NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049709

Metagenome / Metatranscriptome Family F049709

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049709
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 131 residues
Representative Sequence NNRIYAASQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Number of Associated Samples 119
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 99.32 %
% of genes from short scaffolds (< 2000 bps) 98.63 %
Associated GOLD sequencing projects 114
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.315 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.548 % of family members)
Environment Ontology (ENVO) Unclassified
(39.041 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.096 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 36.59%    β-sheet: 13.01%    Coil/Unstructured: 50.41%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF132794HBT_2 46.58
PF02679ComA 1.37
PF08501Shikimate_dh_N 1.37
PF12895ANAPC3 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG0169Shikimate 5-dehydrogenaseAmino acid transport and metabolism [E] 1.37
COG1809Phosphosulfolactate synthase, CoM biosynthesis protein ACoenzyme transport and metabolism [H] 1.37


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.32 %
UnclassifiedrootN/A0.68 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000953|JGI11615J12901_10460947All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium677Open in IMG/M
3300000955|JGI1027J12803_106272017All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium931Open in IMG/M
3300002100|JGI24809J26612_1011222All Organisms → cellular organisms → Bacteria1862Open in IMG/M
3300004019|Ga0055439_10228899All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium602Open in IMG/M
3300004157|Ga0062590_100565373All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium989Open in IMG/M
3300004157|Ga0062590_101547946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium668Open in IMG/M
3300004157|Ga0062590_102445197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300004463|Ga0063356_101989630All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium879Open in IMG/M
3300004463|Ga0063356_104717805All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium586Open in IMG/M
3300004463|Ga0063356_105856253All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium527Open in IMG/M
3300005289|Ga0065704_10177620All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1255Open in IMG/M
3300005289|Ga0065704_10436693All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium717Open in IMG/M
3300005290|Ga0065712_10128497All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300005294|Ga0065705_10624390All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium692Open in IMG/M
3300005294|Ga0065705_10789685All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium614Open in IMG/M
3300005295|Ga0065707_10400514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium853Open in IMG/M
3300005295|Ga0065707_10771317All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium596Open in IMG/M
3300005353|Ga0070669_102041060All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium501Open in IMG/M
3300005354|Ga0070675_101670829All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium588Open in IMG/M
3300005364|Ga0070673_100361893All Organisms → cellular organisms → Bacteria1290Open in IMG/M
3300005365|Ga0070688_101286333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium590Open in IMG/M
3300005467|Ga0070706_102107927All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium510Open in IMG/M
3300005543|Ga0070672_100170556All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1809Open in IMG/M
3300005566|Ga0066693_10448787All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium528Open in IMG/M
3300005577|Ga0068857_101626154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium631Open in IMG/M
3300005617|Ga0068859_101374723All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium779Open in IMG/M
3300005719|Ga0068861_100919582All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300005843|Ga0068860_101553089All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes684Open in IMG/M
3300006031|Ga0066651_10096687All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1480Open in IMG/M
3300006237|Ga0097621_102353201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium510Open in IMG/M
3300006853|Ga0075420_100360582All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis1258Open in IMG/M
3300006853|Ga0075420_101274980All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium631Open in IMG/M
3300006876|Ga0079217_11113969All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium591Open in IMG/M
3300006880|Ga0075429_101069030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium705Open in IMG/M
3300006894|Ga0079215_11511108All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300006904|Ga0075424_102734022All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300006918|Ga0079216_10968662All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium652Open in IMG/M
3300006969|Ga0075419_10405175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes935Open in IMG/M
3300007004|Ga0079218_10103012All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1967Open in IMG/M
3300009094|Ga0111539_11283373All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium850Open in IMG/M
3300009094|Ga0111539_11868294All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium696Open in IMG/M
3300009100|Ga0075418_11608934All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium706Open in IMG/M
3300009156|Ga0111538_11950959All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium738Open in IMG/M
3300009162|Ga0075423_12794950All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300009610|Ga0105340_1325867All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium675Open in IMG/M
3300010399|Ga0134127_10878427All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium950Open in IMG/M
3300010401|Ga0134121_11881255All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium627Open in IMG/M
3300010403|Ga0134123_10653818All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Niastella → Niastella koreensis1020Open in IMG/M
3300010403|Ga0134123_12059216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium630Open in IMG/M
3300011333|Ga0127502_10894352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium612Open in IMG/M
3300011423|Ga0137436_1145034All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium635Open in IMG/M
3300011435|Ga0137426_1160745All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium663Open in IMG/M
3300012891|Ga0157305_10077868All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium774Open in IMG/M
3300012892|Ga0157294_10163526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium628Open in IMG/M
3300012895|Ga0157309_10182940All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium645Open in IMG/M
3300012895|Ga0157309_10204102All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium620Open in IMG/M
3300012895|Ga0157309_10302919All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium540Open in IMG/M
3300012898|Ga0157293_10128364All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium690Open in IMG/M
3300012899|Ga0157299_10013864All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1421Open in IMG/M
3300012900|Ga0157292_10172436All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium705Open in IMG/M
3300012901|Ga0157288_10241036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium601Open in IMG/M
3300012902|Ga0157291_10349491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300012906|Ga0157295_10084202All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium839Open in IMG/M
3300012906|Ga0157295_10333271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300012907|Ga0157283_10152206All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium683Open in IMG/M
3300012912|Ga0157306_10088013All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium874Open in IMG/M
3300012913|Ga0157298_10403763All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium521Open in IMG/M
3300012914|Ga0157297_10097733All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium875Open in IMG/M
3300012915|Ga0157302_10102912All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes904Open in IMG/M
3300012916|Ga0157310_10337827All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium604Open in IMG/M
3300013297|Ga0157378_13065643All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium519Open in IMG/M
3300013308|Ga0157375_12477067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium619Open in IMG/M
3300014326|Ga0157380_12268961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium607Open in IMG/M
3300014745|Ga0157377_10813596All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium690Open in IMG/M
3300014885|Ga0180063_1264362All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium549Open in IMG/M
3300015077|Ga0173483_10400092All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium705Open in IMG/M
3300015200|Ga0173480_10695067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium637Open in IMG/M
3300015201|Ga0173478_10135972All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium958Open in IMG/M
3300015371|Ga0132258_11213058All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1907Open in IMG/M
3300015373|Ga0132257_104042861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium534Open in IMG/M
3300015374|Ga0132255_105610259All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium531Open in IMG/M
3300018067|Ga0184611_1007521All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2965Open in IMG/M
3300018067|Ga0184611_1275987All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium589Open in IMG/M
3300018074|Ga0184640_10224128All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium851Open in IMG/M
3300018081|Ga0184625_10461933All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M
3300018083|Ga0184628_10564710All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium580Open in IMG/M
3300018084|Ga0184629_10309012All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium832Open in IMG/M
3300018469|Ga0190270_13480466All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium500Open in IMG/M
3300018476|Ga0190274_12714687All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium592Open in IMG/M
3300019356|Ga0173481_10796581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium522Open in IMG/M
3300019361|Ga0173482_10106676All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1026Open in IMG/M
3300019362|Ga0173479_10711394All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300019362|Ga0173479_10728462All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium539Open in IMG/M
3300020016|Ga0193696_1128169All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium639Open in IMG/M
3300021082|Ga0210380_10128218All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1132Open in IMG/M
3300022737|Ga0247747_1026132All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium662Open in IMG/M
3300022737|Ga0247747_1052514All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300022756|Ga0222622_10517207All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium854Open in IMG/M
3300022894|Ga0247778_1171783All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium601Open in IMG/M
3300022898|Ga0247745_1076741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium556Open in IMG/M
3300022898|Ga0247745_1081111All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium544Open in IMG/M
3300022899|Ga0247795_1042822All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium753Open in IMG/M
3300022899|Ga0247795_1043097All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium750Open in IMG/M
3300022908|Ga0247779_1125554All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium671Open in IMG/M
3300022911|Ga0247783_1109899All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium758Open in IMG/M
3300023062|Ga0247791_1057012All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium623Open in IMG/M
3300023064|Ga0247801_1061163All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium590Open in IMG/M
3300023066|Ga0247793_1073906All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300023073|Ga0247744_1067028All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium607Open in IMG/M
3300024055|Ga0247794_10177248All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium678Open in IMG/M
3300025271|Ga0207666_1005809All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1585Open in IMG/M
3300025315|Ga0207697_10138404All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1055Open in IMG/M
3300025558|Ga0210139_1094578All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium613Open in IMG/M
3300025922|Ga0207646_11180186All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium672Open in IMG/M
3300025940|Ga0207691_10908668All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium737Open in IMG/M
3300025940|Ga0207691_10908834All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium737Open in IMG/M
3300025940|Ga0207691_11719727All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300026088|Ga0207641_10308356All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1497Open in IMG/M
3300026306|Ga0209468_1129581All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium727Open in IMG/M
3300027907|Ga0207428_10550139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium835Open in IMG/M
3300027907|Ga0207428_10586327All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium804Open in IMG/M
3300027992|Ga0247750_1009966All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium852Open in IMG/M
3300027993|Ga0247749_1019568All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium717Open in IMG/M
3300027993|Ga0247749_1036574All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium572Open in IMG/M
3300028380|Ga0268265_11895405All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium603Open in IMG/M
3300031547|Ga0310887_10422922All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium789Open in IMG/M
3300031562|Ga0310886_10582116All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium685Open in IMG/M
3300031562|Ga0310886_11033316All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium528Open in IMG/M
3300031716|Ga0310813_11670482All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium596Open in IMG/M
3300031847|Ga0310907_10751198All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium543Open in IMG/M
3300031854|Ga0310904_11257576All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M
3300031858|Ga0310892_11310531All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium519Open in IMG/M
3300031908|Ga0310900_10530738All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium920Open in IMG/M
3300031913|Ga0310891_10368175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium519Open in IMG/M
3300031943|Ga0310885_10707968All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium566Open in IMG/M
3300031943|Ga0310885_10730904All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium558Open in IMG/M
3300031944|Ga0310884_10289829All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes909Open in IMG/M
3300031944|Ga0310884_10632087All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium642Open in IMG/M
3300031944|Ga0310884_11076092All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium502Open in IMG/M
3300032000|Ga0310903_10325622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium763Open in IMG/M
3300032012|Ga0310902_11107748All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium554Open in IMG/M
3300032122|Ga0310895_10524339All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium599Open in IMG/M
3300032211|Ga0310896_10123288All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1193Open in IMG/M
3300032275|Ga0315270_10979427All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium560Open in IMG/M
3300033412|Ga0310810_11397099All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium535Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.55%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil11.64%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil9.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.22%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.42%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere3.42%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil2.74%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.74%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere2.74%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.05%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter2.05%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.05%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere2.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.05%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.37%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere1.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.37%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.68%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.68%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.68%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.68%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000953Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002100Soil microbial communities from Manhattan, Kansas, USA - Sample 500um MDAEnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011333Cornfield soil microbial communities from Stanford, California, USA - CI-CA-CRN metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011435Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT660_2EnvironmentalOpen in IMG/M
3300012891Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012912Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2EnvironmentalOpen in IMG/M
3300012913Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012916Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300014885Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10DEnvironmentalOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022894Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L049-202B-5EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022908Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300023062Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023073Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S154-409C-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025271Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025315Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)Host-AssociatedOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027992Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S125-311R-5EnvironmentalOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300031944Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI11615J12901_1046094713300000953SoilKIRSNNKSPRNKKTTPAEPATAEFASLNEPLGNSFNQPIDDLSLVTSDQNYLTMVNANGRLVKIPTQLASLAPHLQDKPVSEDYYEVLFGEGNYWKETLNEWRKKVASAPMSTGDAFTSLVELLKNVQNR*
JGI1027J12803_10627201713300000955SoilVQNGIEKKISTDTNSNNEKKIDNIKQPDLSSSTSVAVVNPESNITKEKRNKTTATRIARAYATPQTTSVQYAALNSETPGGNSFGQSIDDLSLVTADQNYLTMVNANGRLVKIPAQFASLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
JGI24809J26612_101122213300002100SoilSFNQPIDDLSLVTSDQNYMTMVSANGRLVKIPAQLASLAPHLQDKPVSEDIYEVLFGEGAYWKETLTEWRKKLASAPVSTGDAFTSLVELLKNVQNR*
Ga0055439_1022889913300004019Natural And Restored WetlandsSNTEKKTEIITQPDPISTTAASTIDTESLIKNKRNKTTGIRNNRTYAAPQTTNAQYAVLNSETPGGDSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVPEDYYEVMFGEGAYWKETLNEWRKKVASVPGSSGDAFTSFIELLKTVQDK*
Ga0062590_10056537313300004157SoilDTNINKEKKTDEARQPDISSTPSVTPVIPESLIKKKRNKTEGIRNNRTYAAAQTSNVQYAVLNNEMPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0062590_10154794623300004157SoilNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0062590_10244519713300004157SoilQKSFDQPIDDLSLVTADQHYLTMVNSNGRLVKIPAQLAHLAPHLQEKPISEDINEVMFGEGTYWKETMNEWRKKIASMPVSSGDAFTSFIELLKTVQDK*
Ga0063356_10198963013300004463Arabidopsis Thaliana RhizosphereSVAAINPESLIKSKRNRTTGIKNNRTFASAQTSNVQYAVLNNESPGDNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK*
Ga0063356_10471780523300004463Arabidopsis Thaliana RhizosphereKSKRNKTAIRNNRIYAAPQTSNVQYAALNNERPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASVPVSSGDAFTSFIELLKTVQDK*
Ga0063356_10585625313300004463Arabidopsis Thaliana RhizosphereSPQTSNVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0065704_1017762013300005289Switchgrass RhizosphereIKNRKNNYFNKHRNKLIPQSAVQYAALNAPLGKSFDQPIDDLSSVTADQHYMTMVNSNGRLVKIPAELAHLAPHMQDKPISEDIYEVMFGEGTYWKETMSEWKKKIASLPVSSGDAFTSFIELLKTVQDK*
Ga0065704_1043669313300005289Switchgrass RhizosphereDLHGPKESIVSVSPDTQSINNKRNTSHKRYRSRLIPHPTVQYASLNAPLGKSFDQPIDDLSSVTADQHYMTMVNSNGRLVKIPAELAHLAPHMQDKPISEDIYEVMFGEGNYWKETMGEWRKKIASLPVSSGDAFTSFIELLKTVQDK*
Ga0065712_1012849733300005290Miscanthus RhizosphereSIATINPEITTKNNRNRSESVRKNRIYAASQIANVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLVPHLQNKPVAEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0065705_1062439023300005294Switchgrass RhizosphereTTGVQYAALNNERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK*
Ga0065705_1078968513300005294Switchgrass RhizosphereSLNAPLGKSFDQPIDDLSSVTADQHYMTMVNSNGRLVKIPAELAHLAPHMQDKPISEDIYEVMFGEGNYWKETMGEWRKKIASLPVSSGDAFTSFIELLKTVQDK*
Ga0065707_1040051423300005295Switchgrass RhizosphereASITSASIPPQTTKTRKNNYFNKHRNNFIPQSTVQYAALNAPLGKSFDQPIDDLSSVTADQHYMTMVNSNGRLVKIPAELAHLAPHMQDKPISEDIYEVMFGEGTYWKETMSEWKKKIASLPVSSGDAFTSFIELLKTVQDK*
Ga0065707_1077131723300005295Switchgrass RhizosphereYAALNNERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPNQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK*
Ga0070669_10204106023300005353Switchgrass RhizosphereSLNEPLGKSFNEPIDDLSVVTSDQNYLTMVNTNGRLVKIPAQLASLVPHLQDKPVSEDYYEVLFGEGAYWKETLNEWRKKLASAPVSTGDAFTSLVELLKNVQNR*
Ga0070675_10167082913300005354Miscanthus RhizosphereESTRNNRIYAASQTSNVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRRKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0070673_10036189333300005364Switchgrass RhizosphereNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0070688_10128633313300005365Switchgrass RhizosphereKIATDTNSDSEKKIDNIKQPDLSSSTSIAAVNPESIITKEKRIKTAAIRTARTARTYAAPQTTNVQYAALNSETPGGNSFGQSIDDLSLVTADQNYLTMINANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0070706_10210792713300005467Corn, Switchgrass And Miscanthus RhizosphereQPELPATTSIASINPESLIIKSKRNKTAGVRNRSYAVPEASNVQYAVLNSETPGGNSFGQSIDDLSLVTADQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPFSSGDAFTSFIELLKTVQDK*
Ga0070672_10017055613300005543Miscanthus RhizosphereETISKSKRSKSESTRNNRIYAASQTSNVQYASLNSEIPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0066693_1044878723300005566SoilTANVEYAALNSETPGGNSFGESIDDLSLVTSDQNYFTMVNANGRLVKIPAQFASLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVDSLPTTSGDAFTSFIELLKTVQDK*
Ga0068857_10162615423300005577Corn RhizosphereSTSIAAVNPESIITKEKRIKTAAIRTARTARTYAAPQTTNVQYAALNSETPGGNSFGQSIDDLSLVTADQNYLTMINANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0068859_10137472313300005617Switchgrass RhizosphereEFASLNEPLAKSFNEPIDDLSSVTSDQNYYTMVNANGRLVKIPTQLASLAPHLQDKPIAEDYHEVLFGEGAYWKETLSEWRKKLVSTPTGDAFSSFVELLKTVQDK*
Ga0068861_10091958223300005719Switchgrass RhizosphereNVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0068860_10155308923300005843Switchgrass RhizosphereYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLVPHLQNKPVSEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0066651_1009668713300006031SoilSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPIQEDYYEVMFGEGTYWKETLNEWRMKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0097621_10235320113300006237Miscanthus RhizosphereQQDISPGTSIATINPETISKSKRTKSENARNNKIYAASQASNVQYMALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0075420_10036058233300006853Populus RhizosphereKNTSFKKQRNYLIPQSTVQYASLNAPLGKSFDQTIDDLSSVTADQHYMTMVNSNGRLVKIPAELAHLAPHLQDKPISEDIYEVMFGEGTYWKETMSEWRKRIASLPVSSGDAFTSFIELLKTVQNK*
Ga0075420_10127498013300006853Populus RhizosphereRTARTYAAPQTTSVQYAVLNNETPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSLIELLKTVQDK*
Ga0079217_1111396913300006876Agricultural SoilLGKSFHQPIDDLSSVTADQHYLTMVNLNGRLVKIPAELAHLAPHMQDKPISEDVYEVMFGEGTYWKETMSEWRKKIASLPVSSGDAFTSFIELLKTVQEK*
Ga0075429_10106903013300006880Populus RhizosphereKDKRNKTAGIRTARNYATPQTTGVQYAALNNERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK*
Ga0079215_1151110813300006894Agricultural SoilIAAINPETSSNGKRNRSGTRSNKVYSAPQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAQFANLVPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0075424_10273402213300006904Populus RhizosphereTQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0079216_1096866223300006918Agricultural SoilASVSVKSPIIKNNKKNRNGRIPQSSTVQYAALNEPLGKSFHQPIDDLSSVTADQHYLTMVNLNGRLVKIPAELAHLAPHMQDKPISEDVYEVMFGEGTYWKETMSEWRKKIASLPVSSGDAFTSFIELLKTVQEK*
Ga0075419_1040517533300006969Populus RhizosphereIYAASQTSNVQYASLNSEIPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRRKVASLPVSSGDAFTSFIELLKTVQDK
Ga0079218_1010301213300007004Agricultural SoilGNSFGESIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLVPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0111539_1128337313300009094Populus RhizosphereVTPNISVAATNPGSLIKSKSNKTTNRRYNRIYPETQTSNVQYAALNNEMPGNNSFGQPIDDLSLVTSDQHYLTMVNANGRLAKIPAQFANLVPHLQNKPISEDYYEVMFGEGAYWKETLDEWRKKVASVPVSSGDAFTSFIELLKTVQDK*
Ga0111539_1186829423300009094Populus RhizosphereKSKRNKSENARNNRIYAASQASNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0075418_1160893423300009100Populus RhizosphereAINPETISKGKQNKPGGTRNNRIYAASQTSNVQYASLNSETPGGNSFGQSIDDLSLVTADQTYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK*
Ga0111538_1195095913300009156Populus RhizosphereTKTATDTNSNNEKKIENIQQPDLSPGTSIAATNPETISKNKRIGSNGTRNNRIYAAAQTSNVQYAALNRETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFASLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0075423_1279495023300009162Populus RhizosphereNKHRNGLIPQSTVQYASLNAPLGNSFNQPIDDLSNVTADQHYMTMVNSNGRLVKIPAELAHLAPHMQDKPISEDIYEVMFGEGTYWKETMSEWKKKIASLPVSSGDAFTSFIELLKTVQDK*
Ga0105340_132586723300009610SoilTRNNRIYAASQTSNVQYASLNSETPGGNSFGQSIDDLSLVTADQTYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSLIELLKTVQDK*
Ga0134127_1087842713300010399Terrestrial SoilPNLQSSRGKINNLSRNRNVLIAQPATAQYASLNTPLGKSFNEPIDDLSLVTSDQNYLTMVNANGRLVKIPAQLASLAPHLQDKPVSEDYYEVLFGEGAYWKETLNEWRKKLVSASASGDAFTSFVELLKSVQNK*
Ga0134121_1188125513300010401Terrestrial SoilKKTKTTTDSNSNNEKKVEYIQQPDISPGTSIATINPETITKNNRNRSESARNNRIYAASQTANVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0134123_1065381833300010403Terrestrial SoilLSGKRSGFVAQSATAQFASLKEPLGNSFNQPIDDLSLVTSDQNYLTMINANGRLVKIPAQLASLAPHLQDKPVSEDYYEVLFGEGNYWKETLNEWRKKVASAPVTPGDAFTSLVELLKSVQK*
Ga0134123_1205921613300010403Terrestrial SoilPSQTASVQYASLNSETPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0127502_1089435213300011333SoilDIASATPVAAIDPELPTKNKRNKSTVIRKNRVYAAPQTTNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPIAEDYYEVMFGEGAYWKETLHEWRKKVASVPVSSGDAFTSFIELLKTVQDK*
Ga0137436_114503413300011423SoilSKSKRNKSENAKNNRIYAASQASNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0137426_116074513300011435SoilNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFASLAPHLQNKPVSEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157305_1007786813300012891SoilTDTNSNNEKKIENIQQQDISPGTSIATINPEPINKSKRNKSENARNNRIYAASQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157294_1016352613300012892SoilSLNSETPGGNSFGQSMDDLSVVTSDQNYFAMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRRKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157309_1018294023300012895SoilNSNNEKRVENIQQPALSPGTSLATINPETISKVKRNRSENNRNNRIYAASQTANVQYASLNSETPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK*
Ga0157309_1020410223300012895SoilQTSNVEYTALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPTEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157309_1030291913300012895SoilKSESTRNNRIYAASQTPNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157293_1012836423300012898SoilLNKERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK*
Ga0157299_1001386413300012899SoilKKIENIQQPDISPATSIAAINPETISKGKQDKSAGTRNNRMYAASQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157292_1017243613300012900SoilKRNKSENAKNNRIYAASQASNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPTEFANLAPHLQNKPISEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157288_1024103623300012901SoilIKKKRNKTEGIRNNRTYAAAQTSNVQYAVLNNEMPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK*
Ga0157291_1034949113300012902SoilNPESLIKSKRNRTTGIKNNRTFASAQTSNVQYAVLNNESPGDNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK*
Ga0157295_1008420213300012906SoilNSSTEKKVENIQQPDLSPGTSIATINPETTFKNKRNGSESTKNNRIYAASQTANVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157295_1033327113300012906SoilASQTANVQYAALYSETHDGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSLIELLKTVQDK*
Ga0157283_1015220613300012907SoilIYAASQASNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0157306_1008801333300012912SoilETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPTEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157298_1040376313300012913SoilRIYAASQTPNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVPEDYYEVMFGEGAYWKETLNEWRMKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157297_1009773313300012914SoilPGTSIATINPEPINKNKRNKSENARNNRIYAASQTSNVQYAALNSETPGGKSFGRSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157302_1010291233300012915SoilSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPTEFANLAPHLQNKPVREGYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157310_1033782713300012916SoilKKIDNITKPDLSSTTSAGVADPGSPAIKDKRNKTVGIRTARNYGAAQTTGVQYAALNKERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSLIELLKTVQDK*
Ga0157378_1306564323300013297Miscanthus RhizosphereRSESARNNRIYAASQTANVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157375_1247706723300013308Miscanthus RhizosphereASQTPNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157380_1226896123300014326Switchgrass RhizosphereNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFASLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0157377_1081359613300014745Miscanthus RhizosphereRIYAASQTPNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFASLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSLIELLKTVQDK*
Ga0180063_126436223300014885SoilTGRKSFDQPIDDLSRVTSDEHYLTMVNSNGRLVKIPAELAHLVPHMQDKPISEDIYEVMFGEGNYWKETMSEWKKKIASLPVSSGDAFTSFIELLKTVQDE*
Ga0173483_1040009213300015077SoilNSFGESIDDLSLVTSDQNYFTMVSANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0173480_1069506713300015200SoilNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRRKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0173478_1013597213300015201SoilVNPETISKNKRNKSENARNNRIYAASQTSNVEYTALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0132258_1121305843300015371Arabidopsis RhizosphereVQNGIEKKTATDTDSNNEKKIENTQQPDLSPGTSIAAINPETISKRKRNSAEGTRNNKVYAATQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLSEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0132257_10404286113300015373Arabidopsis RhizosphereRNNRIYAAAQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFADLVPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0132255_10561025913300015374Arabidopsis RhizosphereSKVKRNRSESNRNNRIYAAAQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFASLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK*
Ga0184611_100752113300018067Groundwater SedimentNNRIYAASQTSNVQYASLNSETPGGNSFGQSIDDLSLVTADQTYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSLIELLKTVQDK
Ga0184611_127598713300018067Groundwater SedimentNSNNEKKIENIQQQHISPGTSIATINPEPINKSKRNKSENARNNRIYAASQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0184640_1022412813300018074Groundwater SedimentIATINPEPINKNKRNKSENARNNRIYAASQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMINANGRMVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0184625_1046193313300018081Groundwater SedimentKIENIQQPDNSPETSIATLNPETISKSKRTKSEITRNNRIYAASQTSNVQYAALNSETPGGNSFGQSIDDLSLVTADQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDLYEVMFGEGAYWKETLNEWRKKVASVPGSSGDAFTSFIELLKTVQDK
Ga0184625_1050320423300018081Groundwater SedimentSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFASLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0184628_1056471013300018083Groundwater SedimentTPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0184629_1030901223300018084Groundwater SedimentNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPASSGDAFTSFIELLKTVQDK
Ga0190270_1348046613300018469SoilIQQPDLTPGTSIAAINPATISKSKRNKAAGSRNNRIYAAAQTSNVQYAVLNSEIPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0190274_1271468723300018476SoilKSKRSKSESTRNNRIYAASQTSNVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLTEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0173481_1079658113300019356SoilQSASIADVNPETISKSKRNKSESTRNNRIYAASQTPNVQYAALNSEIPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0173482_1010667633300019361SoilENIQQQDISPGTSIATINPETISKSKRTKSENARNNKIYAASQASNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFASLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0173479_1071139423300019362SoilARNYATPQTTGVQYAALNNERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK
Ga0173479_1072846213300019362SoilKKIENIQQPDISPATTIAAINPETISKGKQDKFAGTRNNRMYAASQTSNVQYASLNSETPGGNSFGQSIDDLSLVTADQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSLIELLKTVQDK
Ga0193696_112816923300020016SoilLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRRKVASLPVSSGDAFTSFIE
Ga0210380_1012821813300021082Groundwater SedimentNPETISKGKQNKSAATRNNRIYAASQTSNVQYASLNSETPGGNSFGQSIDDLSLVTADQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSLIELLKTVQDK
Ga0247747_102613223300022737SoilNRTYAAAQTSNVQYAVLNNEMPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVAALPVSSGDAFTSFIELLKTVQDK
Ga0247747_105251413300022737SoilWLMLRNNKGDDALAGVENGINKKTAADTNSNIEKKIDNITKPDLSSTTSAGVADPGSPAIKDKRNKTVGIRTARNYGAAQTTGVQYAALNKERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKV
Ga0222622_1051720723300022756Groundwater SedimentIETKTATDTNSNNEKKIENIQQQDISPGTSIATINPEPINKSKRNKSENARNNRIYAASQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0247778_117178313300022894Plant LitterSSTEKKVENIQQPDLSPGTSIATINPETTFKNKRNGSESTKNNRIYAASQTANVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0247745_107674113300022898SoilSNVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRRKVASLPVSSGDAFTSFIELLKTVQDK
Ga0247745_108111113300022898SoilDEARQPDISSTPSVTPVIPESLIKKKRNKTEGIRNNRTYAAAQTSNVQYAVLNNEMPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK
Ga0247795_104282223300022899SoilKKKRNKSESARNNRIYAASQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0247795_104309723300022899SoilETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLVPHLQNKPVSEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0247779_112555413300022908Plant LitterNLNTEKKIENIQQPDISSGTSIAALNPETISKSKRNKSEGNRNNRIYAASQTPNIQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0247783_110989913300022911Plant LitterSPETSIAALNPETNSKSKRNKSEGNRNNRIYAASQTPNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0247791_105701213300023062SoilKKRNKTEGIRNNRTYAAAQTSNVQYAVLNNEMPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0247801_106116313300023064SoilDKRNKTAGIRTARNYATPQTTGVQYAALNNERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK
Ga0247793_107390613300023066SoilSAGVADPGSPAIKDKRNKTVGIRTARNYGAAQTTGVQYAALNKERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK
Ga0247744_106702823300023073SoilYASLNSETPGGNSFGQSIDDLSLVTADQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSLIELLKTVQDK
Ga0247794_1017724823300024055SoilQDKFAGTRNNRMYAASQTSNVQYASLNSETPGGNSFGQSIDDLSLVTADQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPISSGDAFTSLIELLKTVQDK
Ga0207666_100580933300025271Corn, Switchgrass And Miscanthus RhizosphereATDSNSNNEKKVENIQQPDILPGTSIATINPETTTKNNRNRSESARNNRIYAASQTANVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0207697_1013840433300025315Corn, Switchgrass And Miscanthus RhizosphereESARNNRIYAASQTANVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0210139_109457823300025558Natural And Restored WetlandsSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVPEDYYEVMFGEGAYWKETLNEWRKKVASVPGSSGDAFTSFIELLKTVQDK
Ga0207646_1118018623300025922Corn, Switchgrass And Miscanthus RhizosphereRIYAASQTSNVQYASLNSEIPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQD
Ga0207691_1090866823300025940Miscanthus RhizosphereKSKRSKSESTRNNRIYAASQTSNVQYASLNSEIPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0207691_1090883413300025940Miscanthus RhizosphereKSKRSKSESTRNNRIYAASQTSNVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRRKVASLPVSSGDAFTSFIELLKTVQDK
Ga0207691_1171972723300025940Miscanthus RhizosphereSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0207641_1030835633300026088Switchgrass RhizosphereNVQYAALNSETPGGNSFGQSIDDLSLVTADQNYLTMINANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0209468_112958123300026306SoilLSRGVFIPETNSETISNSKRNKFEASRNNKIYAAAQTSNFQYASLNSETPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGEYWKETLNEWRKKVASLPTSSGDAFTSFIELLKTVQDK
Ga0207428_1055013913300027907Populus RhizosphereASQASNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0207428_1058632723300027907Populus RhizosphereNKGDDTLAGVENGTEKRSGTDTNSNNENKPDNIKQPDLSSSTSVAVANPESLIIKEKRNKTTGVRTYAAPQTTGVQYAVLNNETPGGNRFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFASLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK
Ga0247750_100996623300027992SoilNNRIYAASQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0247749_101956813300027993SoilNVQYTALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFASLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0247749_103657413300027993SoilPAIKDKRNKTVGIRTARNYGAAQTTGVQYAALNKERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK
Ga0268265_1189540523300028380Switchgrass RhizosphereQTANVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLVPHLQNKPVSEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310887_1042292223300031547SoilTDSNSSTEKKVENIQQPDLSPGTSIVTINPETTFKNKRNGSESTRNNRIYAASQTANVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310886_1058211623300031562SoilPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310886_1103331613300031562SoilAWIVFRNNKANDALAGVQNEIEKKTATDTNTHNEKKIDNIKQPDLSSTTSVAAINPESLFKSKRNKIAGIRNNRVYAAAQTSNVQYAALNNETPGGNSFGQSIDDLSLVTADQNYLTMINANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPV
Ga0310813_1167048223300031716SoilPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310907_1075119823300031847SoilGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310904_1125757623300031854SoilTARNYATPQTTGVQYAALNNERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPNQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK
Ga0310892_1131053113300031858SoilGDDALAGVQNGIEQKTETDTNSNIEKKIDNITEPDLSSTTPGGVVNPGSPVIKDKRNKTAGIRTARNYATPQTTGVQYAALNNERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPNQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPVSSGDA
Ga0310900_1053073823300031908SoilIQQRDLSPGASIAAIIPETISKSKRNKSGGYRNNRIYASPQTSNVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGTYWKETLNEWRKKVASLPTSSGDAFTSFIELLKTVQDK
Ga0310891_1036817513300031913SoilASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310885_1070796823300031943SoilYAAPQASNVQYAALNNETPGGNSFGQSIDDLSLVTADQNYLTMINANGRLVKIPTQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310885_1073090413300031943SoilQQPDLSPGTSIATINPETTFKNKRNGSESTRNNRIYAASQTANVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310884_1028982913300031944SoilETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310884_1063208723300031944SoilERPGGNSFGQPIDDLSLVTADQNYLTMVNANGRLVKIPNQFANLAPHLQNKPVSEDYYEVMFGEGTYWKETLNEWRKKVASVPISSGDAFTSFIELLKTVQDK
Ga0310884_1107609213300031944SoilIDSPIDLRETKSIASVSVKSPSSKNNKNSPYKKNRSNVIPQPATAQYAALSAPLSKTFHQPIDDLSSVTADQHYLTMVNSNGRLVKIPTELAHLAPHMQDKPISEDVYEVMFGEGTYWKETMSEWRKKIATLPVSSGDAFTSFIELLKTVQDK
Ga0310903_1032562213300032000SoilIYAPSQTANVQYAALNNETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310902_1110774823300032012SoilEPLGKNFNEPIDDLSVVTSDQNYLTMVSANGRLVKIPAQLASLAPHLQDKPVSEDYYEVMFGEGTYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0310895_1052433923300032122SoilPDISSTTSIAATNPELLTKSKRNKTAIRNNRIYAAPQTSNVQYAALNNEIPGGNSFGQSIDDLSLVTSDQNYLTMVNANGRLVKIPAQFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASVPVSSGDAFTSFIELLKTVQDK
Ga0310896_1012328833300032211SoilFKNKRNGSESTRNNRIYAASQTANVQYAALNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRMVKIPAEFANLAPHLQNKPVSEDYYEVMFGEGAYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK
Ga0315270_1097942713300032275SedimentAINPESLTIKSKRNNNNIGTRNTRTYAATQTTNVQYASLINETPGGNSFGQSIDDLSLVTSDQNYLTMINANGRLVKIPAQFANLAPHLQNKPISEDYYEVMFGEGEYWKETLNEWRKKIASSTVSSGDAFTSLVELLKTVQNK
Ga0310810_1139709923300033412SoilSQTANVQYASLNSETPGGNSFGQSIDDLSLVTSDQNYFTMVNANGRLVKIPAQFANLVPHLQNKPVSEDYYEVMFGEGEYWKETLNEWRKKVASLPVSSGDAFTSFIELLKTVQDK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.