NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F049710

Metagenome Family F049710

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049710
Family Type Metagenome
Number of Sequences 146
Average Sequence Length 49 residues
Representative Sequence MRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR
Number of Associated Samples 110
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.48 %
% of genes near scaffold ends (potentially truncated) 47.26 %
% of genes from short scaffolds (< 2000 bps) 79.45 %
Associated GOLD sequencing projects 101
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.767 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.493 % of family members)
Environment Ontology (ENVO) Unclassified
(34.932 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.740 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 24.05%    β-sheet: 2.53%    Coil/Unstructured: 73.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF01638HxlR 32.19
PF02265S1-P1_nuclease 23.29
PF04264YceI 6.85
PF064393keto-disac_hyd 3.42
PF02518HATPase_c 3.42
PF13618Gluconate_2-dh3 2.74
PF04151PPC 2.05
PF13715CarbopepD_reg_2 1.37
PF07705CARDB 0.68
PF00930DPPIV_N 0.68
PF04371PAD_porph 0.68
PF13673Acetyltransf_10 0.68
PF05368NmrA 0.68
PF07075DUF1343 0.68
PF15902Sortilin-Vps10 0.68
PF04074DUF386 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 32.19
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 6.85
COG0823Periplasmic component TolB of the Tol biopolymer transport systemIntracellular trafficking, secretion, and vesicular transport [U] 0.68
COG1506Dipeptidyl aminopeptidase/acylaminoacyl peptidaseAmino acid transport and metabolism [E] 0.68
COG2731Beta-galactosidase, beta subunitCarbohydrate transport and metabolism [G] 0.68
COG2957Agmatine/peptidylarginine deiminaseAmino acid transport and metabolism [E] 0.68
COG3876Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 familyCell wall/membrane/envelope biogenesis [M] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.77 %
UnclassifiedrootN/A21.23 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886007|SwRhRL2b_contig_2017705All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes912Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14251084All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes936Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101322787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1063Open in IMG/M
3300000891|JGI10214J12806_13024575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium627Open in IMG/M
3300000956|JGI10216J12902_103079068Not Available522Open in IMG/M
3300002099|JGI24808J26613_1006843All Organisms → cellular organisms → Bacteria2663Open in IMG/M
3300004019|Ga0055439_10328969Not Available507Open in IMG/M
3300004022|Ga0055432_10112020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes727Open in IMG/M
3300004114|Ga0062593_101353464All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes758Open in IMG/M
3300004114|Ga0062593_101672703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4694Open in IMG/M
3300004114|Ga0062593_102547733All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4580Open in IMG/M
3300004157|Ga0062590_101723510Not Available639Open in IMG/M
3300004157|Ga0062590_102789835All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4522Open in IMG/M
3300004463|Ga0063356_100854608All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1278Open in IMG/M
3300004463|Ga0063356_103115478Not Available714Open in IMG/M
3300004463|Ga0063356_105723297Not Available533Open in IMG/M
3300004479|Ga0062595_101838560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes577Open in IMG/M
3300004480|Ga0062592_102542128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4516Open in IMG/M
3300004480|Ga0062592_102659301Not Available505Open in IMG/M
3300004778|Ga0062383_10156099Not Available1026Open in IMG/M
3300005175|Ga0066673_10535992All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes687Open in IMG/M
3300005289|Ga0065704_10042632All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes904Open in IMG/M
3300005289|Ga0065704_10113572All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1909Open in IMG/M
3300005289|Ga0065704_10126753All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1685Open in IMG/M
3300005290|Ga0065712_10099043All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2084Open in IMG/M
3300005294|Ga0065705_10169028All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1697Open in IMG/M
3300005328|Ga0070676_11442949All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes529Open in IMG/M
3300005334|Ga0068869_100202063All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1567Open in IMG/M
3300005334|Ga0068869_101967546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4524Open in IMG/M
3300005340|Ga0070689_100273376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1399Open in IMG/M
3300005340|Ga0070689_100636616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes926Open in IMG/M
3300005438|Ga0070701_11322414Not Available516Open in IMG/M
3300005466|Ga0070685_11405524All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium536Open in IMG/M
3300005471|Ga0070698_100007536All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes11769Open in IMG/M
3300005545|Ga0070695_100430758All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1006Open in IMG/M
3300005617|Ga0068859_100311616All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1667Open in IMG/M
3300005719|Ga0068861_102129399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes561Open in IMG/M
3300005841|Ga0068863_100000546All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae38297Open in IMG/M
3300005841|Ga0068863_100035689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae4734Open in IMG/M
3300005841|Ga0068863_100492145Not Available1207Open in IMG/M
3300005841|Ga0068863_102176419All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300005844|Ga0068862_102582669Not Available520Open in IMG/M
3300005937|Ga0081455_11052421All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4503Open in IMG/M
3300006046|Ga0066652_100439661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae1198Open in IMG/M
3300006046|Ga0066652_100772460All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes917Open in IMG/M
3300006237|Ga0097621_102328026Not Available513Open in IMG/M
3300006844|Ga0075428_100591865All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300006853|Ga0075420_100220180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae1655Open in IMG/M
3300006881|Ga0068865_101054333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes714Open in IMG/M
3300009094|Ga0111539_10215739All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2235Open in IMG/M
3300009094|Ga0111539_11972049All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300009100|Ga0075418_10068347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales3787Open in IMG/M
3300009100|Ga0075418_10186491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2209Open in IMG/M
3300009156|Ga0111538_10354575All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1857Open in IMG/M
3300009156|Ga0111538_10436044All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales1660Open in IMG/M
3300009156|Ga0111538_10878900All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1135Open in IMG/M
3300009156|Ga0111538_11147721All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes982Open in IMG/M
3300009162|Ga0075423_11586095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4703Open in IMG/M
3300009553|Ga0105249_10001780All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes18768Open in IMG/M
3300009553|Ga0105249_10470046All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1299Open in IMG/M
3300009553|Ga0105249_13132234Not Available531Open in IMG/M
3300010036|Ga0126305_10264706All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1109Open in IMG/M
3300010037|Ga0126304_10051152All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2509Open in IMG/M
3300010037|Ga0126304_10088151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae1945Open in IMG/M
3300010337|Ga0134062_10253644All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes819Open in IMG/M
3300010399|Ga0134127_13533866All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4512Open in IMG/M
3300010403|Ga0134123_10894393All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes893Open in IMG/M
3300011119|Ga0105246_11047421Not Available742Open in IMG/M
3300012469|Ga0150984_120571453Not Available523Open in IMG/M
3300012882|Ga0157304_1052064All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes633Open in IMG/M
3300012885|Ga0157287_1005848All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales1263Open in IMG/M
3300012892|Ga0157294_10085875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes784Open in IMG/M
3300012893|Ga0157284_10161166All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes645Open in IMG/M
3300012899|Ga0157299_10071576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes833Open in IMG/M
3300012908|Ga0157286_10014637All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1609Open in IMG/M
3300012909|Ga0157290_10322231All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes577Open in IMG/M
3300012914|Ga0157297_10211405Not Available677Open in IMG/M
3300012930|Ga0137407_10978768Not Available801Open in IMG/M
3300014325|Ga0163163_12350731Not Available592Open in IMG/M
3300014326|Ga0157380_10071785All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2801Open in IMG/M
3300014326|Ga0157380_10093599All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales2485Open in IMG/M
3300014326|Ga0157380_11925365All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes652Open in IMG/M
3300014969|Ga0157376_10897586All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes904Open in IMG/M
3300015200|Ga0173480_10006920All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4492Open in IMG/M
3300015201|Ga0173478_10013715All Organisms → cellular organisms → Bacteria2162Open in IMG/M
3300015371|Ga0132258_10073062All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales7962Open in IMG/M
3300015372|Ga0132256_102620986All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes604Open in IMG/M
3300015374|Ga0132255_101125200All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae1181Open in IMG/M
3300015374|Ga0132255_102146822All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes851Open in IMG/M
3300017792|Ga0163161_10599498All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes908Open in IMG/M
3300018051|Ga0184620_10199512All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes664Open in IMG/M
3300018067|Ga0184611_1000379All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes8027Open in IMG/M
3300018476|Ga0190274_10007638All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae6607Open in IMG/M
3300018476|Ga0190274_10038652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes3340Open in IMG/M
3300018476|Ga0190274_13839816Not Available509Open in IMG/M
3300018481|Ga0190271_10302548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1661Open in IMG/M
3300018482|Ga0066669_11608644Not Available593Open in IMG/M
3300018920|Ga0190273_12341156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes506Open in IMG/M
3300019356|Ga0173481_10074156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1240Open in IMG/M
3300019361|Ga0173482_10044584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae1412Open in IMG/M
3300019362|Ga0173479_10059697All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Spirosoma1284Open in IMG/M
3300019871|Ga0193702_1036544All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes616Open in IMG/M
3300019884|Ga0193741_1007511All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2893Open in IMG/M
3300020009|Ga0193740_1023913Not Available966Open in IMG/M
3300020016|Ga0193696_1168536Not Available529Open in IMG/M
3300020020|Ga0193738_1000058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes72108Open in IMG/M
3300020020|Ga0193738_1000422All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes22821Open in IMG/M
3300020020|Ga0193738_1014885All Organisms → cellular organisms → Bacteria2493Open in IMG/M
3300021415|Ga0193694_1000004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes536325Open in IMG/M
3300022737|Ga0247747_1006636Not Available1131Open in IMG/M
3300022756|Ga0222622_10879773All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes656Open in IMG/M
3300022894|Ga0247778_1067417All Organisms → cellular organisms → Bacteria921Open in IMG/M
3300023067|Ga0247743_1041861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4646Open in IMG/M
3300023069|Ga0247751_1002803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2266Open in IMG/M
3300023072|Ga0247799_1070120Not Available604Open in IMG/M
3300023260|Ga0247798_1013670All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes977Open in IMG/M
3300025321|Ga0207656_10458249All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium645Open in IMG/M
3300025893|Ga0207682_10004429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales5878Open in IMG/M
3300025908|Ga0207643_10884506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes579Open in IMG/M
3300025908|Ga0207643_11141506Not Available502Open in IMG/M
3300025918|Ga0207662_10057146All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2331Open in IMG/M
3300025926|Ga0207659_11227787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes644Open in IMG/M
3300025934|Ga0207686_10006287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga → Chitinophaga niastensis6390Open in IMG/M
3300025961|Ga0207712_10007619All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales6842Open in IMG/M
3300025961|Ga0207712_10453893All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1087Open in IMG/M
3300026041|Ga0207639_10690480All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes946Open in IMG/M
3300026088|Ga0207641_10000539All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes42499Open in IMG/M
3300026088|Ga0207641_11292633All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes730Open in IMG/M
3300026116|Ga0207674_12170112Not Available519Open in IMG/M
3300026118|Ga0207675_101484560All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium699Open in IMG/M
3300026306|Ga0209468_1195916Not Available512Open in IMG/M
3300027831|Ga0209797_10008333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes4879Open in IMG/M
3300027831|Ga0209797_10354719Not Available603Open in IMG/M
3300027907|Ga0207428_10256313All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1303Open in IMG/M
3300027907|Ga0207428_10951887All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4605Open in IMG/M
3300027909|Ga0209382_10710916Not Available1080Open in IMG/M
3300028281|Ga0247689_1055399All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4561Open in IMG/M
(restricted) 3300031150|Ga0255311_1058676Not Available813Open in IMG/M
3300031538|Ga0310888_10498827All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes728Open in IMG/M
3300031538|Ga0310888_10841307Not Available570Open in IMG/M
3300031562|Ga0310886_10885976All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → unclassified Sphingobacteriales → Sphingobacteriales bacterium 12-47-4567Open in IMG/M
3300031943|Ga0310885_10275170All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes862Open in IMG/M
3300031943|Ga0310885_10421704All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium714Open in IMG/M
3300032013|Ga0310906_10994123Not Available603Open in IMG/M
3300032075|Ga0310890_11390878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales576Open in IMG/M
3300033412|Ga0310810_10959671All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes739Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere6.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil5.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.42%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.74%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere2.74%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment2.05%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.05%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.05%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.05%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.05%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere2.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.05%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.37%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.37%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.37%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.37%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.68%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.68%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.68%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.68%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886007Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002099Soil microbial communities from Manhattan, Kansas, USA - Sample 400um MDAEnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004022Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012882Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2EnvironmentalOpen in IMG/M
3300012885Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012893Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019871Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3a1EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020009Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300023067Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5EnvironmentalOpen in IMG/M
3300023069Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5EnvironmentalOpen in IMG/M
3300023072Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S151-409C-6EnvironmentalOpen in IMG/M
3300023260Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6EnvironmentalOpen in IMG/M
3300025321Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028281Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK30EnvironmentalOpen in IMG/M
3300031150 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4EnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SwRhRL2b_0335.000010302162886007Switchgrass RhizosphereMRRKKGPYIIRLIRLALKSVWYALTIPNDPYHEKEVNFWNMPVRKKQRQYR
ICChiseqgaiiFebDRAFT_1425108433300000363SoilALKSVWYALTIPNDPHHEKKVNFWNMPLRKSERERQYR*
INPhiseqgaiiFebDRAFT_10132278713300000364SoilMRRKKMPHFIRLMRLALKSVWYALTTPNDPYHEKEVNFWNIPIRKKQRERQYR*
JGI10214J12806_1302457513300000891SoilMRRKKLPYVVRLIRLAFKSVWYALTIPNDPYHEKKVNFWN
JGI10216J12902_10307906823300000956SoilTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVGERQYR*
JGI24808J26613_100684313300002099SoilMRRKKMPHFIRLMRLAIKSVWYALTIPNDPYHEKRVNFWNMPVRKRGGERQYR*
Ga0055439_1032896913300004019Natural And Restored WetlandsIRLMRLALKSVWYALIIPNDPYHEKKVNFWNMPVRKRERQYR*
Ga0055432_1011202033300004022Natural And Restored WetlandsMRRKKMPHFIRLMRLALKSVWYALIIPNDPYHEKKVNFWNMPVRKRERQYR*
Ga0062593_10135346413300004114SoilHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR*
Ga0062593_10167270323300004114SoilMRRKKMPHFIRLMRLAMKSVWYALTIPNDPYHEKRVNFWNMPVRKRGGERQYR*
Ga0062593_10254773323300004114SoilMRRRKMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR*
Ga0062590_10172351013300004157SoilMRRKKLPYVIRLIRLVVKSVWYALTIPNDPYHEKEVNFWNMPVRKRERQYR*
Ga0062590_10278983523300004157SoilMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRK
Ga0063356_10085460823300004463Arabidopsis Thaliana RhizosphereMRRKKMPHFIRLVRLALKSVWYALTIPNDPHHEKKVNFWNMPLRKSERERQYR*
Ga0063356_10311547813300004463Arabidopsis Thaliana RhizosphereMRRKKLPYIIRSIRLALKCVWYALTIPNDPQHEHEVNFWNIPIRKRQR
Ga0063356_10572329713300004463Arabidopsis Thaliana RhizosphereMRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKGERGYR*
Ga0062595_10183856023300004479SoilIRLVRLALKSVWYALTIPNDPYHEKQVNFWNMPIRKNERKRQYR*
Ga0062592_10254212813300004480SoilMPHFIRLTRLALKSVWYALTIPNDPYHEKDVNFWNMPKRKKVSERQYR*
Ga0062592_10265930113300004480SoilMRRKKLPYIIRLIRLAIKSVWYALIIPNDPYHEKEVNFWNMPVRKRERQYR*
Ga0062383_1015609923300004778Wetland SedimentMPYIIRLIRLAAKSVWYALTVPNDPYHNKEVNFWNMPVRKRERQYR*
Ga0066673_1053599223300005175SoilMQKRKMPHFIRLTRLAMKSVWYALIIPNDPYHEKEVNFWNIPKRKKASERQFR*
Ga0065704_1004263213300005289Switchgrass RhizosphereMRRKKLPYIIRLIRLVVKSVWYALTIPNDPYHEKEVNFWNMPVRKRERQYR*
Ga0065704_1011357223300005289Switchgrass RhizosphereMRRKKGPYIIRLIRLALKSVWYALTIPNDPYHEKEVNFWNMPVRKKQRQYR*
Ga0065704_1012675313300005289Switchgrass RhizosphereIRLVRLALKSVWYALTIPNDPYHEKKVNFWNRPIRKRVSERQYR*
Ga0065712_1009904323300005290Miscanthus RhizosphereMRRRKLPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR*
Ga0065705_1016902833300005294Switchgrass RhizosphereMRRRRMPYFIRLIRLALKSVWYALTIPNDPYHEKEVNFWNMPVKKRERGYR*
Ga0070676_1144294923300005328Miscanthus RhizosphereTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR*
Ga0068869_10020206333300005334Miscanthus RhizosphereMRKRKLPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR*
Ga0068869_10196754623300005334Miscanthus RhizosphereACKLDPMRRKKMPYLLRVIRLAVKCVWYALTTPNDPYHKHEVNFWNIPVRKRQGQFR*
Ga0070689_10027337613300005340Switchgrass RhizosphereMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR*
Ga0070689_10063661623300005340Switchgrass RhizosphereMRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRK
Ga0070701_1132241413300005438Corn, Switchgrass And Miscanthus RhizosphereMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKGESEYR*
Ga0070685_1140552413300005466Switchgrass RhizosphereMRRKKMPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKSERERQYR*
Ga0070698_100007536123300005471Corn, Switchgrass And Miscanthus RhizosphereMRRKKLPYIIRLIRLAVKSVWYALIIPNDPYHEKEVNFWNMPVRKKERQYR*
Ga0070695_10043075813300005545Corn, Switchgrass And Miscanthus RhizosphereMRRKKLPYMIRMIRLAIKCVWHALTTPNDPYHEKQVNFWNIPVRKRQRQYR*
Ga0068859_10031161613300005617Switchgrass RhizosphereMRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPI
Ga0068861_10212939913300005719Switchgrass RhizosphereHNLIPMRRKKLPYAIRLIRFTLKCVWYALTIPNDPFTNKQVNFWNMPIRKRERQGNVPDLQN*
Ga0068863_100000546313300005841Switchgrass RhizosphereMRRKKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR*
Ga0068863_10003568943300005841Switchgrass RhizosphereMRRRKMPHFIRLTRLAMKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR*
Ga0068863_10049214523300005841Switchgrass RhizosphereMRRKKMPHFIRLVRLALKSVWYALTIPNDPYHEKQVNFWNMPIRKNERKRQYR*
Ga0068863_10217641913300005841Switchgrass RhizosphereLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR*
Ga0068862_10258266913300005844Switchgrass RhizosphereKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR*
Ga0081455_1105242123300005937Tabebuia Heterophylla RhizosphereMPHFIRLTRLALKSVWYALIIPNDPYHEKDVNFWNMPKRKKVS
Ga0066652_10043966123300006046SoilMKSVWYALIIPNDPHHEKEVNFWNMPKRKKVSERQFR*
Ga0066652_10077246023300006046SoilMRRRKMPHFIRLMRLALKSVWYALIIPNDPYHEKEVNFWNMPIRKREGNTSKV*
Ga0097621_10232802613300006237Miscanthus RhizosphereIPMRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR*
Ga0075428_10059186513300006844Populus RhizosphereMRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR*
Ga0075420_10022018023300006853Populus RhizosphereMRRKKMPYVIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKSERERQYR*
Ga0068865_10105433313300006881Miscanthus RhizosphereMRRKKMPHFIRLTRLALKSVWYALIIPNDPYHEKEVNFWN
Ga0111539_1021573943300009094Populus RhizosphereMRRKKMPHLIRVVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRK
Ga0111539_1197204913300009094Populus RhizosphereMRRKKLPHFIRLVRLALKSVWYALTIPNDPYHEKKVNF
Ga0075418_1006834733300009100Populus RhizosphereMRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKREREYR*
Ga0075418_1018649113300009100Populus RhizosphereMRRRKLPHFIRLMRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR*
Ga0111538_1035457533300009156Populus RhizosphereMRRRKLPHFIRLTRLAMKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR*
Ga0111538_1043604423300009156Populus RhizosphereMRRKKLPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRERGYR*
Ga0111538_1087890013300009156Populus RhizosphereKLNPMRRKKLPYIIRLIRLVVKSVWYALTIPNDPYHEKQVNFWNMPVRKRERQYR*
Ga0111538_1114772123300009156Populus RhizosphereMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR*
Ga0075423_1158609513300009162Populus RhizosphereMRRRKLPHFIRLTRLAIKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR*
Ga0105249_1000178063300009553Switchgrass RhizosphereMRRKKMPYIIRLMRLALKSVWYALTIPNDPYHEKEVNFWNMPIRKREREYK*
Ga0105249_1047004613300009553Switchgrass RhizosphereAIRLAVKCVWYALTTPNDPYHEKQVNFWNIPVRKRQRQYR*
Ga0105249_1313223413300009553Switchgrass RhizosphereMRKRKMPHFIRLTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVSERQYR*
Ga0126305_1026470613300010036Serpentine SoilLNPMRRKKMPHLIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKSERKRQYR*
Ga0126304_1005115233300010037Serpentine SoilMRKRKLPHFIRLMRLVLKSVWYALTIPNDPYIQKKVNFWNMPVRKRERGYR*
Ga0126304_1008815123300010037Serpentine SoilMRRKKMPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR*
Ga0134062_1025364413300010337Grasslands SoilRLTRLAMKSVWYALIIPNDPYHEKEVNFWNIPKRKKASERQFR*
Ga0134127_1353386623300010399Terrestrial SoilKLNPMRRKKLPYIIRSIRLAVKCVWYALTTPNDPYHEKQVNFWNIPVRKRQRQYR*
Ga0134123_1089439323300010403Terrestrial SoilMRRKKMPHFIRLTRLALKSVWYALIIPNDPYHEKEVNFWNIPKRKKMGERQYR*
Ga0105246_1104742123300011119Miscanthus RhizosphereMRRKKMPHFIRLMRLAMKSVWYALTIPNDPYHEKRVNFWNMPVRKRG
Ga0150984_12057145323300012469Avena Fatua RhizosphereQKRKMPHFIRLTRLAMKSVWYALIIPNDPYHEKEVNFWNIPKRKKVSERQFK*
Ga0157304_105206423300012882SoilPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR*
Ga0157287_100584813300012885SoilLKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR*
Ga0157294_1008587513300012892SoilRKLPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR*
Ga0157284_1016116623300012893SoilPMRRRKMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR*
Ga0157299_1007157613300012899SoilLVRLALKSVWYALTIPNDPYHEKKVNFWNMPLRKSERERQYR*
Ga0157286_1001463713300012908SoilIRLMRLATKSVWYALTIPNDPYHEKRVNFWNMPVRKRGGERQYR*
Ga0157290_1032223113300012909SoilRKMPHFIRLTRLALKSVWYALTIPNDPYHEKDVNFWNMPKRKKVSERQYR*
Ga0157297_1021140523300012914SoilMHRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKDVNFWNMPKRKKVSERQYR*
Ga0137407_1097876833300012930Vadose Zone SoilICAYNLIPMRRKKRPYIIRLIRLTLKSVWHALTLPEDPYQEKEVNFWNIPIRKRERQYR*
Ga0163163_1235073113300014325Switchgrass RhizosphereMKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR*
Ga0157380_1007178553300014326Switchgrass RhizosphereLKSVWYALTIPNDPYHEKKVNFWNMPIRKSERERQYR*
Ga0157380_1009359933300014326Switchgrass RhizosphereMRRKKMPHFIRLARLALKSVWYALTIPNDPHHEKKVNFWNMPIRKSESERQYR*
Ga0157380_1192536523300014326Switchgrass RhizosphereALKSVWYALIIPNDPYHEKEVNFWNMPKRKKMGERQYR*
Ga0157376_1089758623300014969Miscanthus RhizosphereMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVGERQYR*
Ga0173480_1000692053300015200SoilMRRKKMPHLIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKSETKRQYR*
Ga0173478_1001371553300015201SoilMPHFIRLTRLAFKGVWYALTIRNDPLNEKEVNFWNMPKRKKVSE
Ga0132258_1007306273300015371Arabidopsis RhizosphereMPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR*
Ga0132256_10262098613300015372Arabidopsis RhizosphereFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKSERERQYR*
Ga0132255_10112520023300015374Arabidopsis RhizosphereMQKRKMPHFIRLTRLAMKSVWYALIIPNDPHHEKEVNFWNMPKRKKVSERQFR*
Ga0132255_10214682213300015374Arabidopsis RhizosphereKMPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKSERERQYR*
Ga0163161_1059949823300017792Switchgrass RhizosphereRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR
Ga0184620_1019951223300018051Groundwater SedimentMRRKKMPHLIRLIRLALKSVWYALTTPNDPYHEKEVNFWNMPVRKREREYR
Ga0184611_100037943300018067Groundwater SedimentMRRKKMPHFIRLMRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKSERERQYR
Ga0190274_1000763843300018476SoilMRRRKMPHFIRLTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVSERQYR
Ga0190274_1003865223300018476SoilMRRKKMPHFIRLVRLALKSVWYALTIPNDPHYEKKVNFWNMPLRKSERERQYR
Ga0190274_1383981613300018476SoilVLKLICTCKSVRMRVKKKPYIIRLIRLGLKSVWHALTVPNDPYSDKKVNFWNIPIKKREKQYR
Ga0190271_1030254813300018481SoilMRRRKMPHFIRLTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVSE
Ga0066669_1160864423300018482Grasslands SoilMQKRKMPHIIRLTRLAMKSVWYALIIPNDPYHEKEVNFWNIPKRKKASERQFR
Ga0190273_1234115613300018920SoilMRRKKMPYLIRVIRLSLKCVWYALTIPNDPYHEKEVNFWNMPIRKRERQYR
Ga0173481_1007415623300019356SoilMRRKKMPHFIRLMRLAMKSVWYALTIPNDPYHEKRVNFWNMPVRKRGGERQYR
Ga0173482_1004458423300019361SoilMRRRKMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR
Ga0173479_1005969713300019362SoilMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR
Ga0193702_103654413300019871SoilMPDFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR
Ga0193741_100751133300019884SoilMRKRKMPHFIRLTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVSERQYR
Ga0193740_102391323300020009SoilPKLFPMRRRKKSYVIRLIRFALKSVWFALTTPNDPYHTKEVNFWNMPVRKRERQYR
Ga0193696_116853613300020016SoilMRRKKMPHLIRLIRLALKSVWYALTTPNDPYHEKKVNFWNMPVRKREREYRQCENAARN
Ga0193738_1000058553300020020SoilMRKRKMPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNIPKRKKVSERQYR
Ga0193738_1000422163300020020SoilMRRRKMPHFIRLTRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVGERQYR
Ga0193738_101488533300020020SoilMRRRKKSYVIRLIRFALKSVWFALTTPNDPYHTKEVNFWNMPVRKRERQYR
Ga0193694_10000041623300021415SoilMRRRKMPHFIRLTRLAFKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR
Ga0247747_100663613300022737SoilMRRKKMPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKSETKRQYR
Ga0222622_1087977313300022756Groundwater SedimentSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR
Ga0247778_106741713300022894Plant LitterIPMRRRKMPHFIRLTRLALKSVWYALTIPNDPIHEKEVNFWNMPKRKKVSERQYR
Ga0247743_104186123300023067SoilMRRKKMPHLIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVR
Ga0247751_100280313300023069SoilLIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPLRKSERERQYR
Ga0247799_107012013300023072SoilMPHFIRLMRLAMKSVWYALTIPNDPYHEKRVNFWNMPVRKRGGERQYR
Ga0247798_101367033300023260SoilRLALKSVWYALTIPNDPLHEKEVNFWNMPKRKKVGERQYR
Ga0207656_1045824913300025321Corn RhizosphereMRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKAVN
Ga0207682_1000442953300025893Miscanthus RhizosphereMRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR
Ga0207643_1088450613300025908Miscanthus RhizosphereMPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR
Ga0207643_1114150613300025908Miscanthus RhizosphereMRKRKLPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR
Ga0207662_1005714613300025918Switchgrass RhizosphereRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR
Ga0207659_1122778713300025926Miscanthus RhizosphereMRRRKLPHFIRLTRLALKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR
Ga0207686_1000628773300025934Miscanthus RhizosphereIPMRRRKMPHFIRLTRLALKSVWYALIIPNDPYHEKKVNFWNMPIRKRESEYR
Ga0207712_1000761953300025961Switchgrass RhizosphereMRRKKMPYIIRLMRLALKSVWYALTIPNDPYHEKEVNFWNMPIRKREREYK
Ga0207712_1045389323300025961Switchgrass RhizosphereMRRRKMPHFIRLTRLALKSVWYALIIPNDPYHEKEVNFWNMPKRKKMGERQYR
Ga0207639_1069048013300026041Corn RhizosphereMRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWN
Ga0207641_10000539323300026088Switchgrass RhizosphereMRRKKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR
Ga0207641_1129263333300026088Switchgrass RhizosphereRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPVRKRESEYK
Ga0207674_1217011223300026116Corn RhizosphereRLIRLALKSVWHALTVPNDPYSDKKVNFWNIPIKKREKQYRQKSEANPC
Ga0207675_10148456023300026118Switchgrass RhizosphereMRRRKMPHFIRLMRLALKSVWYALTIPNDPYHEKEVNFW
Ga0209468_119591623300026306SoilMQKRKMPHFIRLTRLAMKSVWYALIIPNDPYHEKEVNFWNIPKRKKASERQFR
Ga0209797_1000833313300027831Wetland SedimentMPYIIRLIRLAAKSVWYALTVPNDPYHNKEVNFWNMP
Ga0209797_1035471913300027831Wetland SedimentRLIRLAAKSVWYALTVPNDPYHNKEVNFWNMPVRKRERQYR
Ga0207428_1025631323300027907Populus RhizosphereMRRRKLPHFIRLTRLAIKSVWYALTIPNDPYHEKEVNFWNMPKRKKVSERQYR
Ga0207428_1095188713300027907Populus RhizosphereMRRKKMPHFIRLIRLALKSVWYALTIPNDPYHEKK
Ga0209382_1071091623300027909Populus RhizosphereMRRKKLPYIIRLIRLVVKSVWYALTIPNDPYHEKEVNFWNMPVRKRERQYR
Ga0247689_105539913300028281SoilMRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRESEYR
(restricted) Ga0255311_105867623300031150Sandy SoilLKLICTHNFFPMRRKKRPYIIRLIKLSLKCIWHALTAPNDPFHNKEVNFWNMPVRKREKRFG
Ga0310888_1049882723300031538SoilMRRRKLPHFIRLMRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR
Ga0310888_1084130723300031538SoilMRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKGERGYR
Ga0310886_1088597623300031562SoilMRRRKMPHFIRLARLALKSVWYALTIPNDPYHEKEVNFWNMPKRKSERERQYR
Ga0310885_1027517023300031943SoilMRRRKLPHFIRLMRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKGERGYR
Ga0310885_1042170413300031943SoilMRRRKMPHFIRLTRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRE
Ga0310906_1099412313300032013SoilMRLVLKSVWYALTIPNDPYHEKKVNFWNMPVRKRERGYR
Ga0310890_1139087813300032075SoilMRRKKLPHFIRLVRLALKSVWYALTIPNDPYHEKKVNFWNMPIRKRERGY
Ga0310810_1095967123300033412SoilRKKMPHFIRLVRLALKSVWYALTIPNDPYHEKNVNFWNMPIRKRKRQFR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.