| Basic Information | |
|---|---|
| Family ID | F049711 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 49 residues |
| Representative Sequence | CDYDYIIINDVLENSIHLLESIVRSGTAVPRRQQSRIEEIIASFGGLA |
| Number of Associated Samples | 126 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.63 % |
| % of genes from short scaffolds (< 2000 bps) | 95.21 % |
| Associated GOLD sequencing projects | 120 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.644 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.137 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.630 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF01192 | RNA_pol_Rpb6 | 45.89 |
| PF02441 | Flavoprotein | 41.10 |
| PF04127 | DFP | 6.85 |
| PF03167 | UDG | 2.05 |
| PF00625 | Guanylate_kin | 1.37 |
| PF04851 | ResIII | 0.68 |
| PF00882 | Zn_dep_PLPC | 0.68 |
| PF00392 | GntR | 0.68 |
| PF05163 | DinB | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG1758 | DNA-directed RNA polymerase, subunit K/omega | Transcription [K] | 45.89 |
| COG0452 | Phosphopantothenoylcysteine synthetase/decarboxylase CoaBC | Coenzyme transport and metabolism [H] | 6.85 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 2.05 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 2.05 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 2.05 |
| COG0194 | Guanylate kinase | Nucleotide transport and metabolism [F] | 1.37 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1042094 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300004157|Ga0062590_102786633 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300004157|Ga0062590_102788183 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300004633|Ga0066395_10519767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300004798|Ga0058859_10872473 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300005093|Ga0062594_103051944 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005174|Ga0066680_10783617 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300005180|Ga0066685_10053457 | All Organisms → cellular organisms → Bacteria | 2600 | Open in IMG/M |
| 3300005181|Ga0066678_10908061 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300005328|Ga0070676_11322064 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005330|Ga0070690_101685832 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300005353|Ga0070669_101414147 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 604 | Open in IMG/M |
| 3300005354|Ga0070675_100313686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1384 | Open in IMG/M |
| 3300005365|Ga0070688_100138641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1650 | Open in IMG/M |
| 3300005532|Ga0070739_10560191 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005556|Ga0066707_10829417 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005559|Ga0066700_10907085 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300005560|Ga0066670_10278446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1016 | Open in IMG/M |
| 3300005561|Ga0066699_10245978 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1261 | Open in IMG/M |
| 3300005564|Ga0070664_100126992 | All Organisms → cellular organisms → Bacteria | 2238 | Open in IMG/M |
| 3300005566|Ga0066693_10478952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300005569|Ga0066705_10517891 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300005577|Ga0068857_100263904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1581 | Open in IMG/M |
| 3300005598|Ga0066706_10547579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 920 | Open in IMG/M |
| 3300005615|Ga0070702_100726619 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300005713|Ga0066905_100512226 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300005713|Ga0066905_101907789 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005764|Ga0066903_101877357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1147 | Open in IMG/M |
| 3300005840|Ga0068870_10732089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300005842|Ga0068858_101177599 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300005843|Ga0068860_101932471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300005844|Ga0068862_101820461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300006046|Ga0066652_101349390 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300006046|Ga0066652_101873861 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006237|Ga0097621_102310976 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006358|Ga0068871_101998142 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300006794|Ga0066658_10500281 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300006844|Ga0075428_102546220 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006847|Ga0075431_102092630 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300006865|Ga0073934_10800215 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300007255|Ga0099791_10025973 | All Organisms → cellular organisms → Bacteria | 2544 | Open in IMG/M |
| 3300009012|Ga0066710_101780246 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300009094|Ga0111539_10253511 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300009156|Ga0111538_11182714 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 966 | Open in IMG/M |
| 3300009176|Ga0105242_11846755 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300009176|Ga0105242_12938461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300009177|Ga0105248_10866942 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300009177|Ga0105248_12975356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 540 | Open in IMG/M |
| 3300009252|Ga0103863_10076757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300009254|Ga0103867_1021811 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300009444|Ga0114945_10587025 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300010043|Ga0126380_11211726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300010046|Ga0126384_11097937 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300010046|Ga0126384_12020382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300010047|Ga0126382_10153903 | All Organisms → cellular organisms → Bacteria | 1578 | Open in IMG/M |
| 3300010048|Ga0126373_10587795 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300010048|Ga0126373_13240588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300010132|Ga0127455_1130111 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300010303|Ga0134082_10419380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300010358|Ga0126370_10453158 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1070 | Open in IMG/M |
| 3300010360|Ga0126372_10619225 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300010362|Ga0126377_12423843 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300010362|Ga0126377_12883345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300010362|Ga0126377_13250882 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300010376|Ga0126381_103922988 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300010400|Ga0134122_10377972 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300010401|Ga0134121_13055716 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300011120|Ga0150983_15572340 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300011441|Ga0137452_1314336 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300012201|Ga0137365_10069436 | All Organisms → cellular organisms → Bacteria | 2658 | Open in IMG/M |
| 3300012205|Ga0137362_10070939 | All Organisms → cellular organisms → Bacteria | 2884 | Open in IMG/M |
| 3300012207|Ga0137381_11329316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300012212|Ga0150985_118697508 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300012350|Ga0137372_11237581 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300012356|Ga0137371_10311693 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300012357|Ga0137384_10661492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 850 | Open in IMG/M |
| 3300012379|Ga0134058_1032727 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 614 | Open in IMG/M |
| 3300012384|Ga0134036_1266086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300012393|Ga0134052_1127124 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300012406|Ga0134053_1015482 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300012406|Ga0134053_1062773 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1044 | Open in IMG/M |
| 3300012469|Ga0150984_104178011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300012469|Ga0150984_118357619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 963 | Open in IMG/M |
| 3300012908|Ga0157286_10202115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300012909|Ga0157290_10380892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300012923|Ga0137359_10967083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300012976|Ga0134076_10620535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300012976|Ga0134076_10627797 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300012989|Ga0164305_12026770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300013296|Ga0157374_10075931 | All Organisms → cellular organisms → Bacteria | 3176 | Open in IMG/M |
| 3300013297|Ga0157378_12569363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300013308|Ga0157375_10863463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1051 | Open in IMG/M |
| 3300014267|Ga0075313_1206526 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300014326|Ga0157380_10530730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1150 | Open in IMG/M |
| 3300014745|Ga0157377_10294089 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300015356|Ga0134073_10303768 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300015372|Ga0132256_102431273 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300015372|Ga0132256_102993197 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 568 | Open in IMG/M |
| 3300015374|Ga0132255_101014901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300015374|Ga0132255_103061930 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
| 3300016270|Ga0182036_11300323 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300016387|Ga0182040_11313143 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300016404|Ga0182037_11606104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300016445|Ga0182038_11030669 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300017659|Ga0134083_10072622 | All Organisms → cellular organisms → Bacteria | 1325 | Open in IMG/M |
| 3300018058|Ga0187766_11391535 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300018431|Ga0066655_10285883 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300018482|Ga0066669_10775735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300018482|Ga0066669_11197079 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300019362|Ga0173479_10487790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300019487|Ga0187893_10855145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300021404|Ga0210389_10424600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300021478|Ga0210402_10857680 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300023071|Ga0247752_1075270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300025315|Ga0207697_10230718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300025918|Ga0207662_10491800 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300025923|Ga0207681_11363235 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300025923|Ga0207681_11408164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300025935|Ga0207709_11676821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300025960|Ga0207651_10751541 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300026088|Ga0207641_10195600 | All Organisms → cellular organisms → Bacteria | 1861 | Open in IMG/M |
| 3300026095|Ga0207676_12504534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300026116|Ga0207674_11584223 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300026118|Ga0207675_102556044 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300026121|Ga0207683_11834913 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300026324|Ga0209470_1168662 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300026342|Ga0209057_1053334 | All Organisms → cellular organisms → Bacteria | 1885 | Open in IMG/M |
| 3300026538|Ga0209056_10376489 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
| 3300026550|Ga0209474_10685848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300027617|Ga0210002_1027889 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
| 3300027873|Ga0209814_10153414 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300027873|Ga0209814_10244120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300027873|Ga0209814_10446458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 571 | Open in IMG/M |
| 3300027909|Ga0209382_10952195 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 899 | Open in IMG/M |
| 3300028380|Ga0268265_10962234 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300028380|Ga0268265_12130769 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300028381|Ga0268264_12006266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300028803|Ga0307281_10328181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300031122|Ga0170822_12780721 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300031231|Ga0170824_117966912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300031716|Ga0310813_10463788 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300031716|Ga0310813_11985870 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300031744|Ga0306918_11378712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300031854|Ga0310904_11254330 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300031912|Ga0306921_10505833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300034670|Ga0314795_149243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.64% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.22% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 7.53% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.16% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.48% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.74% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.74% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.05% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.05% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.37% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.37% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.37% |
| Thermal Springs | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs | 0.68% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.68% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005532 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009252 | Microbial communities of water from Amazon river, Brazil - RCM16 | Environmental | Open in IMG/M |
| 3300009254 | Microbial communities of water from Amazon river, Brazil - RCM20 | Environmental | Open in IMG/M |
| 3300009444 | Hot spring microbial communities from Beatty, Nevada to study Microbial Dark Matter (Phase II) - OV2 TP3 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010132 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012384 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012393 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300034670 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| KanNP_Total_noBrdU_T14TCDRAFT_10420941 | 3300000596 | Soil | NDILENSIRLLESIIRSGTAKPRRQQSRIEEIIASFGGLA* |
| Ga0062590_1027866331 | 3300004157 | Soil | KSEIRFYREYDYIIVNDVLENSIRLLESIVKSGYATPARQEKRVEEIIASFGGTA* |
| Ga0062590_1027881831 | 3300004157 | Soil | EIQFYREYDYIIINDVLENSILLLESIVRSGAAFPSHQHARIEEIIASFGGSA* |
| Ga0066395_105197671 | 3300004633 | Tropical Forest Soil | VCRSYDYIVVNDVLDDSVQVLESIVRAGRARPWRQQARIEEIIASFGGTA* |
| Ga0058859_108724733 | 3300004798 | Host-Associated | DVLDNSIRLLECIVRSGTAVPQRQQSRIEEIIASFGGLA* |
| Ga0062594_1030519443 | 3300005093 | Soil | DVLENSILLLESIVRSGTAIPSRQQGRIEEIIASFGGSV* |
| Ga0066680_107836171 | 3300005174 | Soil | YDYIIINDILENSILLLESIIRSGTATPRCQESRIEEIIASFGGLA* |
| Ga0066685_100534571 | 3300005180 | Soil | YIIVNDVLENSILLLESIVRSGRAAPWRQQSRIEEIIASFGGIA* |
| Ga0066678_109080611 | 3300005181 | Soil | EIQFYRDYDYIIINEVLQNSILLLESIVRSGTVKPQRQQARVEEIIASFGGRA* |
| Ga0070676_113220643 | 3300005328 | Miscanthus Rhizosphere | FYRDYDYIIINDILENSIRLLESIVRSGSATPPRQQDRIEEIIASFGGLA* |
| Ga0070690_1016858323 | 3300005330 | Switchgrass Rhizosphere | KAEIRFYCDYDYIIINDVLDNSIRLLECIVRSGTAVPQRQQSRIEEIIASFGGLA* |
| Ga0070669_1014141471 | 3300005353 | Switchgrass Rhizosphere | IAKDEIRFYCDYDYIIINDVLEHSIQLLEPIVRSGTAVPRRQQSRIEEIIASFGGLA* |
| Ga0070675_1003136861 | 3300005354 | Miscanthus Rhizosphere | IVNDVLENSIRLLESIVKSGYATPARQEKRVEEIIASFGGTA* |
| Ga0070688_1001386411 | 3300005365 | Switchgrass Rhizosphere | DYIVINEVLENSIQLLESIVRSGHAVPSRQQARIEEIIASFGGSA* |
| Ga0070739_105601913 | 3300005532 | Surface Soil | SVALLESIVRSGTAAPRRQEARVEEIIASFGGLA* |
| Ga0066707_108294173 | 3300005556 | Soil | AKGEIQFYRDYDYIIINDILENSVLLLESIVHSGAAAPERQQARVEEIIASFGGLA* |
| Ga0066700_109070853 | 3300005559 | Soil | IQFYREYDYIVVNDILEKSVLLLESIVRSGTAAPRRQQARVEEIIASFGGLA* |
| Ga0066670_102784463 | 3300005560 | Soil | GEIQFYRDYDYIIINEVLQNSILLLESIVRSGTVKPQRQQARVEEIIASFGGRA* |
| Ga0066699_102459783 | 3300005561 | Soil | YDYIIINDILDNSILLLESIVRSGKAVPRRQQGRIEEIIASFGGLA* |
| Ga0070664_1001269921 | 3300005564 | Corn Rhizosphere | SEIHACHSYDYIVVNDVLEDSIQVLEAIVRAGRARPERQHARIEEIITSFGGTA* |
| Ga0066693_104789523 | 3300005566 | Soil | IQFYRDYDYIIINDILENSVLLLESIVHSGTAAPERQQARVEEIIASFGGLA* |
| Ga0066705_105178911 | 3300005569 | Soil | RLVIAKREIQFYRDYDYVVINDVLQNSVLLLESIVRSGTASPRRQQARVEEIIASFGGPA |
| Ga0068857_1002639041 | 3300005577 | Corn Rhizosphere | IAICRDYDYIVINDVLEESIQVLEAIVRAGRARPWRQQARIEEIIASFGGIA* |
| Ga0066706_105475793 | 3300005598 | Soil | FYREYDYIIINDVLENSILLLEAIVRSGTAIPSRQQGRIEEIIASFGGSA* |
| Ga0070702_1007266193 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | YDYIIINDILENSILLFESIVRGGTAIPRRQQGRIEEIIASFGGLA* |
| Ga0066905_1005122261 | 3300005713 | Tropical Forest Soil | EILYYRDYDYIIINDILEKSIRLLESIVLSGTAKPSRQQGRIEEIIASFGGLA* |
| Ga0066905_1019077891 | 3300005713 | Tropical Forest Soil | DVLEQSIRLLESVVRSGTATPQRQQRRIEEIIASFGGLA* |
| Ga0066903_1018773573 | 3300005764 | Tropical Forest Soil | RSEIAICREYDYIVINDVLDDSIKVLEAIVRAGRARPWRQQARIEEIIASFGGIA* |
| Ga0068870_107320891 | 3300005840 | Miscanthus Rhizosphere | DYDYIIINDILVNSIHLLESIIRSGSAVPQKQQGRIEEIIASFGGLA* |
| Ga0068858_1011775993 | 3300005842 | Switchgrass Rhizosphere | YYRDYDYIVINEVLENSIELLESIVRSGHAFPSRQQARIEQVIASFGGSA* |
| Ga0068860_1019324713 | 3300005843 | Switchgrass Rhizosphere | KDEIRFYCDYDYIIINDVLEHSSQLLESIVRSGTAVPRRQQSRIEEIIASFGGLA* |
| Ga0068862_1018204611 | 3300005844 | Switchgrass Rhizosphere | DYIIINDVLENSIHLLESIVRSGTAVPRRQQSRIEEIIASFGGLA* |
| Ga0066652_1013493901 | 3300006046 | Soil | LFYRDYDYIIINDILENSILLLESIIRSGTAIPRCQESRIEEIIASFGGLA* |
| Ga0066652_1018738613 | 3300006046 | Soil | SEYDYIIINDILENSILLLESIVRSGTAVPRRQKSRIEEIIASFGGLA* |
| Ga0097621_1023109762 | 3300006237 | Miscanthus Rhizosphere | LEIAKGEIPYYRDYDYIVINEVLENSIQLLESIVRSGHAVPSRQQARIEEIIASFGGSA* |
| Ga0068871_1019981423 | 3300006358 | Miscanthus Rhizosphere | NDVLENSILLLESIVRCGTASPSHQQGRIEEIITSFGGSA* |
| Ga0066658_105002811 | 3300006794 | Soil | GRLEIAKREILFYRDYDYIIINDVLDKSVLLLESIVRSGTAVPRRQQSRIEEIIASFGGIA* |
| Ga0075428_1025462201 | 3300006844 | Populus Rhizosphere | DYDYIIINDILQNSIGLLESIVRSGAALPRLQEGRVEEIIASFGGLA* |
| Ga0075431_1020926301 | 3300006847 | Populus Rhizosphere | IINDILENSIRLLESIVRGRTATPQRQQSRIEEIIASFGGLV* |
| Ga0073934_108002153 | 3300006865 | Hot Spring Sediment | RRRLEIAKGEILFYRDYDYIIINDILENSIRLLESIVRSGTAIPERQQNRIGEIIASFGGLA* |
| Ga0099791_100259735 | 3300007255 | Vadose Zone Soil | YDYIIINDVLENSIRILESIVRSGAAAPWRQQGRIEEIIASFGGIA* |
| Ga0066710_1017802463 | 3300009012 | Grasslands Soil | YRDYDYVIVNDVLEHSILLLESIVRSGTAAPWRQQGRIEEIIASFGGTA |
| Ga0111539_102535111 | 3300009094 | Populus Rhizosphere | NDILENSIRLLESIVRSGSATPPRQQDRIEEIIASFGGLA* |
| Ga0111538_111827141 | 3300009156 | Populus Rhizosphere | EILYYRDYDYIIINDILENSIRLLESIIRSGTAKPRRQQSRIEEIIASFGGLA* |
| Ga0105242_118467553 | 3300009176 | Miscanthus Rhizosphere | SIQLLESIVRSGQAIPTRQQERIEQVIASFGGSA* |
| Ga0105242_129384611 | 3300009176 | Miscanthus Rhizosphere | YIVVNDVLDASIQLLEAIVRAGRAMPTHQQARIEEIIASFGGTA* |
| Ga0105248_108669423 | 3300009177 | Switchgrass Rhizosphere | DYIVINEVLENSIQLLESIVRSGQAIPTRQQERIEQVIASFGGSA* |
| Ga0105248_129753563 | 3300009177 | Switchgrass Rhizosphere | DYDYIVINDILENSIRLLESIVRSGSATPPRQQDRIEEIIASFGGLA* |
| Ga0103863_100767571 | 3300009252 | River Water | VLENSIAVLESIVRCGRAAPARQQVRIEEIIASFGGHA* |
| Ga0103867_10218111 | 3300009254 | River Water | RLEIAKGEIKFYRDYDYIVVNDVLENSIAVLESIVRCGRAAPARQQARIEKIIASFGGHA |
| Ga0114945_105870253 | 3300009444 | Thermal Springs | INDVLENSILLLESIVRSGSATPRRQQNRIEEIIASFGGSA* |
| Ga0126380_112117263 | 3300010043 | Tropical Forest Soil | KDEIRFYRDYDYVIINDILENSILILESIVRSGRAVPRRQVNRIEEIIASFGGLA* |
| Ga0126384_110979373 | 3300010046 | Tropical Forest Soil | YDYIVINEVLENSIQLLESIVRSGHAVPARQQVRIEEIIASFGGSA* |
| Ga0126384_120203823 | 3300010046 | Tropical Forest Soil | YIIVNDVLENSIRLLESIVQSGYATPARQEKRVEEIIASFGGTA* |
| Ga0126382_101539033 | 3300010047 | Tropical Forest Soil | VLEDSVQVLEAIVRSGQARPSRQQARIEEIIASFGGKA* |
| Ga0126373_105877951 | 3300010048 | Tropical Forest Soil | RLEIARSEIGFYRDYDYIIINDILETSILLLESIVRSGTAVPRRQQGRIEEIIASFGGLA |
| Ga0126373_132405883 | 3300010048 | Tropical Forest Soil | LFYRDYDYIVINDVLENSILLRESIIRCSTAIPSKQQHRIEEIIASFGGTA* |
| Ga0127455_11301113 | 3300010132 | Grasslands Soil | ENSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA* |
| Ga0134082_104193801 | 3300010303 | Grasslands Soil | LEIAKCEIQFYRDYDYIIVNDVLENSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA* |
| Ga0126370_104531583 | 3300010358 | Tropical Forest Soil | INDILENSILLLESIVRSGRAVPRRQQSRIEEIIASFGGLA* |
| Ga0126372_106192253 | 3300010360 | Tropical Forest Soil | ENSIRLLESIVRSGTAKPRRQESRIEEIIASFGGLA* |
| Ga0126377_124238431 | 3300010362 | Tropical Forest Soil | LEIAKSEILFYRDYDYIIINDILENSIRLLECIVRSGKATPQRQQTRIEEIIASFGGLA* |
| Ga0126377_128833453 | 3300010362 | Tropical Forest Soil | IINDVLEDSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA* |
| Ga0126377_132508821 | 3300010362 | Tropical Forest Soil | NSIHLLESIVKSGYATPARQEQRVEEIIASFGGTA* |
| Ga0126381_1039229883 | 3300010376 | Tropical Forest Soil | LQNSIILLESLIRSGGAIPAKQECRIEEIIASFGGTA* |
| Ga0134122_103779721 | 3300010400 | Terrestrial Soil | LEIAKGEILFYRDYDYIIINDILDNSIRLLESIVCSGTALPRRQQSRIEEIIASFGGLA* |
| Ga0134121_130557163 | 3300010401 | Terrestrial Soil | YDYIIINDILENSILLLESIVRSGTAVPRHQKSRIEEIIASFGGLA* |
| Ga0150983_155723401 | 3300011120 | Forest Soil | YDFIIINDILENSVVLLESIVRCGSAIPAKQERRIEEIIASFGVTA* |
| Ga0137452_13143363 | 3300011441 | Soil | INDVLENSILLLESIVRSGTASPSHQKGRIEEIIASFGGSA* |
| Ga0137365_100694365 | 3300012201 | Vadose Zone Soil | DYDYIIVNDVLENSILLLESIVRSGRAAPWRQQSRIEEIIASFGGIA* |
| Ga0137362_100709391 | 3300012205 | Vadose Zone Soil | GEIQFYREYDYIVINDILEKSVLLLESIVRSGTAAPRRQQARVEEIIASFGGLA* |
| Ga0137381_113293163 | 3300012207 | Vadose Zone Soil | GEILFYRDYDYIIINDILENSIHLLKCILRSGTAVPRRQQPRIEEIIASFGGLA* |
| Ga0150985_1186975083 | 3300012212 | Avena Fatua Rhizosphere | YNYIIINDILESSILLLESIVRSGTAVPWRQESRIEEIVTSFGGLA* |
| Ga0137372_112375811 | 3300012350 | Vadose Zone Soil | IAKSEILFYRDYDYIIINDVLENSILLLESIVRSGRAAPWRQQSRIEEIIASFGGIA* |
| Ga0137371_103116931 | 3300012356 | Vadose Zone Soil | DYDYVIVNDVLENSILLLESIVRSGTAAPWRQQSRIEEIIASFGGIG* |
| Ga0137384_106614921 | 3300012357 | Vadose Zone Soil | RGEIVFYRDYDYIIINDILENSILLLGSIVRSGTAVPRRQQPRIEEIIASFGGLA* |
| Ga0134058_10327271 | 3300012379 | Grasslands Soil | DYIIINDVLEHSILLLESIVRSGAVKPQLQQARIEEIIASFGGRA* |
| Ga0134036_12660863 | 3300012384 | Grasslands Soil | DYIIVNDVLENSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA* |
| Ga0134052_11271243 | 3300012393 | Grasslands Soil | IRRRLEIAKCEIQFYRDYDYIIVNDVLENSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA* |
| Ga0134053_10154823 | 3300012406 | Grasslands Soil | FYRDYDYIIVNDVLENSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA* |
| Ga0134053_10627731 | 3300012406 | Grasslands Soil | IVNDVLQNSILLLESIVRSGTVKPRRQQARVEEIIASFGGRA* |
| Ga0150984_1041780111 | 3300012469 | Avena Fatua Rhizosphere | ILFYRDYDYIIINDILENSIELLESIVRSGTIVPQRLEGRIEEIIASFGGLA* |
| Ga0150984_1183576193 | 3300012469 | Avena Fatua Rhizosphere | VNDILDNSIQTLEAIVRAGRARSTRQQSKIEEIIASFGGSA* |
| Ga0157286_102021153 | 3300012908 | Soil | EIARSEIPVSRNYDYIVVNDVLEDSVQALEAIVRAGHARPWPQQDRIEQIIASFGGTA* |
| Ga0157290_103808921 | 3300012909 | Soil | IARSEIPVSRNYDYIVVNDVLEDSVQALEAIVRAGHARPWPQQDRIEQIIASFGGTA* |
| Ga0137359_109670833 | 3300012923 | Vadose Zone Soil | INDILENSILLLESIIRSGTAIPRCQESRIEEIIASFGGLA* |
| Ga0134076_106205353 | 3300012976 | Grasslands Soil | FYRDYDYIVVNDVLDNSIQLLEAIVRSGRAIPSRQQARIEEIIASFGGIA* |
| Ga0134076_106277973 | 3300012976 | Grasslands Soil | EIAKDEIQFYRDYDYIIVNDVLQNSILLLESIVRSGTVKPRRQQARVEEIIASFGGRA* |
| Ga0164305_120267702 | 3300012989 | Soil | EIPYYRDYDYIVVNEVLDNSIQLLESIVRSGHAVPSRQQARIEEIIASFGGSA* |
| Ga0157374_100759315 | 3300013296 | Miscanthus Rhizosphere | AICRDYDYIVINDVLNESIQVLEAIVRAGRARPWRQQARIEEIIASFGGIA* |
| Ga0157378_125693633 | 3300013297 | Miscanthus Rhizosphere | YSYYVYIIINDFLENSIHLLEAIVRSGTAVPRRQQSRIEEIIASFGGLA* |
| Ga0157375_108634631 | 3300013308 | Miscanthus Rhizosphere | GEIPYYRDYDYIVINEVLENSIQLLESIVRSGHAVPSRQQARIEEIIASFGGSA* |
| Ga0075313_12065263 | 3300014267 | Natural And Restored Wetlands | YIIVNDILENSIQLLESIVRSQDATPRRQQERIEEILASFGGLA* |
| Ga0157380_105307303 | 3300014326 | Switchgrass Rhizosphere | YRDYDYIVVNDILDNSIQTLEAIVRATRARSTRQQAKIEEIIASFGGTV* |
| Ga0157377_102940893 | 3300014745 | Miscanthus Rhizosphere | RSEIHACHSYDYIVVNDVLEDSIQVLEAIVRAGRARPERQHARIEEIITSFGGTA* |
| Ga0134073_103037683 | 3300015356 | Grasslands Soil | LENSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA* |
| Ga0132256_1024312731 | 3300015372 | Arabidopsis Rhizosphere | DYDYIIINDVLENSIHLLKCIVSTGAARPQYQQSRIEEIIASFGGLA* |
| Ga0132256_1029931971 | 3300015372 | Arabidopsis Rhizosphere | SYDYIVVNDVLDDSVQVLEAIVRAGRARPWRQQARIEDIIASFGGTV* |
| Ga0132255_1010149011 | 3300015374 | Arabidopsis Rhizosphere | NDVIDDSVQTLEAIVRAGRARPWRQQARIEEIIASFGGTA* |
| Ga0132255_1030619301 | 3300015374 | Arabidopsis Rhizosphere | DYIVINDVLEDSVQMLEAIVRVGRAKPERQRDRIEEIIASFGGTA* |
| Ga0182036_113003233 | 3300016270 | Soil | RRLEIAKDEIRFYRDYDYIIVNDILEKSILLLESIVRSGRAVPRRQQSRIEEIIASFGGL |
| Ga0182040_113131433 | 3300016387 | Soil | EIARREIHSYSDYDYIVINDVLEKSISLLESIIVSGTAVPRRQQGRIEEIIASFGGLA |
| Ga0182037_116061041 | 3300016404 | Soil | IAKNEILYYRDYDYIIINDILEHSIRLLESIVRSGTTIPRRQQSRVEEIIASFGGQA |
| Ga0182038_110306691 | 3300016445 | Soil | VINDVLENSIILLESIIRSGGAIPAKQECRIEEIIASFGGTA |
| Ga0134083_100726223 | 3300017659 | Grasslands Soil | FYRDYDYIIVNDVLENSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA |
| Ga0187766_113915353 | 3300018058 | Tropical Peatland | FYRDYDYIIINDILENSILLLESIIRSGKAVPRRQQNRIEEIIASFGGLA |
| Ga0066655_102858833 | 3300018431 | Grasslands Soil | RRLEIAKCEIQFYRDYDYIIVNDVLENSILLLESIVRSGTVKPQRQQARIEEIIASFGGR |
| Ga0066669_107757351 | 3300018482 | Grasslands Soil | FYRDYDYIIINDILENSVLLLESIVHSGTAAPERQQARVEEIIASFGGLA |
| Ga0066669_111970793 | 3300018482 | Grasslands Soil | RDYDYIIVNDVLENSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA |
| Ga0173479_104877901 | 3300019362 | Soil | RRLEIAKGEIPYYRDYDYIVVNEVLEKSIQLLESIVRSGHALPSRQQVRIEEIISSFGGS |
| Ga0187893_108551452 | 3300019487 | Microbial Mat On Rocks | RRRLEIAKGEILFYRDYDYIIVNDILENSILLLESIIRSGGAVPARQQHRIEEIIASFGGFN |
| Ga0210389_104246001 | 3300021404 | Soil | DILEKSILLLESIVRSGTAVPRRQQGRIEEIIASFGGLA |
| Ga0210402_108576801 | 3300021478 | Soil | YRDYDYIIVNDILENSILLLESIVRSGRAVPRRQQSRIEEIIASFGGLA |
| Ga0247752_10752701 | 3300023071 | Soil | EESIQVLEAIVRAGRARPWRQQARIEEIIASFGGIA |
| Ga0207697_102307181 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | EIARSEIAICRDYDYIVINDVLNESIQVLEAIVRAGRARPWRQQARIEEIIASFGGIA |
| Ga0207662_104918001 | 3300025918 | Switchgrass Rhizosphere | ILENSIRLLESIVRSGTAIPRRQQGRIEEIIASFGGLA |
| Ga0207681_113632351 | 3300025923 | Switchgrass Rhizosphere | YDYIVINEVLENSIQLLESIVRSGQAIPTRQQERIEQVIASFGGSA |
| Ga0207681_114081643 | 3300025923 | Switchgrass Rhizosphere | RLEIAKGEILFYRDYDYIIVNDVLDNSAALLEAIVRSGAAFPHQQEHRIEEIIASFGGSA |
| Ga0207709_116768211 | 3300025935 | Miscanthus Rhizosphere | ILFYSDYDYIIINDILENSILLLESIVRSGTAVPRRQKSRIEEIIASFGGLA |
| Ga0207651_107515411 | 3300025960 | Switchgrass Rhizosphere | NDVLEESIQVLEAIVRAGRARPWRQQARIEEIIASFGGIA |
| Ga0207641_101956001 | 3300026088 | Switchgrass Rhizosphere | INEVLENSIQLLESIVRSGHAVPSRQQARIEEIIASFGGSA |
| Ga0207676_125045341 | 3300026095 | Switchgrass Rhizosphere | LEIARSEIAICRDYDYIVINDVLEESIQVLEAIVRAGRARPWRQQARIEEIIASFGGIA |
| Ga0207674_115842231 | 3300026116 | Corn Rhizosphere | ARSEIAICRDYDYIVINDVLEESIQVLEAIVRAGRARPWRQQARIEEIIASFGGIA |
| Ga0207675_1025560441 | 3300026118 | Switchgrass Rhizosphere | LYYPEYNYIIINDVLEKSSHLLESIVRSGTATPQRQGHRIEEIIASFGGLA |
| Ga0207683_118349133 | 3300026121 | Miscanthus Rhizosphere | AKGEIPYYRDYDYIVINEVLENSIQLLESIVRSGHAVPSRQQARIEEIIASFGGSA |
| Ga0209470_11686621 | 3300026324 | Soil | RRRLEIAKSEILFDRDYDYVIVNDVLENSILLLESIVRSGTAAPWRQQSRIEEIIASFGGIG |
| Ga0209057_10533341 | 3300026342 | Soil | RLEIAKCEIRFYRDYDYIIVNDVLENSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA |
| Ga0209056_103764891 | 3300026538 | Soil | YHEYDYIIINDVLENSIRILESIVRSGAAAPWRQQGRIEEIIASFGGIA |
| Ga0209474_106858481 | 3300026550 | Soil | VLENSILLLESIVRSGTVKPQRQQARIEEIIASFGGRA |
| Ga0210002_10278891 | 3300027617 | Arabidopsis Thaliana Rhizosphere | RNYDYIVVNDVLEDSVQALEAIVRAGHARPWPQQDRIEQIIASFGGTA |
| Ga0209814_101534141 | 3300027873 | Populus Rhizosphere | RRLEIAKGEILFYRDYDYIIINDILENSIHLLECILRCGKATPKYQESRIEEIIASFGGL |
| Ga0209814_102441201 | 3300027873 | Populus Rhizosphere | LDIAKREILYYRDYDYIIINDILENSIRLLESIIGSGTAKPRRQQSRIEEIIASFGGLA |
| Ga0209814_104464581 | 3300027873 | Populus Rhizosphere | EHSIRLLESIVRSGTATPRRQQRRIEEIIASFGGLA |
| Ga0209382_109521951 | 3300027909 | Populus Rhizosphere | IINDILENSIRLLESIVRGRTATPQRQQSRIEEIIASFGGLV |
| Ga0268265_109622341 | 3300028380 | Switchgrass Rhizosphere | CDYDYIIINDVLENSIHLLESIVRSGTAVPRRQQSRIEEIIASFGGLA |
| Ga0268265_121307691 | 3300028380 | Switchgrass Rhizosphere | IARSEIHSCHSYDYIVVNDVLDDSIATLEAIVRAGRARPARQQSRIEEIITSFGGTA |
| Ga0268264_120062663 | 3300028381 | Switchgrass Rhizosphere | KDEIRFYCDYDYIIINDVLEHSSQLLESIVRSGTAVPRRQQSRIEEIIASFGGLA |
| Ga0307281_103281813 | 3300028803 | Soil | EVLENSIQLLESIVRSGHAVPSRQQARIEEIIASFGGSA |
| Ga0170822_127807211 | 3300031122 | Forest Soil | RDYDYIVINDVLENSIILLESIIRSGGAIPAKQECRIEEIIASFGGTA |
| Ga0170824_1179669122 | 3300031231 | Forest Soil | VVNDILDNSIQTLEAIVRATRARSTRQQAKIEEIIASFGGTA |
| Ga0310813_104637881 | 3300031716 | Soil | INDVLDNSIRLLECIVRSGTAVPQRQQSRIEEIIASFGGLA |
| Ga0310813_119858701 | 3300031716 | Soil | EYDYIIVNEVLEKSISLLESIVQSGYATPARQEKRVEEIIASFGGTA |
| Ga0306918_113787123 | 3300031744 | Soil | YDYVVINDVLQNSVLLLESIVRSRTAAPRRQEARVEEIIASFGGLA |
| Ga0310904_112543303 | 3300031854 | Soil | IHACHSYDYIVVNDVLEESVRMLEAIVCAGRAKPERQRDRIEEIIASFGGTA |
| Ga0306921_105058331 | 3300031912 | Soil | DYDYIIVNDVLENSVLLLESIVRSGTAAPRRQQARVEGIIASFGGLA |
| Ga0314795_149243_3_203 | 3300034670 | Soil | DEAIHRRLEIAKGEIPYYRDYDYIVVHEVLEKSIQLLESIVRSGHALPSRQQVRIEEIISSFGGSA |
| ⦗Top⦘ |