoilMRPAVRQQLNPSIRSNETRDFEGSLRSKIVGQEEGVQSLVDL
Ga0120127_1004348723300013503PermafrostMKAAVRQQLDPSIRSTDTRDFETTLRSKIVGQVEGVQSL
Ga0120127_1011311723300013503PermafrostMKAAVRQQLDPSIRSSNTRDFESSLRSKIVGQTEGVQSL
Ga0181527_125760823300014153BogMRAAVRQQLDPSIRSNDTRDFHQSLRAKIVGQEEG
Ga0167668_105164623300015193Glacier Forefield SoilMKAAVRQQLDPSIRSTDTRDFESSLRSKIVGQVEGVQSLVDMYQVFCAGL
Ga0137418_1121179913300015241Vadose Zone SoilMKAAVRHQLDPTIRSTDTRDFQGSLRAKIVGQEEG
Ga0137409_1149982613300015245Vadose Zone SoilMRSAVRQQLDPSIRSNDTRDFHSSLRAKIVGQEEGVQS
Ga0182036_1115738213300016270SoilMRAAVRHQLDPTIRSNVTHDFHQALRSKIVGQEEGVQALVD
Ga0182041_1187935113300016294SoilMRPATRQQLNPAIRSNDTRDFEGSLRSKIVGQEEGVQALVDL
Ga0182040_1056589213300016387SoilMKAAARQQLDPSIRSNDTREFHQALRAKIVGQEEGVQAL
Ga0182038_1180912923300016445SoilMRAAVRQQLDPSIRSNDTREFQQALRAKIVGQEEGVQALV
Ga0187803_1010705713300017934Freshwater SedimentMKAAVRQQLDPGRRSAETLEFDGALRAKIVGQAEG
Ga0187776_1010687613300017966Tropical PeatlandMKAAVRQQLDPTIRSNDTRDFHASLRAKIVDQEKNVQSLMDMF
Ga0187783_1132114113300017970Tropical PeatlandMKAATRHQLDPRIRSTDTRDFEGALRAKIVGQVEGVQALVD
Ga0187780_1139532923300017973Tropical PeatlandMRPAVRQQLDPSLRSDDTLAFDQALRAKIVGQEEAVEALVD
Ga0187822_1031454313300017994Freshwater SedimentMKAAVRQQLDPTIRSNDTRDFHTSLRAKIVGQEEGVQ
Ga0187815_1013057023300018001Freshwater SedimentMKAAVRQQLDPTIRSNDTRDFHQALRAKIVGQEEGG
Ga0187874_1025904423300018019PeatlandMKAAVRQQLDPGRRSAETLEFDGALRSKIVGQAEGVQALVDL
Ga0187765_1015846023300018060Tropical PeatlandMKPAVRHQLDPSIRSTDTRDFESSLRAKIVGQAEGVQALVD
Ga0066655_1074210013300018431Grasslands SoilMKPAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSLVDMFQV
Ga0066667_1144637923300018433Grasslands SoilMKAAARQQLDPTIRSNDTREFQNYLRAKIVGQEEGVQALVDV
Ga0181514_103152213300019268PeatlandMRAAVRQQLDPTIRSNDTRDFHGSLRSKIVGQEEGVQALVDM
Ga0193751_100841513300019888SoilMKAAVRHQLDPSIRSTDTRDFESSLRAKIVGQAEGVQSL
Ga0193728_102360863300019890SoilMKAAVRHQLDPSIRSTDTRDFESSLRAKIVGQAEGVQSLVDMYQVF
Ga0210407_1000247313300020579SoilMKAAARQQLDPTIRSNDTRDFQSSLRAKIVGQEEGVQSL
Ga0210407_1003665953300020579SoilMRAAARQQLDPSIRSTDSRDFQSSLTAKIVGQEEGVQ
Ga0210407_1119507633300020579SoilMKAAVRHQLDPTIRSSDTCDFHSSLRAKIVGQEEGVQS
Ga0210403_1024839823300020580SoilMKPAVRQQLDPSIRSTDTRDFEGSLRAKIVGQAEGLQALVDMYQ
Ga0210395_1139645813300020582SoilMKAAARQQLDPTIRSNDTRDFHQSLRARIVGQEEG
Ga0210401_1017871313300020583SoilMKAATRQQLDPTIRSNDTRDFHQSLRARIVGQEEGV
Ga0215015_1000627133300021046SoilMRPAVRQQLNPSIRSNDTRDFEGSLRAKIVGQEEGVQSLVD
Ga0179596_1045035323300021086Vadose Zone SoilMKAAVRHQLDPTIRSTDTCDFQSSLCAKIVGQEEGV
Ga0210406_1085492313300021168SoilMKAATRQQLDPTIRSNDTRDFHQSLRARIVGQEEGVQAL
Ga0210400_1008761713300021170SoilMKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSL
Ga0210387_1123306913300021405SoilMKAAARQQLDPTIRSNDTRDFHQSLRARIVGQEEGV
Ga0210384_1108633013300021432SoilMKSAVRQQLDPSIRSTDTRDFESSLRAKIVGQAEGVQALVDMYQVFCAGL
Ga0210410_1033007023300021479SoilMRAAARQQLDPTIRSNDTRDFQSSLRAKIVGQEEGV
Ga0210409_1015999513300021559SoilMKAAAKQQLDPSIRSTDTRGFHSALRSKIVGQEEGVQS
Ga0126371_1083669513300021560Tropical Forest SoilMKAAARQQLDPSIRSNDTREFHNALRSKIVGQEEGVLA
Ga0126371_1218847023300021560Tropical Forest SoilMRPAVRQQLDPSIRSTDTRDFEASLRAKIVGQAEGVQSLVDMYQVFCA
Ga0247691_104148713300024222SoilMKAAARQQLDPTIRSNDTRDFHQSLRARIVGQEEGVQALVDL
Ga0179589_1010474923300024288Vadose Zone SoilMKSAVRQQLDPTIRSIDTRDFEASLRAKVVGQAEGVQSLV
Ga0137417_103373913300024330Vadose Zone SoilMKAAVRHQLDPTIRSSDTRDFQGALRAKIVGQEEGVQALGSTCTRSS
Ga0137417_1430755123300024330Vadose Zone SoilMKAAVRHQWDPTILSNDTRDFQGPALENCRAREGVQALVDLYQVFCRG
Ga0207692_1038009313300025898Corn, Switchgrass And Miscanthus RhizosphereMKAAARQQLDPSIRSNDTREFHNALRSKIVGQEEGVQALV
Ga0207664_1158747313300025929Agricultural SoilMRPAVRQQLDPSIRSEDTRAFDQALRMKIVGQEEGVQALVD
Ga0207665_1041312313300025939Corn, Switchgrass And Miscanthus RhizosphereMKAATRQQLDPTIRSNDTREFQNYLRAKIVGQEEGVQALVD
Ga0209862_105670013300026222Permafrost SoilMKAAVRQQLDPSIRSTDTRDFETTLRSKIVGQVEGVQSLVMKLDRYKLR
Ga0209438_102759813300026285Grasslands SoilMKAAVRHQLDPTIRSSDTCDFHSSLRAKIVGQEEGVQSLVDMFQ
Ga0209237_122450123300026297Grasslands SoilMKAAVRHQLDPTIRSNDTCDFHASLRAKIVGQEEGVQSLVDM
Ga0209238_121032723300026301Grasslands SoilMKAAARQQLDPTIRSNDTREFQNYLRAKIVGQEEGVQA
Ga0209238_121185613300026301Grasslands SoilMRSAARHQLDPTIRSSDTRDFHGALRAKIVGQEEGVQALVD
Ga0209154_111904523300026317SoilMKAAVRHQLDPTIRSNDTCDFHASLRAKIVGQEEGVQSL
Ga0257147_107582713300026475SoilMRPAVRQQLNPSIRSNDTRDFEGSLRAKIVGQEEGVQSLVDL
Ga0209648_1069910223300026551Grasslands SoilMKAAVRQQLDPTIRSNDTRDFHSSLRAKIVGQEEG
Ga0207776_102564813300027035Tropical Forest SoilMRAAVRQQLDPSIRSTDTREFQQSLRAKIVGQEEGVQALV
Ga0207780_106451813300027313Tropical Forest SoilMRAAVRQQLDPTIRSNDTRDFHQSLRAKIVGQEEG
Ga0209004_109471313300027376Forest SoilMRAAAAVQLDPTIPGNDTRDFHTAMRAKIVGQEEGVQ
Ga0209076_112571513300027643Vadose Zone SoilMKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSLVD
Ga0209076_118112323300027643Vadose Zone SoilMKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSLV
Ga0209588_108516913300027671Vadose Zone SoilMKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVKS
Ga0209118_109929123300027674Forest SoilMKAAARQQLDPSIRSNDTRDFHQSLRARIVGQEEGVQALVD
Ga0209011_1002120103300027678Forest SoilMKAAVRQQLDPTIRSTDTCDFHSSLRAKIVGQEEGVQSL
Ga0209447_1018012823300027701Bog Forest SoilMKAAVRSQLDPNIRSNDTRDFHESLRAKIVGQEEGVQALVDL
Ga0209038_1005804313300027737Bog Forest SoilMKAAVRQQLDPTIRSIDTREFESSLRAKVVGQVEGVQSLVDMYQV
Ga0208989_1027867113300027738Forest SoilMKAAVRHQLDPTIRSTDTRDFQGSLRAKIVGQEEGVQA
Ga0209166_1042528923300027857Surface SoilMKAATRQQLDPTIRSNDTRDFHQSLRARIVGQEEGVQA
Ga0209283_1041596223300027875Vadose Zone SoilMKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSLVDM
Ga0209283_1065154113300027875Vadose Zone SoilMKAAARQQLDPTIRSNDTRDFHSSLRAKIVGQEEGV
Ga0209067_1055738033300027898WatershedsMRAAVRQQLDPSVRSTDSRDFETSLRAKIVGQEEGV
Ga0137415_1044846023300028536Vadose Zone SoilMKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQS
Ga0318516_1018026013300031543SoilMRAAVRQQLDPSIRSNDTREFHQALRAKIVGQEEG
Ga0310915_1040459923300031573SoilMKAAVRQQLDPSIRSNDTREFQQSLRAKIVGQEEGVQAL
Ga0307476_1131458023300031715Hardwood Forest SoilMPMKAAARQQLDPSIRSTDSRDFEGALRSKIVGQAEG
Ga0318501_1015869533300031736SoilMTTAAGQQLDPSSRSADARAFDSAMRSKIVGQEEA
Ga0307475_1067577923300031754Hardwood Forest SoilMKAAVRHQLDPTIRSTDTRDFQGALRAKIVGQEEGVQALV
Ga0306919_1036637613300031879SoilMKAAVRQQLDPSIRSNDTREFQQSLRAKIVGQEEGVQALVD
Ga0306921_1038555113300031912SoilMKAAARQQLDPTIRSNDTRDFHQSLRAKIVGQEEG
Ga0310916_1037453423300031942SoilMKAAVRQQLDPSIRSNDTREFQQSLRAKIVGQEEG
Ga0306926_1261319113300031954SoilMRAAVRHQLDPTIRSNVTHDFHQALRSKIVGQEEGV
Ga0307479_1002326173300031962Hardwood Forest SoilMKAAVRHQLDPTIRSNDTRDFQGALRAKIVGQEEG
Ga0307479_1006060453300031962Hardwood Forest SoilMRAARKQLDPTIRSNDTRDFHSLMRGKIVGQEEGVQALVD
Ga0306924_1030138233300032076SoilMRPAVRQQLNPTIRSNDTRDFECALRAKIVGQEEGV
Ga0307470_1057362723300032174Hardwood Forest SoilMRPAVRQQLNPSIRSNDTRDFEGALRSKIVGQEEGVQ
Ga0307472_10100042423300032205Hardwood Forest SoilMRSAVRQQLDPSIRSNDTRDFHSSLRAKIVGQEEG
Ga0335069_1035861213300032893SoilMRAAVRQQLDPTIRSNGTRDFHQSLRSKIVGQEEGVQALVD
Ga0335083_1143290913300032954SoilMKSAARQQLDPTIRSNETLDFETSLKSKIVGQTEG
Ga0326728_1108774413300033402Peat SoilMKAAVRHQLDPTIRSNDTRDFHQALRAKIVGQEEG
Ga0326727_1060004413300033405Peat SoilMRAAVRQQLDPSIRSNDTRDFHQSLRAKIVGQEEGV
Ga0314864_0181678_2_1243300033805PeatlandMKAAARHQLDPSIRSTDTRDFESSLRAKIVGQAEGIQALVD
Ga0314867_006258_1_1293300033808PeatlandMKSAARQQLDPTVRSGETREFEAGLRSKIVGQAEGVQALVDLY


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.