Basic Information | |
---|---|
Family ID | F049712 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 146 |
Average Sequence Length | 39 residues |
Representative Sequence | MKAAVRQQLDPTIRSNDTRDFHTSLRAKIVGQEEGVQ |
Number of Associated Samples | 127 |
Number of Associated Scaffolds | 146 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 98.63 % |
% of genes near scaffold ends (potentially truncated) | 96.58 % |
% of genes from short scaffolds (< 2000 bps) | 89.04 % |
Associated GOLD sequencing projects | 119 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.33 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (90.411 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (24.657 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.767 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.315 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.08% β-sheet: 0.00% Coil/Unstructured: 76.92% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 146 Family Scaffolds |
---|---|---|
PF10431 | ClpB_D2-small | 36.99 |
PF02954 | HTH_8 | 4.11 |
PF07724 | AAA_2 | 1.37 |
PF01035 | DNA_binding_1 | 1.37 |
PF13493 | DUF4118 | 1.37 |
PF13545 | HTH_Crp_2 | 0.68 |
PF01063 | Aminotran_4 | 0.68 |
PF00873 | ACR_tran | 0.68 |
PF13231 | PMT_2 | 0.68 |
PF00437 | T2SSE | 0.68 |
PF13732 | DUF4162 | 0.68 |
COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
---|---|---|---|
COG0115 | Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase | Amino acid transport and metabolism [E] | 1.37 |
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 1.37 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 1.37 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 90.41 % |
Unclassified | root | N/A | 9.59 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000955|JGI1027J12803_101974565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300004080|Ga0062385_10597154 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
3300004633|Ga0066395_10383255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 788 | Open in IMG/M |
3300004635|Ga0062388_101789432 | Not Available | 630 | Open in IMG/M |
3300005167|Ga0066672_10042762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2558 | Open in IMG/M |
3300005440|Ga0070705_101863791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300005538|Ga0070731_10023220 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4264 | Open in IMG/M |
3300005556|Ga0066707_10130512 | All Organisms → cellular organisms → Bacteria | 1575 | Open in IMG/M |
3300005559|Ga0066700_10754739 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_57_11 | 660 | Open in IMG/M |
3300005561|Ga0066699_10814403 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
3300005566|Ga0066693_10023878 | All Organisms → cellular organisms → Bacteria | 1879 | Open in IMG/M |
3300005566|Ga0066693_10209558 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
3300005598|Ga0066706_10021908 | All Organisms → cellular organisms → Bacteria | 3901 | Open in IMG/M |
3300005607|Ga0070740_10221831 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
3300005841|Ga0068863_101269146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
3300006237|Ga0097621_102292469 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300006800|Ga0066660_10901911 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300006804|Ga0079221_10192306 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300006806|Ga0079220_11870200 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 531 | Open in IMG/M |
3300006893|Ga0073928_10165103 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
3300006893|Ga0073928_10959210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
3300007076|Ga0075435_100762077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 842 | Open in IMG/M |
3300007265|Ga0099794_10775828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
3300009038|Ga0099829_10112452 | All Organisms → cellular organisms → Bacteria | 2134 | Open in IMG/M |
3300009553|Ga0105249_11217940 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300009624|Ga0116105_1085401 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
3300009641|Ga0116120_1016636 | All Organisms → cellular organisms → Bacteria | 2751 | Open in IMG/M |
3300010048|Ga0126373_10196448 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
3300010048|Ga0126373_11974709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Kribbellaceae → Kribbella → Kribbella pittospori | 646 | Open in IMG/M |
3300010343|Ga0074044_10716905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 653 | Open in IMG/M |
3300010361|Ga0126378_11204970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 855 | Open in IMG/M |
3300010361|Ga0126378_12788480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
3300010398|Ga0126383_12042436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
3300010400|Ga0134122_11830165 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
3300011269|Ga0137392_11217180 | Not Available | 611 | Open in IMG/M |
3300011270|Ga0137391_11319275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 568 | Open in IMG/M |
3300011271|Ga0137393_11244860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
3300012096|Ga0137389_11331864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 612 | Open in IMG/M |
3300012202|Ga0137363_10248758 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300012203|Ga0137399_10723516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 838 | Open in IMG/M |
3300012361|Ga0137360_10195264 | All Organisms → cellular organisms → Bacteria | 1635 | Open in IMG/M |
3300012362|Ga0137361_11940875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
3300012683|Ga0137398_10584321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 772 | Open in IMG/M |
3300012685|Ga0137397_10608527 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300012685|Ga0137397_10690847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 758 | Open in IMG/M |
3300012685|Ga0137397_11293043 | Not Available | 519 | Open in IMG/M |
3300012685|Ga0137397_11359432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 501 | Open in IMG/M |
3300012918|Ga0137396_10982489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300012923|Ga0137359_10166953 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
3300012923|Ga0137359_10397354 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300012925|Ga0137419_10273497 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300012927|Ga0137416_10280485 | All Organisms → cellular organisms → Bacteria | 1373 | Open in IMG/M |
3300012929|Ga0137404_10234860 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
3300012944|Ga0137410_10136778 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
3300012944|Ga0137410_11189425 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
3300012944|Ga0137410_11736299 | Not Available | 550 | Open in IMG/M |
3300013503|Ga0120127_10043487 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300013503|Ga0120127_10113117 | Not Available | 619 | Open in IMG/M |
3300014153|Ga0181527_1257608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 701 | Open in IMG/M |
3300015193|Ga0167668_1051646 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
3300015241|Ga0137418_11211799 | Not Available | 530 | Open in IMG/M |
3300015245|Ga0137409_11499826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 522 | Open in IMG/M |
3300016270|Ga0182036_11157382 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
3300016294|Ga0182041_11879351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
3300016387|Ga0182040_10565892 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300016445|Ga0182038_11809129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 551 | Open in IMG/M |
3300017934|Ga0187803_10107057 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300017966|Ga0187776_10106876 | All Organisms → cellular organisms → Bacteria | 1674 | Open in IMG/M |
3300017970|Ga0187783_11321141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
3300017973|Ga0187780_11395329 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300017994|Ga0187822_10314543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 556 | Open in IMG/M |
3300018001|Ga0187815_10130570 | All Organisms → cellular organisms → Bacteria | 1062 | Open in IMG/M |
3300018019|Ga0187874_10259044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
3300018060|Ga0187765_10158460 | All Organisms → cellular organisms → Bacteria | 1282 | Open in IMG/M |
3300018431|Ga0066655_10742100 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 666 | Open in IMG/M |
3300018433|Ga0066667_11446379 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300019268|Ga0181514_1031522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 534 | Open in IMG/M |
3300019888|Ga0193751_1008415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5550 | Open in IMG/M |
3300019890|Ga0193728_1023608 | All Organisms → cellular organisms → Bacteria | 3072 | Open in IMG/M |
3300020579|Ga0210407_10002473 | All Organisms → cellular organisms → Bacteria | 15822 | Open in IMG/M |
3300020579|Ga0210407_10036659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3648 | Open in IMG/M |
3300020579|Ga0210407_11195076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
3300020580|Ga0210403_10248398 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
3300020582|Ga0210395_11396458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 511 | Open in IMG/M |
3300020583|Ga0210401_10178713 | All Organisms → cellular organisms → Bacteria | 1978 | Open in IMG/M |
3300021046|Ga0215015_10006271 | All Organisms → cellular organisms → Bacteria | 1293 | Open in IMG/M |
3300021086|Ga0179596_10450353 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300021168|Ga0210406_10854923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 688 | Open in IMG/M |
3300021170|Ga0210400_10087617 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
3300021405|Ga0210387_11233069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 648 | Open in IMG/M |
3300021432|Ga0210384_11086330 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
3300021479|Ga0210410_10330070 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300021559|Ga0210409_10159995 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
3300021560|Ga0126371_10836695 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
3300021560|Ga0126371_12188470 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
3300024222|Ga0247691_1041487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 698 | Open in IMG/M |
3300024288|Ga0179589_10104749 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
3300024330|Ga0137417_1033739 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300024330|Ga0137417_1430755 | All Organisms → cellular organisms → Bacteria | 8797 | Open in IMG/M |
3300025898|Ga0207692_10380093 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
3300025929|Ga0207664_11587473 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
3300025939|Ga0207665_10413123 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
3300026222|Ga0209862_1056700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 693 | Open in IMG/M |
3300026285|Ga0209438_1027598 | All Organisms → cellular organisms → Bacteria | 1890 | Open in IMG/M |
3300026297|Ga0209237_1224501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
3300026301|Ga0209238_1210327 | Not Available | 571 | Open in IMG/M |
3300026301|Ga0209238_1211856 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
3300026317|Ga0209154_1119045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_57_11 | 1117 | Open in IMG/M |
3300026475|Ga0257147_1075827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
3300026551|Ga0209648_10699102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 554 | Open in IMG/M |
3300027035|Ga0207776_1025648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 768 | Open in IMG/M |
3300027313|Ga0207780_1064518 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 620 | Open in IMG/M |
3300027376|Ga0209004_1094713 | Not Available | 506 | Open in IMG/M |
3300027643|Ga0209076_1125715 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
3300027643|Ga0209076_1181123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
3300027671|Ga0209588_1085169 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300027674|Ga0209118_1099291 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300027678|Ga0209011_1002120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7040 | Open in IMG/M |
3300027701|Ga0209447_10180128 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 579 | Open in IMG/M |
3300027737|Ga0209038_10058043 | Not Available | 1159 | Open in IMG/M |
3300027738|Ga0208989_10278671 | Not Available | 539 | Open in IMG/M |
3300027857|Ga0209166_10425289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 687 | Open in IMG/M |
3300027875|Ga0209283_10415962 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300027875|Ga0209283_10651541 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300027898|Ga0209067_10557380 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 655 | Open in IMG/M |
3300028536|Ga0137415_10448460 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300031543|Ga0318516_10180260 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
3300031573|Ga0310915_10404599 | Not Available | 969 | Open in IMG/M |
3300031715|Ga0307476_11314580 | Not Available | 527 | Open in IMG/M |
3300031736|Ga0318501_10158695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1168 | Open in IMG/M |
3300031754|Ga0307475_10675779 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300031879|Ga0306919_10366376 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
3300031912|Ga0306921_10385551 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
3300031942|Ga0310916_10374534 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300031954|Ga0306926_12613191 | Not Available | 551 | Open in IMG/M |
3300031962|Ga0307479_10023261 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5866 | Open in IMG/M |
3300031962|Ga0307479_10060604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3647 | Open in IMG/M |
3300032076|Ga0306924_10301382 | All Organisms → cellular organisms → Bacteria | 1839 | Open in IMG/M |
3300032174|Ga0307470_10573627 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
3300032205|Ga0307472_101000424 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
3300032893|Ga0335069_10358612 | All Organisms → cellular organisms → Bacteria | 1720 | Open in IMG/M |
3300032954|Ga0335083_11432909 | Not Available | 527 | Open in IMG/M |
3300033402|Ga0326728_11087744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. FW306-2-11AA | 543 | Open in IMG/M |
3300033405|Ga0326727_10600044 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300033805|Ga0314864_0181678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
3300033808|Ga0314867_006258 | All Organisms → cellular organisms → Bacteria | 2780 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 24.66% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.48% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.79% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.11% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.74% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.74% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.74% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.05% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.05% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.05% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.05% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.05% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.37% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.37% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.37% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.37% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.37% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.37% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.37% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.37% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.68% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.68% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.68% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.68% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.68% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.68% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024222 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK32 | Environmental | Open in IMG/M |
3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026222 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-061 (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
3300027313 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 45 (SPAdes) | Environmental | Open in IMG/M |
3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
3300033808 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_20 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI1027J12803_1019745652 | 3300000955 | Soil | MRPAVRQQLNPSIRSNDTRDFEGALRSKIVGQEEGVQAL |
Ga0062385_105971541 | 3300004080 | Bog Forest Soil | MKAGARQQLDPTIRSTDTRDFEGALRSKIVGQAEGVQALV |
Ga0066395_103832553 | 3300004633 | Tropical Forest Soil | MRAAARHQLDPSIRSTDTRDFESSLRAKIVGQAEGIQALVDMYQVFCAGLNS |
Ga0062388_1017894321 | 3300004635 | Bog Forest Soil | MKAAVRQQLDPTIRSIDTRDFESSLRAKVVGQAEGVQALVDMYQVF |
Ga0066672_100427622 | 3300005167 | Soil | MTAAVRHQLDPSIRSNDTRDFHASLRAKIVGQEEGIQSLVAMY* |
Ga0070705_1018637912 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MRPAVRQQLNPSIRSNDTRDFEGSLRSKIVGQEEGVQALVDL |
Ga0070731_100232201 | 3300005538 | Surface Soil | MRPAVRQQLNPSIRSNDTRDFEGALRSKIVGQEEGVQALVD |
Ga0066707_101305122 | 3300005556 | Soil | MKAAVRHQLDPTIRSNDTCDFESSLRAKIVGQEEGVQSL |
Ga0066700_107547391 | 3300005559 | Soil | MKAAVRHQLDPTIRSNDTCDFHASLRAKIVGQEEGVQS |
Ga0066699_108144032 | 3300005561 | Soil | MRAAVRHQLDPSIRSNDTRDFHASLRAKIVGQEEGIQSLV |
Ga0066693_100238781 | 3300005566 | Soil | MRTAARHQLDPTIRSSDTRDFHGSLRAKIVGQEEGVQALV |
Ga0066693_102095581 | 3300005566 | Soil | MRPAVRQQLNPSIRSNETRDFEGSLRSKIVGQQEGVQALVDLY |
Ga0066706_100219086 | 3300005598 | Soil | MKPAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSL |
Ga0070740_102218312 | 3300005607 | Surface Soil | MRSAARQQLDPTIRSTGTRDFETSLRSKIVGQEEGVQALV |
Ga0068863_1012691462 | 3300005841 | Switchgrass Rhizosphere | MRAAVRQQLDPTIRSNDTRDFHGSLRAKIVGQEEG |
Ga0097621_1022924691 | 3300006237 | Miscanthus Rhizosphere | MRPAVRQQLDPSIRSDDTRAFDQALRVKIVGQEEGVQALV |
Ga0066660_109019112 | 3300006800 | Soil | MKAAVRHQLDPTIRSTDTRDFQGSLRAKIVGQEEGVQALV |
Ga0079221_101923062 | 3300006804 | Agricultural Soil | MKSAARQQQLDPRIRSTDTRDFEGALRAKIVGQGEGVQALVDL |
Ga0079220_118702001 | 3300006806 | Agricultural Soil | MKAGARQQLDPTILSNDTRDFHQSLRARIVGQEEGV |
Ga0073928_101651033 | 3300006893 | Iron-Sulfur Acid Spring | MKPAVRQQLDPTIRSIDTREFESSLRAKVVGQTEGVQ |
Ga0073928_109592102 | 3300006893 | Iron-Sulfur Acid Spring | MKAAVRQQLDPTIRSTTTRDFEASLRAKIVGQAEGVQSLVDMYQVFC |
Ga0075435_1007620772 | 3300007076 | Populus Rhizosphere | MKPAVRQQLNPSIRSNDTRDFEGALGSKIVGQEEG |
Ga0099794_107758281 | 3300007265 | Vadose Zone Soil | MKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGV |
Ga0099829_101124523 | 3300009038 | Vadose Zone Soil | MKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSLVDMF |
Ga0105249_112179402 | 3300009553 | Switchgrass Rhizosphere | MRPAVRQQLDPSIRSDDTRAFDQALRVKIVGQEEGVQA |
Ga0116105_10854011 | 3300009624 | Peatland | MKPAVRQQLDPTIRSIDTRKFESSLRSKVVGQTEGVQA |
Ga0116120_10166361 | 3300009641 | Peatland | MKAAVRQQLDPGRRSAETLEFDGALRSKIVGQAEG |
Ga0126373_101964481 | 3300010048 | Tropical Forest Soil | MRPAVRQQLNPSIRSNDTRDFEGAIRSKIVGQEEGVEAL |
Ga0126373_119747091 | 3300010048 | Tropical Forest Soil | MRTAVRQQLDPNIRSDDTLAFDQALRAKIVGQEEGVQ |
Ga0074044_107169052 | 3300010343 | Bog Forest Soil | MRAAVRQQLDPTIRSTDTHDFESSLRAKIVGQAEGVQALVDMYQVFCA |
Ga0126378_112049702 | 3300010361 | Tropical Forest Soil | MRAAVRQQLDPSIRSNDTREFHQALRAKIVGQEEGVQALV |
Ga0126378_127884802 | 3300010361 | Tropical Forest Soil | MRAAVRHQLDPSIRSNDTRGFHASLRAKIVGQEEGVQSLVD |
Ga0126383_120424361 | 3300010398 | Tropical Forest Soil | MRPAVRQQLNPSIRSNDTRDFEGAIRSKIVGQEEG |
Ga0134122_118301652 | 3300010400 | Terrestrial Soil | MRPAVRQQLDPSIRSDDTRAFDQALRVKIVGQEEGVQ |
Ga0137392_112171801 | 3300011269 | Vadose Zone Soil | MNAMKAAARQQLDPTIRSNDTRDFHSSLRAKIVGQ |
Ga0137391_113192751 | 3300011270 | Vadose Zone Soil | MNAMKAAARQQLDPTIRSNDTRDFHSSLRAKIVGQEE |
Ga0137393_112448601 | 3300011271 | Vadose Zone Soil | MKAAVRHQLDPTIRSSDTRDFQGALRAKIVGQEEGVQA |
Ga0137389_113318642 | 3300012096 | Vadose Zone Soil | MKAAVRHQLDPTIRSNDTRDFQGALRAKIVGQEEGVQALVDL |
Ga0137363_102487582 | 3300012202 | Vadose Zone Soil | MRPAVRQQLNPSIRSNDTRDFEGSLRAKIVGQEEGV |
Ga0137399_107235161 | 3300012203 | Vadose Zone Soil | MRAAARQQLDPTIRSKVARDFHGSMRAKIVGQVEG |
Ga0137360_101952642 | 3300012361 | Vadose Zone Soil | MKAAVRHQLDPTIRSTDTRDFQGSLRAKIVGQEEGVQALVDL |
Ga0137361_119408751 | 3300012362 | Vadose Zone Soil | MRAAARQQLDLTIRSKVTRDFHGSMRAKIIGQEEGVQALVDLHQVF |
Ga0137398_105843211 | 3300012683 | Vadose Zone Soil | MRPAVRQQLNPSIRSNDTRDFEGSLRAKIVGQEEGVQ |
Ga0137397_106085272 | 3300012685 | Vadose Zone Soil | MKSAVRQQLDPSIRSNDTRDFHSSLRAKIVGQEEGVQSLVD |
Ga0137397_106908472 | 3300012685 | Vadose Zone Soil | MKAAARQQLDPTIRSNDTHDFHQSLRARIVGQEEGVQALV |
Ga0137397_112930431 | 3300012685 | Vadose Zone Soil | MRPAVRQQLNPSIRSNETRDFEGSLRSKIVGQEEGVQSLVD |
Ga0137397_113594321 | 3300012685 | Vadose Zone Soil | MRSAVRQQLDPSIRSNDTRDFHSSLRAKIVGQEEGVQ |
Ga0137396_109824891 | 3300012918 | Vadose Zone Soil | MRAAARQQLDPTIRSKVARDFHGSMRAKIVGQEEG |
Ga0137359_101669533 | 3300012923 | Vadose Zone Soil | MKAAVRHQLDPTIRSNDTRDFQGSLKTKIVGQEEGV |
Ga0137359_103973541 | 3300012923 | Vadose Zone Soil | MRAAVRQQLDPSVRSTDSRDFETSLRAKIVGQEEGVQ |
Ga0137419_102734971 | 3300012925 | Vadose Zone Soil | MRSAVRQQLDPSIRSNDTRDFHSSLRAKIVGQEEGVQSL |
Ga0137416_102804851 | 3300012927 | Vadose Zone Soil | MKAAVRHQLDPTIRSTSTCDFEDALRSKIVGQVEGVQALVDMYQVF |
Ga0137404_102348602 | 3300012929 | Vadose Zone Soil | MKAAVRHQLDPTIRSTDTRDFQGSLRAKIVGQEEGVQALVD |
Ga0137410_101367781 | 3300012944 | Vadose Zone Soil | MRAAARQQLDPTIPSKVTRDFHGSMQAKIVGQEEAVQALV |
Ga0137410_111894251 | 3300012944 | Vadose Zone Soil | MRAAARQQLDLTIRSKATRDFHGSMRAKIVGQEEGVQALVDLH* |
Ga0137410_117362991 | 3300012944 | Vadose Zone Soil | MRPAVRQQLNPSIRSNETRDFEGSLRSKIVGQEEGVQSLVDL |
Ga0120127_100434872 | 3300013503 | Permafrost | MKAAVRQQLDPSIRSTDTRDFETTLRSKIVGQVEGVQSL |
Ga0120127_101131172 | 3300013503 | Permafrost | MKAAVRQQLDPSIRSSNTRDFESSLRSKIVGQTEGVQSL |
Ga0181527_12576082 | 3300014153 | Bog | MRAAVRQQLDPSIRSNDTRDFHQSLRAKIVGQEEG |
Ga0167668_10516462 | 3300015193 | Glacier Forefield Soil | MKAAVRQQLDPSIRSTDTRDFESSLRSKIVGQVEGVQSLVDMYQVFCAGL |
Ga0137418_112117991 | 3300015241 | Vadose Zone Soil | MKAAVRHQLDPTIRSTDTRDFQGSLRAKIVGQEEG |
Ga0137409_114998261 | 3300015245 | Vadose Zone Soil | MRSAVRQQLDPSIRSNDTRDFHSSLRAKIVGQEEGVQS |
Ga0182036_111573821 | 3300016270 | Soil | MRAAVRHQLDPTIRSNVTHDFHQALRSKIVGQEEGVQALVD |
Ga0182041_118793511 | 3300016294 | Soil | MRPATRQQLNPAIRSNDTRDFEGSLRSKIVGQEEGVQALVDL |
Ga0182040_105658921 | 3300016387 | Soil | MKAAARQQLDPSIRSNDTREFHQALRAKIVGQEEGVQAL |
Ga0182038_118091292 | 3300016445 | Soil | MRAAVRQQLDPSIRSNDTREFQQALRAKIVGQEEGVQALV |
Ga0187803_101070571 | 3300017934 | Freshwater Sediment | MKAAVRQQLDPGRRSAETLEFDGALRAKIVGQAEG |
Ga0187776_101068761 | 3300017966 | Tropical Peatland | MKAAVRQQLDPTIRSNDTRDFHASLRAKIVDQEKNVQSLMDMF |
Ga0187783_113211411 | 3300017970 | Tropical Peatland | MKAATRHQLDPRIRSTDTRDFEGALRAKIVGQVEGVQALVD |
Ga0187780_113953292 | 3300017973 | Tropical Peatland | MRPAVRQQLDPSLRSDDTLAFDQALRAKIVGQEEAVEALVD |
Ga0187822_103145431 | 3300017994 | Freshwater Sediment | MKAAVRQQLDPTIRSNDTRDFHTSLRAKIVGQEEGVQ |
Ga0187815_101305702 | 3300018001 | Freshwater Sediment | MKAAVRQQLDPTIRSNDTRDFHQALRAKIVGQEEGG |
Ga0187874_102590442 | 3300018019 | Peatland | MKAAVRQQLDPGRRSAETLEFDGALRSKIVGQAEGVQALVDL |
Ga0187765_101584602 | 3300018060 | Tropical Peatland | MKPAVRHQLDPSIRSTDTRDFESSLRAKIVGQAEGVQALVD |
Ga0066655_107421001 | 3300018431 | Grasslands Soil | MKPAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSLVDMFQV |
Ga0066667_114463792 | 3300018433 | Grasslands Soil | MKAAARQQLDPTIRSNDTREFQNYLRAKIVGQEEGVQALVDV |
Ga0181514_10315221 | 3300019268 | Peatland | MRAAVRQQLDPTIRSNDTRDFHGSLRSKIVGQEEGVQALVDM |
Ga0193751_10084151 | 3300019888 | Soil | MKAAVRHQLDPSIRSTDTRDFESSLRAKIVGQAEGVQSL |
Ga0193728_10236086 | 3300019890 | Soil | MKAAVRHQLDPSIRSTDTRDFESSLRAKIVGQAEGVQSLVDMYQVF |
Ga0210407_100024731 | 3300020579 | Soil | MKAAARQQLDPTIRSNDTRDFQSSLRAKIVGQEEGVQSL |
Ga0210407_100366595 | 3300020579 | Soil | MRAAARQQLDPSIRSTDSRDFQSSLTAKIVGQEEGVQ |
Ga0210407_111950763 | 3300020579 | Soil | MKAAVRHQLDPTIRSSDTCDFHSSLRAKIVGQEEGVQS |
Ga0210403_102483982 | 3300020580 | Soil | MKPAVRQQLDPSIRSTDTRDFEGSLRAKIVGQAEGLQALVDMYQ |
Ga0210395_113964581 | 3300020582 | Soil | MKAAARQQLDPTIRSNDTRDFHQSLRARIVGQEEG |
Ga0210401_101787131 | 3300020583 | Soil | MKAATRQQLDPTIRSNDTRDFHQSLRARIVGQEEGV |
Ga0215015_100062713 | 3300021046 | Soil | MRPAVRQQLNPSIRSNDTRDFEGSLRAKIVGQEEGVQSLVD |
Ga0179596_104503532 | 3300021086 | Vadose Zone Soil | MKAAVRHQLDPTIRSTDTCDFQSSLCAKIVGQEEGV |
Ga0210406_108549231 | 3300021168 | Soil | MKAATRQQLDPTIRSNDTRDFHQSLRARIVGQEEGVQAL |
Ga0210400_100876171 | 3300021170 | Soil | MKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSL |
Ga0210387_112330691 | 3300021405 | Soil | MKAAARQQLDPTIRSNDTRDFHQSLRARIVGQEEGV |
Ga0210384_110863301 | 3300021432 | Soil | MKSAVRQQLDPSIRSTDTRDFESSLRAKIVGQAEGVQALVDMYQVFCAGL |
Ga0210410_103300702 | 3300021479 | Soil | MRAAARQQLDPTIRSNDTRDFQSSLRAKIVGQEEGV |
Ga0210409_101599951 | 3300021559 | Soil | MKAAAKQQLDPSIRSTDTRGFHSALRSKIVGQEEGVQS |
Ga0126371_108366951 | 3300021560 | Tropical Forest Soil | MKAAARQQLDPSIRSNDTREFHNALRSKIVGQEEGVLA |
Ga0126371_121884702 | 3300021560 | Tropical Forest Soil | MRPAVRQQLDPSIRSTDTRDFEASLRAKIVGQAEGVQSLVDMYQVFCA |
Ga0247691_10414871 | 3300024222 | Soil | MKAAARQQLDPTIRSNDTRDFHQSLRARIVGQEEGVQALVDL |
Ga0179589_101047492 | 3300024288 | Vadose Zone Soil | MKSAVRQQLDPTIRSIDTRDFEASLRAKVVGQAEGVQSLV |
Ga0137417_10337391 | 3300024330 | Vadose Zone Soil | MKAAVRHQLDPTIRSSDTRDFQGALRAKIVGQEEGVQALGSTCTRSS |
Ga0137417_143075512 | 3300024330 | Vadose Zone Soil | MKAAVRHQWDPTILSNDTRDFQGPALENCRAREGVQALVDLYQVFCRG |
Ga0207692_103800931 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAAARQQLDPSIRSNDTREFHNALRSKIVGQEEGVQALV |
Ga0207664_115874731 | 3300025929 | Agricultural Soil | MRPAVRQQLDPSIRSEDTRAFDQALRMKIVGQEEGVQALVD |
Ga0207665_104131231 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAATRQQLDPTIRSNDTREFQNYLRAKIVGQEEGVQALVD |
Ga0209862_10567001 | 3300026222 | Permafrost Soil | MKAAVRQQLDPSIRSTDTRDFETTLRSKIVGQVEGVQSLVMKLDRYKLR |
Ga0209438_10275981 | 3300026285 | Grasslands Soil | MKAAVRHQLDPTIRSSDTCDFHSSLRAKIVGQEEGVQSLVDMFQ |
Ga0209237_12245012 | 3300026297 | Grasslands Soil | MKAAVRHQLDPTIRSNDTCDFHASLRAKIVGQEEGVQSLVDM |
Ga0209238_12103272 | 3300026301 | Grasslands Soil | MKAAARQQLDPTIRSNDTREFQNYLRAKIVGQEEGVQA |
Ga0209238_12118561 | 3300026301 | Grasslands Soil | MRSAARHQLDPTIRSSDTRDFHGALRAKIVGQEEGVQALVD |
Ga0209154_11190452 | 3300026317 | Soil | MKAAVRHQLDPTIRSNDTCDFHASLRAKIVGQEEGVQSL |
Ga0257147_10758271 | 3300026475 | Soil | MRPAVRQQLNPSIRSNDTRDFEGSLRAKIVGQEEGVQSLVDL |
Ga0209648_106991022 | 3300026551 | Grasslands Soil | MKAAVRQQLDPTIRSNDTRDFHSSLRAKIVGQEEG |
Ga0207776_10256481 | 3300027035 | Tropical Forest Soil | MRAAVRQQLDPSIRSTDTREFQQSLRAKIVGQEEGVQALV |
Ga0207780_10645181 | 3300027313 | Tropical Forest Soil | MRAAVRQQLDPTIRSNDTRDFHQSLRAKIVGQEEG |
Ga0209004_10947131 | 3300027376 | Forest Soil | MRAAAAVQLDPTIPGNDTRDFHTAMRAKIVGQEEGVQ |
Ga0209076_11257151 | 3300027643 | Vadose Zone Soil | MKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSLVD |
Ga0209076_11811232 | 3300027643 | Vadose Zone Soil | MKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSLV |
Ga0209588_10851691 | 3300027671 | Vadose Zone Soil | MKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVKS |
Ga0209118_10992912 | 3300027674 | Forest Soil | MKAAARQQLDPSIRSNDTRDFHQSLRARIVGQEEGVQALVD |
Ga0209011_100212010 | 3300027678 | Forest Soil | MKAAVRQQLDPTIRSTDTCDFHSSLRAKIVGQEEGVQSL |
Ga0209447_101801282 | 3300027701 | Bog Forest Soil | MKAAVRSQLDPNIRSNDTRDFHESLRAKIVGQEEGVQALVDL |
Ga0209038_100580431 | 3300027737 | Bog Forest Soil | MKAAVRQQLDPTIRSIDTREFESSLRAKVVGQVEGVQSLVDMYQV |
Ga0208989_102786711 | 3300027738 | Forest Soil | MKAAVRHQLDPTIRSTDTRDFQGSLRAKIVGQEEGVQA |
Ga0209166_104252892 | 3300027857 | Surface Soil | MKAATRQQLDPTIRSNDTRDFHQSLRARIVGQEEGVQA |
Ga0209283_104159622 | 3300027875 | Vadose Zone Soil | MKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQSLVDM |
Ga0209283_106515411 | 3300027875 | Vadose Zone Soil | MKAAARQQLDPTIRSNDTRDFHSSLRAKIVGQEEGV |
Ga0209067_105573803 | 3300027898 | Watersheds | MRAAVRQQLDPSVRSTDSRDFETSLRAKIVGQEEGV |
Ga0137415_104484602 | 3300028536 | Vadose Zone Soil | MKAAVRHQLDPTIRSNDTCDFHSSLRAKIVGQEEGVQS |
Ga0318516_101802601 | 3300031543 | Soil | MRAAVRQQLDPSIRSNDTREFHQALRAKIVGQEEG |
Ga0310915_104045992 | 3300031573 | Soil | MKAAVRQQLDPSIRSNDTREFQQSLRAKIVGQEEGVQAL |
Ga0307476_113145802 | 3300031715 | Hardwood Forest Soil | MPMKAAARQQLDPSIRSTDSRDFEGALRSKIVGQAEG |
Ga0318501_101586953 | 3300031736 | Soil | MTTAAGQQLDPSSRSADARAFDSAMRSKIVGQEEA |
Ga0307475_106757792 | 3300031754 | Hardwood Forest Soil | MKAAVRHQLDPTIRSTDTRDFQGALRAKIVGQEEGVQALV |
Ga0306919_103663761 | 3300031879 | Soil | MKAAVRQQLDPSIRSNDTREFQQSLRAKIVGQEEGVQALVD |
Ga0306921_103855511 | 3300031912 | Soil | MKAAARQQLDPTIRSNDTRDFHQSLRAKIVGQEEG |
Ga0310916_103745342 | 3300031942 | Soil | MKAAVRQQLDPSIRSNDTREFQQSLRAKIVGQEEG |
Ga0306926_126131911 | 3300031954 | Soil | MRAAVRHQLDPTIRSNVTHDFHQALRSKIVGQEEGV |
Ga0307479_100232617 | 3300031962 | Hardwood Forest Soil | MKAAVRHQLDPTIRSNDTRDFQGALRAKIVGQEEG |
Ga0307479_100606045 | 3300031962 | Hardwood Forest Soil | MRAARKQLDPTIRSNDTRDFHSLMRGKIVGQEEGVQALVD |
Ga0306924_103013823 | 3300032076 | Soil | MRPAVRQQLNPTIRSNDTRDFECALRAKIVGQEEGV |
Ga0307470_105736272 | 3300032174 | Hardwood Forest Soil | MRPAVRQQLNPSIRSNDTRDFEGALRSKIVGQEEGVQ |
Ga0307472_1010004242 | 3300032205 | Hardwood Forest Soil | MRSAVRQQLDPSIRSNDTRDFHSSLRAKIVGQEEG |
Ga0335069_103586121 | 3300032893 | Soil | MRAAVRQQLDPTIRSNGTRDFHQSLRSKIVGQEEGVQALVD |
Ga0335083_114329091 | 3300032954 | Soil | MKSAARQQLDPTIRSNETLDFETSLKSKIVGQTEG |
Ga0326728_110877441 | 3300033402 | Peat Soil | MKAAVRHQLDPTIRSNDTRDFHQALRAKIVGQEEG |
Ga0326727_106000441 | 3300033405 | Peat Soil | MRAAVRQQLDPSIRSNDTRDFHQSLRAKIVGQEEGV |
Ga0314864_0181678_2_124 | 3300033805 | Peatland | MKAAARHQLDPSIRSTDTRDFESSLRAKIVGQAEGIQALVD |
Ga0314867_006258_1_129 | 3300033808 | Peatland | MKSAARQQLDPTVRSGETREFEAGLRSKIVGQAEGVQALVDLY |
⦗Top⦘ |