| Basic Information | |
|---|---|
| Family ID | F049710 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 5.48 % |
| % of genes near scaffold ends (potentially truncated) | 47.26 % |
| % of genes from short scaffolds (< 2000 bps) | 79.45 % |
| Associated GOLD sequencing projects | 101 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.767 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.493 % of family members) |
| Environment Ontology (ENVO) | Unclassified (34.932 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.740 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.05% β-sheet: 2.53% Coil/Unstructured: 73.42% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF01638 | HxlR | 32.19 |
| PF02265 | S1-P1_nuclease | 23.29 |
| PF04264 | YceI | 6.85 |
| PF06439 | 3keto-disac_hyd | 3.42 |
| PF02518 | HATPase_c | 3.42 |
| PF13618 | Gluconate_2-dh3 | 2.74 |
| PF04151 | PPC | 2.05 |
| PF13715 | CarbopepD_reg_2 | 1.37 |
| PF07705 | CARDB | 0.68 |
| PF00930 | DPPIV_N | 0.68 |
| PF04371 | PAD_porph | 0.68 |
| PF13673 | Acetyltransf_10 | 0.68 |
| PF05368 | NmrA | 0.68 |
| PF07075 | DUF1343 | 0.68 |
| PF15902 | Sortilin-Vps10 | 0.68 |
| PF04074 | DUF386 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 32.19 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 6.85 |
| COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.68 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.68 |
| COG2731 | Beta-galactosidase, beta subunit | Carbohydrate transport and metabolism [G] | 0.68 |
| COG2957 | Agmatine/peptidylarginine deiminase | Amino acid transport and metabolism [E] | 0.68 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.77 % |
| Unclassified | root | N/A | 21.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886007|SwRhRL2b_contig_2017705 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 912 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_14251084 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 936 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101322787 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1063 | Open in IMG/M |
| 3300000891|JGI10214J12806_13024575 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 627 | Open in IMG/M |
| 3300000956|JGI10216J12902_103079068 | Not Available | 522 | Open in IMG/M |
| 3300002099|JGI24808J26613_1006843 | All Organisms → cellular organisms → Bacteria | 2663 | Open in IMG/M |
| 3300004019|Ga0055439_10328969 | Not Available | 507 | Open in IMG/M |
| 3300004022|Ga0055432_10112020 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 727 | Open in IMG/M |
| 3300004114|Ga0062593_101353464 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 758 | Open in IMG/M |
| 3300004114|Ga0062593_101672703 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 694 | Open in IMG/M |
| 3300004114|Ga0062593_102547733 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 580 | Open in IMG/M |
| 3300004157|Ga0062590_101723510 | Not Available | 639 | Open in IMG/M |
| 3300004157|Ga0062590_102789835 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 522 | Open in IMG/M |
| 3300004463|Ga0063356_100854608 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1278 | Open in IMG/M |
| 3300004463|Ga0063356_103115478 | Not Available | 714 | Open in IMG/M |
| 3300004463|Ga0063356_105723297 | Not Available | 533 | Open in IMG/M |
| 3300004479|Ga0062595_101838560 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 577 | Open in IMG/M |
| 3300004480|Ga0062592_102542128 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 516 | Open in IMG/M |
| 3300004480|Ga0062592_102659301 | Not Available | 505 | Open in IMG/M |
| 3300004778|Ga0062383_10156099 | Not Available | 1026 | Open in IMG/M |
| 3300005175|Ga0066673_10535992 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 687 | Open in IMG/M |
| 3300005289|Ga0065704_10042632 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 904 | Open in IMG/M |
| 3300005289|Ga0065704_10113572 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1909 | Open in IMG/M |
| 3300005289|Ga0065704_10126753 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1685 | Open in IMG/M |
| 3300005290|Ga0065712_10099043 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2084 | Open in IMG/M |
| 3300005294|Ga0065705_10169028 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1697 | Open in IMG/M |
| 3300005328|Ga0070676_11442949 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 529 | Open in IMG/M |
| 3300005334|Ga0068869_100202063 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1567 | Open in IMG/M |
| 3300005334|Ga0068869_101967546 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 524 | Open in IMG/M |
| 3300005340|Ga0070689_100273376 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1399 | Open in IMG/M |
| 3300005340|Ga0070689_100636616 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 926 | Open in IMG/M |
| 3300005438|Ga0070701_11322414 | Not Available | 516 | Open in IMG/M |
| 3300005466|Ga0070685_11405524 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 536 | Open in IMG/M |
| 3300005471|Ga0070698_100007536 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 11769 | Open in IMG/M |
| 3300005545|Ga0070695_100430758 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1006 | Open in IMG/M |
| 3300005617|Ga0068859_100311616 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 1667 | Open in IMG/M |
| 3300005719|Ga0068861_102129399 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 561 | Open in IMG/M |
| 3300005841|Ga0068863_100000546 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 38297 | Open in IMG/M |
| 3300005841|Ga0068863_100035689 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 4734 | Open in IMG/M |
| 3300005841|Ga0068863_100492145 | Not Available | 1207 | Open in IMG/M |
| 3300005841|Ga0068863_102176419 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005844|Ga0068862_102582669 | Not Available | 520 | Open in IMG/M |
| 3300005937|Ga0081455_11052421 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 503 | Open in IMG/M |
| 3300006046|Ga0066652_100439661 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 1198 | Open in IMG/M |
| 3300006046|Ga0066652_100772460 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 917 | Open in IMG/M |
| 3300006237|Ga0097621_102328026 | Not Available | 513 | Open in IMG/M |
| 3300006844|Ga0075428_100591865 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300006853|Ga0075420_100220180 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 1655 | Open in IMG/M |
| 3300006881|Ga0068865_101054333 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 714 | Open in IMG/M |
| 3300009094|Ga0111539_10215739 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2235 | Open in IMG/M |
| 3300009094|Ga0111539_11972049 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300009100|Ga0075418_10068347 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 3787 | Open in IMG/M |
| 3300009100|Ga0075418_10186491 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium | 2209 | Open in IMG/M |
| 3300009156|Ga0111538_10354575 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1857 | Open in IMG/M |
| 3300009156|Ga0111538_10436044 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1660 | Open in IMG/M |
| 3300009156|Ga0111538_10878900 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1135 | Open in IMG/M |
| 3300009156|Ga0111538_11147721 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 982 | Open in IMG/M |
| 3300009162|Ga0075423_11586095 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 703 | Open in IMG/M |
| 3300009553|Ga0105249_10001780 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 18768 | Open in IMG/M |
| 3300009553|Ga0105249_10470046 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1299 | Open in IMG/M |
| 3300009553|Ga0105249_13132234 | Not Available | 531 | Open in IMG/M |
| 3300010036|Ga0126305_10264706 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1109 | Open in IMG/M |
| 3300010037|Ga0126304_10051152 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2509 | Open in IMG/M |
| 3300010037|Ga0126304_10088151 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 1945 | Open in IMG/M |
| 3300010337|Ga0134062_10253644 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 819 | Open in IMG/M |
| 3300010399|Ga0134127_13533866 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 512 | Open in IMG/M |
| 3300010403|Ga0134123_10894393 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 893 | Open in IMG/M |
| 3300011119|Ga0105246_11047421 | Not Available | 742 | Open in IMG/M |
| 3300012469|Ga0150984_120571453 | Not Available | 523 | Open in IMG/M |
| 3300012882|Ga0157304_1052064 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 633 | Open in IMG/M |
| 3300012885|Ga0157287_1005848 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 1263 | Open in IMG/M |
| 3300012892|Ga0157294_10085875 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 784 | Open in IMG/M |
| 3300012893|Ga0157284_10161166 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 645 | Open in IMG/M |
| 3300012899|Ga0157299_10071576 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 833 | Open in IMG/M |
| 3300012908|Ga0157286_10014637 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1609 | Open in IMG/M |
| 3300012909|Ga0157290_10322231 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 577 | Open in IMG/M |
| 3300012914|Ga0157297_10211405 | Not Available | 677 | Open in IMG/M |
| 3300012930|Ga0137407_10978768 | Not Available | 801 | Open in IMG/M |
| 3300014325|Ga0163163_12350731 | Not Available | 592 | Open in IMG/M |
| 3300014326|Ga0157380_10071785 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2801 | Open in IMG/M |
| 3300014326|Ga0157380_10093599 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 2485 | Open in IMG/M |
| 3300014326|Ga0157380_11925365 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 652 | Open in IMG/M |
| 3300014969|Ga0157376_10897586 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 904 | Open in IMG/M |
| 3300015200|Ga0173480_10006920 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4492 | Open in IMG/M |
| 3300015201|Ga0173478_10013715 | All Organisms → cellular organisms → Bacteria | 2162 | Open in IMG/M |
| 3300015371|Ga0132258_10073062 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 7962 | Open in IMG/M |
| 3300015372|Ga0132256_102620986 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 604 | Open in IMG/M |
| 3300015374|Ga0132255_101125200 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 1181 | Open in IMG/M |
| 3300015374|Ga0132255_102146822 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 851 | Open in IMG/M |
| 3300017792|Ga0163161_10599498 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 908 | Open in IMG/M |
| 3300018051|Ga0184620_10199512 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 664 | Open in IMG/M |
| 3300018067|Ga0184611_1000379 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 8027 | Open in IMG/M |
| 3300018476|Ga0190274_10007638 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 6607 | Open in IMG/M |
| 3300018476|Ga0190274_10038652 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3340 | Open in IMG/M |
| 3300018476|Ga0190274_13839816 | Not Available | 509 | Open in IMG/M |
| 3300018481|Ga0190271_10302548 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1661 | Open in IMG/M |
| 3300018482|Ga0066669_11608644 | Not Available | 593 | Open in IMG/M |
| 3300018920|Ga0190273_12341156 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 506 | Open in IMG/M |
| 3300019356|Ga0173481_10074156 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1240 | Open in IMG/M |
| 3300019361|Ga0173482_10044584 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae | 1412 | Open in IMG/M |
| 3300019362|Ga0173479_10059697 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma | 1284 | Open in IMG/M |
| 3300019871|Ga0193702_1036544 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 616 | Open in IMG/M |
| 3300019884|Ga0193741_1007511 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2893 | Open in IMG/M |
| 3300020009|Ga0193740_1023913 | Not Available | 966 | Open in IMG/M |
| 3300020016|Ga0193696_1168536 | Not Available | 529 | Open in IMG/M |
| 3300020020|Ga0193738_1000058 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 72108 | Open in IMG/M |
| 3300020020|Ga0193738_1000422 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 22821 | Open in IMG/M |
| 3300020020|Ga0193738_1014885 | All Organisms → cellular organisms → Bacteria | 2493 | Open in IMG/M |
| 3300021415|Ga0193694_1000004 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 536325 | Open in IMG/M |
| 3300022737|Ga0247747_1006636 | Not Available | 1131 | Open in IMG/M |
| 3300022756|Ga0222622_10879773 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 656 | Open in IMG/M |
| 3300022894|Ga0247778_1067417 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
| 3300023067|Ga0247743_1041861 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 646 | Open in IMG/M |
| 3300023069|Ga0247751_1002803 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2266 | Open in IMG/M |
| 3300023072|Ga0247799_1070120 | Not Available | 604 | Open in IMG/M |
| 3300023260|Ga0247798_1013670 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 977 | Open in IMG/M |
| 3300025321|Ga0207656_10458249 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 645 | Open in IMG/M |
| 3300025893|Ga0207682_10004429 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 5878 | Open in IMG/M |
| 3300025908|Ga0207643_10884506 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 579 | Open in IMG/M |
| 3300025908|Ga0207643_11141506 | Not Available | 502 | Open in IMG/M |
| 3300025918|Ga0207662_10057146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 2331 | Open in IMG/M |
| 3300025926|Ga0207659_11227787 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 644 | Open in IMG/M |
| 3300025934|Ga0207686_10006287 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga → Chitinophaga niastensis | 6390 | Open in IMG/M |
| 3300025961|Ga0207712_10007619 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales | 6842 | Open in IMG/M |
| 3300025961|Ga0207712_10453893 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1087 | Open in IMG/M |
| 3300026041|Ga0207639_10690480 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 946 | Open in IMG/M |
| 3300026088|Ga0207641_10000539 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 42499 | Open in IMG/M |
| 3300026088|Ga0207641_11292633 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 730 | Open in IMG/M |
| 3300026116|Ga0207674_12170112 | Not Available | 519 | Open in IMG/M |
| 3300026118|Ga0207675_101484560 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 699 | Open in IMG/M |
| 3300026306|Ga0209468_1195916 | Not Available | 512 | Open in IMG/M |
| 3300027831|Ga0209797_10008333 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 4879 | Open in IMG/M |
| 3300027831|Ga0209797_10354719 | Not Available | 603 | Open in IMG/M |
| 3300027907|Ga0207428_10256313 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1303 | Open in IMG/M |
| 3300027907|Ga0207428_10951887 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 605 | Open in IMG/M |
| 3300027909|Ga0209382_10710916 | Not Available | 1080 | Open in IMG/M |
| 3300028281|Ga0247689_1055399 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 561 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1058676 | Not Available | 813 | Open in IMG/M |
| 3300031538|Ga0310888_10498827 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 728 | Open in IMG/M |
| 3300031538|Ga0310888_10841307 | Not Available | 570 | Open in IMG/M |
| 3300031562|Ga0310886_10885976 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4 | 567 | Open in IMG/M |
| 3300031943|Ga0310885_10275170 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 862 | Open in IMG/M |
| 3300031943|Ga0310885_10421704 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 714 | Open in IMG/M |
| 3300032013|Ga0310906_10994123 | Not Available | 603 | Open in IMG/M |
| 3300032075|Ga0310890_11390878 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales | 576 | Open in IMG/M |
| 3300033412|Ga0310810_10959671 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 739 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.42% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.42% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.74% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.05% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.05% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.05% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.05% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.05% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.37% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.68% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002099 | Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDA | Environmental | Open in IMG/M |
| 3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019871 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1 | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022894 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5 | Environmental | Open in IMG/M |
| 3300023067 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300023072 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6 | Environmental | Open in IMG/M |
| 3300023260 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028281 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30 | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| SwRhRL2b_0335.00001030 | 2162886007 | Switchgrass Rhizosphere | MRRKKGPYIIRLIRLALKSVWYALTIPNDPYHEKEVNFWNMPVRKKQRQYR |
| ICChiseqgaiiFebDRAFT_142510843 | 3300000363 | Soil | ALKSVWYALTIPNDPHHEKKVNFWNMPLRKSERERQYR* |
| INPhiseqgaiiFebDRAFT_1013227871 | 3300000364 | Soil | MRRKKMPHFIRLMRLALKSVWYALTTPNDPYHEKEVNFWNIPIRKKQRERQYR* |
| JGI10214J12806_130245751 | 3300000891 | Soil | MRRKKLPYVVRLIRLAFKSVWYALTIPNDPYHEKKVNFWN |
| JGI10216J12902_1030790682 | 3300000956 | Soil | TRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVGERQYR* |
| JGI24808J26613_10068431 | 3300002099 | Soil | MRRKKMPHFIRLMRLAIKSVWYALTIPNDPYHEKRVNFWNMPVRKRGGERQYR* |
| Ga0055439_103289691 | 3300004019 | Natural And Restored Wetlands | IRLMRLALKSVWYALIIPNDPYHEKKVNFWNMPVRKRERQYR* |
| Ga0055432_101120203 | 3300004022 | Natural And Restored Wetlands | MRRKKMPHFIRLMRLALKSVWYALIIPNDPYHEKKVNFWNMPVRKRERQYR* |
| Ga0062593_1013534641 | 3300004114 | Soil | HFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR* |
| Ga0062593_1016727032 | 3300004114 | Soil | MRRKKMPHFIRLMRLAMKSVWYALTIPNDPYHEKRVNFWNMPVRKRGGERQYR* |
| Ga0062593_1025477332 | 3300004114 | Soil | MRRRKMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR* |
| Ga0062590_1017235101 | 3300004157 | Soil | MRRKKLPYVIRLIRLVVKSVWYALTIPNDPYHEKEVNFWNMPVRKRERQYR* |
| Ga0062590_1027898352 | 3300004157 | Soil | MPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRK |
| Ga0063356_1008546082 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRRKKMPHFIRLVRLALKSVWYALTIPNDPHHEKKVNFWNMPLRKSERERQYR* |
| Ga0063356_1031154781 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRRKKLPYIIRSIRLALKCVWYALTIPNDPQHEHEVNFWNIPIRKRQR |
| Ga0063356_1057232971 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKGERGYR* |
| Ga0062595_1018385602 | 3300004479 | Soil | IRLVRLALKSVWYALTIPNDPYHEKQVNFWNMPIRKNERKRQYR* |
| Ga0062592_1025421281 | 3300004480 | Soil | MPHFIRLTRLALKSVWYALTIPNDPYHEKDVNFWNMPKRKKVSERQYR* |
| Ga0062592_1026593011 | 3300004480 | Soil | MRRKKLPYIIRLIRLAIKSVWYALIIPNDPYHEKEVNFWNMPVRKRERQYR* |
| Ga0062383_101560992 | 3300004778 | Wetland Sediment | MPYIIRLIRLAAKSVWYALTVPNDPYHNKEVNFWNMPVRKRERQYR* |
| Ga0066673_105359922 | 3300005175 | Soil | MQKRKMPHFIRLTRLAMKSVWYALIIPNDPYHEKEVNFWNIPKRKKASERQFR* |
| Ga0065704_100426321 | 3300005289 | Switchgrass Rhizosphere | MRRKKLPYIIRLIRLVVKSVWYALTIPNDPYHEKEVNFWNMPVRKRERQYR* |
| Ga0065704_101135722 | 3300005289 | Switchgrass Rhizosphere | MRRKKGPYIIRLIRLALKSVWYALTIPNDPYHEKEVNFWNMPVRKKQRQYR* |
| Ga0065704_101267531 | 3300005289 | Switchgrass Rhizosphere | IRLVRLALKSVWYALTIPNDPYHEKKVNFWNRPIRKRVSERQYR* |
| Ga0065712_100990432 | 3300005290 | Miscanthus Rhizosphere | MRRRKLPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR* |
| Ga0065705_101690283 | 3300005294 | Switchgrass Rhizosphere | MRRRRMPYFIRLIRLALKSVWYALTIPNDPYHEKEVNFWNMPVKKRERGYR* |
| Ga0070676_114429492 | 3300005328 | Miscanthus Rhizosphere | TRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR* |
| Ga0068869_1002020633 | 3300005334 | Miscanthus Rhizosphere | MRKRKLPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR* |
| Ga0068869_1019675462 | 3300005334 | Miscanthus Rhizosphere | ACKLDPMRRKKMPYLLRVIRLAVKCVWYALTTPNDPYHKHEVNFWNIPVRKRQGQFR* |
| Ga0070689_1002733761 | 3300005340 | Switchgrass Rhizosphere | MPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR* |
| Ga0070689_1006366162 | 3300005340 | Switchgrass Rhizosphere | MRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRK |
| Ga0070701_113224141 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKGESEYR* |
| Ga0070685_114055241 | 3300005466 | Switchgrass Rhizosphere | MRRKKMPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKSERERQYR* |
| Ga0070698_10000753612 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRKKLPYIIRLIRLAVKSVWYALIIPNDPYHEKEVNFWNMPVRKKERQYR* |
| Ga0070695_1004307581 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MRRKKLPYMIRMIRLAIKCVWHALTTPNDPYHEKQVNFWNIPVRKRQRQYR* |
| Ga0068859_1003116161 | 3300005617 | Switchgrass Rhizosphere | MRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPI |
| Ga0068861_1021293991 | 3300005719 | Switchgrass Rhizosphere | HNLIPMRRKKLPYAIRLIRFTLKCVWYALTIPNDPFTNKQVNFWNMPIRKRERQGNVPDLQN* |
| Ga0068863_10000054631 | 3300005841 | Switchgrass Rhizosphere | MRRKKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR* |
| Ga0068863_1000356894 | 3300005841 | Switchgrass Rhizosphere | MRRRKMPHFIRLTRLAMKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR* |
| Ga0068863_1004921452 | 3300005841 | Switchgrass Rhizosphere | MRRKKMPHFIRLVRLALKSVWYALTIPNDPYHEKQVNFWNMPIRKNERKRQYR* |
| Ga0068863_1021764191 | 3300005841 | Switchgrass Rhizosphere | LALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR* |
| Ga0068862_1025826691 | 3300005844 | Switchgrass Rhizosphere | KMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR* |
| Ga0081455_110524212 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MPHFIRLTRLALKSVWYALIIPNDPYHEKDVNFWNMPKRKKVS |
| Ga0066652_1004396612 | 3300006046 | Soil | MKSVWYALIIPNDPHHEKEVNFWNMPKRKKVSERQFR* |
| Ga0066652_1007724602 | 3300006046 | Soil | MRRRKMPHFIRLMRLALKSVWYALIIPNDPYHEKEVNFWNMPIRKREGNTSKV* |
| Ga0097621_1023280261 | 3300006237 | Miscanthus Rhizosphere | IPMRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR* |
| Ga0075428_1005918651 | 3300006844 | Populus Rhizosphere | MRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR* |
| Ga0075420_1002201802 | 3300006853 | Populus Rhizosphere | MRRKKMPYVIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKSERERQYR* |
| Ga0068865_1010543331 | 3300006881 | Miscanthus Rhizosphere | MRRKKMPHFIRLTRLALKSVWYALIIPNDPYHEKEVNFWN |
| Ga0111539_102157394 | 3300009094 | Populus Rhizosphere | MRRKKMPHLIRVVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRK |
| Ga0111539_119720491 | 3300009094 | Populus Rhizosphere | MRRKKLPHFIRLVRLALKSVWYALTIPNDPYHEKKVNF |
| Ga0075418_100683473 | 3300009100 | Populus Rhizosphere | MRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKREREYR* |
| Ga0075418_101864911 | 3300009100 | Populus Rhizosphere | MRRRKLPHFIRLMRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR* |
| Ga0111538_103545753 | 3300009156 | Populus Rhizosphere | MRRRKLPHFIRLTRLAMKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR* |
| Ga0111538_104360442 | 3300009156 | Populus Rhizosphere | MRRKKLPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRERGYR* |
| Ga0111538_108789001 | 3300009156 | Populus Rhizosphere | KLNPMRRKKLPYIIRLIRLVVKSVWYALTIPNDPYHEKQVNFWNMPVRKRERQYR* |
| Ga0111538_111477212 | 3300009156 | Populus Rhizosphere | MPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR* |
| Ga0075423_115860951 | 3300009162 | Populus Rhizosphere | MRRRKLPHFIRLTRLAIKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR* |
| Ga0105249_100017806 | 3300009553 | Switchgrass Rhizosphere | MRRKKMPYIIRLMRLALKSVWYALTIPNDPYHEKEVNFWNMPIRKREREYK* |
| Ga0105249_104700461 | 3300009553 | Switchgrass Rhizosphere | AIRLAVKCVWYALTTPNDPYHEKQVNFWNIPVRKRQRQYR* |
| Ga0105249_131322341 | 3300009553 | Switchgrass Rhizosphere | MRKRKMPHFIRLTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVSERQYR* |
| Ga0126305_102647061 | 3300010036 | Serpentine Soil | LNPMRRKKMPHLIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKSERKRQYR* |
| Ga0126304_100511523 | 3300010037 | Serpentine Soil | MRKRKLPHFIRLMRLVLKSVWYALTIPNDPYIQKKVNFWNMPVRKRERGYR* |
| Ga0126304_100881512 | 3300010037 | Serpentine Soil | MRRKKMPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR* |
| Ga0134062_102536441 | 3300010337 | Grasslands Soil | RLTRLAMKSVWYALIIPNDPYHEKEVNFWNIPKRKKASERQFR* |
| Ga0134127_135338662 | 3300010399 | Terrestrial Soil | KLNPMRRKKLPYIIRSIRLAVKCVWYALTTPNDPYHEKQVNFWNIPVRKRQRQYR* |
| Ga0134123_108943932 | 3300010403 | Terrestrial Soil | MRRKKMPHFIRLTRLALKSVWYALIIPNDPYHEKEVNFWNIPKRKKMGERQYR* |
| Ga0105246_110474212 | 3300011119 | Miscanthus Rhizosphere | MRRKKMPHFIRLMRLAMKSVWYALTIPNDPYHEKRVNFWNMPVRKRG |
| Ga0150984_1205714532 | 3300012469 | Avena Fatua Rhizosphere | QKRKMPHFIRLTRLAMKSVWYALIIPNDPYHEKEVNFWNIPKRKKVSERQFK* |
| Ga0157304_10520642 | 3300012882 | Soil | PHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR* |
| Ga0157287_10058481 | 3300012885 | Soil | LKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR* |
| Ga0157294_100858751 | 3300012892 | Soil | RKLPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR* |
| Ga0157284_101611662 | 3300012893 | Soil | PMRRRKMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR* |
| Ga0157299_100715761 | 3300012899 | Soil | LVRLALKSVWYALTIPNDPYHEKKVNFWNMPLRKSERERQYR* |
| Ga0157286_100146371 | 3300012908 | Soil | IRLMRLATKSVWYALTIPNDPYHEKRVNFWNMPVRKRGGERQYR* |
| Ga0157290_103222311 | 3300012909 | Soil | RKMPHFIRLTRLALKSVWYALTIPNDPYHEKDVNFWNMPKRKKVSERQYR* |
| Ga0157297_102114052 | 3300012914 | Soil | MHRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKDVNFWNMPKRKKVSERQYR* |
| Ga0137407_109787683 | 3300012930 | Vadose Zone Soil | ICAYNLIPMRRKKRPYIIRLIRLTLKSVWHALTLPEDPYQEKEVNFWNIPIRKRERQYR* |
| Ga0163163_123507311 | 3300014325 | Switchgrass Rhizosphere | MKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR* |
| Ga0157380_100717855 | 3300014326 | Switchgrass Rhizosphere | LKSVWYALTIPNDPYHEKKVNFWNMPIRKSERERQYR* |
| Ga0157380_100935993 | 3300014326 | Switchgrass Rhizosphere | MRRKKMPHFIRLARLALKSVWYALTIPNDPHHEKKVNFWNMPIRKSESERQYR* |
| Ga0157380_119253652 | 3300014326 | Switchgrass Rhizosphere | ALKSVWYALIIPNDPYHEKEVNFWNMPKRKKMGERQYR* |
| Ga0157376_108975862 | 3300014969 | Miscanthus Rhizosphere | MPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVGERQYR* |
| Ga0173480_100069205 | 3300015200 | Soil | MRRKKMPHLIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKSETKRQYR* |
| Ga0173478_100137155 | 3300015201 | Soil | MPHFIRLTRLAFKGVWYALTIRNDPLNEKEVNFWNMPKRKKVSE |
| Ga0132258_100730627 | 3300015371 | Arabidopsis Rhizosphere | MPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR* |
| Ga0132256_1026209861 | 3300015372 | Arabidopsis Rhizosphere | FIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKSERERQYR* |
| Ga0132255_1011252002 | 3300015374 | Arabidopsis Rhizosphere | MQKRKMPHFIRLTRLAMKSVWYALIIPNDPHHEKEVNFWNMPKRKKVSERQFR* |
| Ga0132255_1021468221 | 3300015374 | Arabidopsis Rhizosphere | KMPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKSERERQYR* |
| Ga0163161_105994982 | 3300017792 | Switchgrass Rhizosphere | RRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR |
| Ga0184620_101995122 | 3300018051 | Groundwater Sediment | MRRKKMPHLIRLIRLALKSVWYALTTPNDPYHEKEVNFWNMPVRKREREYR |
| Ga0184611_10003794 | 3300018067 | Groundwater Sediment | MRRKKMPHFIRLMRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKSERERQYR |
| Ga0190274_100076384 | 3300018476 | Soil | MRRRKMPHFIRLTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVSERQYR |
| Ga0190274_100386522 | 3300018476 | Soil | MRRKKMPHFIRLVRLALKSVWYALTIPNDPHYEKKVNFWNMPLRKSERERQYR |
| Ga0190274_138398161 | 3300018476 | Soil | VLKLICTCKSVRMRVKKKPYIIRLIRLGLKSVWHALTVPNDPYSDKKVNFWNIPIKKREKQYR |
| Ga0190271_103025481 | 3300018481 | Soil | MRRRKMPHFIRLTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVSE |
| Ga0066669_116086442 | 3300018482 | Grasslands Soil | MQKRKMPHIIRLTRLAMKSVWYALIIPNDPYHEKEVNFWNIPKRKKASERQFR |
| Ga0190273_123411561 | 3300018920 | Soil | MRRKKMPYLIRVIRLSLKCVWYALTIPNDPYHEKEVNFWNMPIRKRERQYR |
| Ga0173481_100741562 | 3300019356 | Soil | MRRKKMPHFIRLMRLAMKSVWYALTIPNDPYHEKRVNFWNMPVRKRGGERQYR |
| Ga0173482_100445842 | 3300019361 | Soil | MRRRKMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR |
| Ga0173479_100596971 | 3300019362 | Soil | MPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR |
| Ga0193702_10365441 | 3300019871 | Soil | MPDFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR |
| Ga0193741_10075113 | 3300019884 | Soil | MRKRKMPHFIRLTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVSERQYR |
| Ga0193740_10239132 | 3300020009 | Soil | PKLFPMRRRKKSYVIRLIRFALKSVWFALTTPNDPYHTKEVNFWNMPVRKRERQYR |
| Ga0193696_11685361 | 3300020016 | Soil | MRRKKMPHLIRLIRLALKSVWYALTTPNDPYHEKKVNFWNMPVRKREREYRQCENAARN |
| Ga0193738_100005855 | 3300020020 | Soil | MRKRKMPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNIPKRKKVSERQYR |
| Ga0193738_100042216 | 3300020020 | Soil | MRRRKMPHFIRLTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVGERQYR |
| Ga0193738_10148853 | 3300020020 | Soil | MRRRKKSYVIRLIRFALKSVWFALTTPNDPYHTKEVNFWNMPVRKRERQYR |
| Ga0193694_1000004162 | 3300021415 | Soil | MRRRKMPHFIRLTRLAFKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR |
| Ga0247747_10066361 | 3300022737 | Soil | MRRKKMPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKSETKRQYR |
| Ga0222622_108797731 | 3300022756 | Groundwater Sediment | SVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR |
| Ga0247778_10674171 | 3300022894 | Plant Litter | IPMRRRKMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR |
| Ga0247743_10418612 | 3300023067 | Soil | MRRKKMPHLIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVR |
| Ga0247751_10028031 | 3300023069 | Soil | LIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPLRKSERERQYR |
| Ga0247799_10701201 | 3300023072 | Soil | MPHFIRLMRLAMKSVWYALTIPNDPYHEKRVNFWNMPVRKRGGERQYR |
| Ga0247798_10136703 | 3300023260 | Soil | RLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVGERQYR |
| Ga0207656_104582491 | 3300025321 | Corn Rhizosphere | MRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKAVN |
| Ga0207682_100044295 | 3300025893 | Miscanthus Rhizosphere | MRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR |
| Ga0207643_108845061 | 3300025908 | Miscanthus Rhizosphere | MPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR |
| Ga0207643_111415061 | 3300025908 | Miscanthus Rhizosphere | MRKRKLPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR |
| Ga0207662_100571461 | 3300025918 | Switchgrass Rhizosphere | RRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR |
| Ga0207659_112277871 | 3300025926 | Miscanthus Rhizosphere | MRRRKLPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR |
| Ga0207686_100062877 | 3300025934 | Miscanthus Rhizosphere | IPMRRRKMPHFIRLTRLALKSVWYALIIPNDPYHEKKVNFWNMPIRKRESEYR |
| Ga0207712_100076195 | 3300025961 | Switchgrass Rhizosphere | MRRKKMPYIIRLMRLALKSVWYALTIPNDPYHEKEVNFWNMPIRKREREYK |
| Ga0207712_104538932 | 3300025961 | Switchgrass Rhizosphere | MRRRKMPHFIRLTRLALKSVWYALIIPNDPYHEKEVNFWNMPKRKKMGERQYR |
| Ga0207639_106904801 | 3300026041 | Corn Rhizosphere | MRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWN |
| Ga0207641_1000053932 | 3300026088 | Switchgrass Rhizosphere | MRRKKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR |
| Ga0207641_112926333 | 3300026088 | Switchgrass Rhizosphere | RKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKRESEYK |
| Ga0207674_121701122 | 3300026116 | Corn Rhizosphere | RLIRLALKSVWHALTVPNDPYSDKKVNFWNIPIKKREKQYRQKSEANPC |
| Ga0207675_1014845602 | 3300026118 | Switchgrass Rhizosphere | MRRRKMPHFIRLMRLALKSVWYALTIPNDPYHEKEVNFW |
| Ga0209468_11959162 | 3300026306 | Soil | MQKRKMPHFIRLTRLAMKSVWYALIIPNDPYHEKEVNFWNIPKRKKASERQFR |
| Ga0209797_100083331 | 3300027831 | Wetland Sediment | MPYIIRLIRLAAKSVWYALTVPNDPYHNKEVNFWNMP |
| Ga0209797_103547191 | 3300027831 | Wetland Sediment | RLIRLAAKSVWYALTVPNDPYHNKEVNFWNMPVRKRERQYR |
| Ga0207428_102563132 | 3300027907 | Populus Rhizosphere | MRRRKLPHFIRLTRLAIKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR |
| Ga0207428_109518871 | 3300027907 | Populus Rhizosphere | MRRKKMPHFIRLIRLALKSVWYALTIPNDPYHEKK |
| Ga0209382_107109162 | 3300027909 | Populus Rhizosphere | MRRKKLPYIIRLIRLVVKSVWYALTIPNDPYHEKEVNFWNMPVRKRERQYR |
| Ga0247689_10553991 | 3300028281 | Soil | MRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR |
| (restricted) Ga0255311_10586762 | 3300031150 | Sandy Soil | LKLICTHNFFPMRRKKRPYIIRLIKLSLKCIWHALTAPNDPFHNKEVNFWNMPVRKREKRFG |
| Ga0310888_104988272 | 3300031538 | Soil | MRRRKLPHFIRLMRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR |
| Ga0310888_108413072 | 3300031538 | Soil | MRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKGERGYR |
| Ga0310886_108859762 | 3300031562 | Soil | MRRRKMPHFIRLARLALKSVWYALTIPNDPYHEKEVNFWNMPKRKSERERQYR |
| Ga0310885_102751702 | 3300031943 | Soil | MRRRKLPHFIRLMRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKGERGYR |
| Ga0310885_104217041 | 3300031943 | Soil | MRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRE |
| Ga0310906_109941231 | 3300032013 | Soil | MRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR |
| Ga0310890_113908781 | 3300032075 | Soil | MRRKKLPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRERGY |
| Ga0310810_109596712 | 3300033412 | Soil | RKKMPHFIRLVRLALKSVWYALTIPNDPYHEKNVNFWNMPIRKRKRQFR |
| ⦗Top⦘ |