| Basic Information | |
|---|---|
| Family ID | F049678 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MQTASVKWIGEQKFVATSPSGHAITFDSDRESNKAPGPM |
| Number of Associated Samples | 115 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.89 % |
| % of genes near scaffold ends (potentially truncated) | 98.63 % |
| % of genes from short scaffolds (< 2000 bps) | 90.41 % |
| Associated GOLD sequencing projects | 109 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.575 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.931 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.671 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.466 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 23.88% Coil/Unstructured: 76.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF01966 | HD | 8.22 |
| PF13487 | HD_5 | 6.16 |
| PF08281 | Sigma70_r4_2 | 3.42 |
| PF08534 | Redoxin | 2.74 |
| PF13492 | GAF_3 | 2.05 |
| PF12680 | SnoaL_2 | 1.37 |
| PF13185 | GAF_2 | 1.37 |
| PF03176 | MMPL | 0.68 |
| PF01844 | HNH | 0.68 |
| PF00005 | ABC_tran | 0.68 |
| PF11941 | DUF3459 | 0.68 |
| PF00144 | Beta-lactamase | 0.68 |
| PF13673 | Acetyltransf_10 | 0.68 |
| PF02517 | Rce1-like | 0.68 |
| PF00990 | GGDEF | 0.68 |
| PF13751 | DDE_Tnp_1_6 | 0.68 |
| PF05114 | DUF692 | 0.68 |
| PF13649 | Methyltransf_25 | 0.68 |
| PF08327 | AHSA1 | 0.68 |
| PF01029 | NusB | 0.68 |
| PF01494 | FAD_binding_3 | 0.68 |
| PF02566 | OsmC | 0.68 |
| PF03544 | TonB_C | 0.68 |
| PF08545 | ACP_syn_III | 0.68 |
| PF04542 | Sigma70_r2 | 0.68 |
| PF00578 | AhpC-TSA | 0.68 |
| PF13578 | Methyltransf_24 | 0.68 |
| PF00583 | Acetyltransf_1 | 0.68 |
| PF05016 | ParE_toxin | 0.68 |
| PF13432 | TPR_16 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.37 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.68 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.68 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.68 |
| COG3220 | Uncharacterized conserved protein, UPF0276 family | Function unknown [S] | 0.68 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.68 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.68 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 0.68 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 0.68 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.68 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.68 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.68 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.68 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.68 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.68 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.68 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.58 % |
| Unclassified | root | N/A | 3.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001089|JGI12683J13190_1002729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Alloacidobacterium → Alloacidobacterium dinghuense | 2348 | Open in IMG/M |
| 3300001154|JGI12636J13339_1036322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300001167|JGI12673J13574_1003424 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300002906|JGI25614J43888_10000157 | All Organisms → cellular organisms → Bacteria | 19008 | Open in IMG/M |
| 3300004082|Ga0062384_101146685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300004092|Ga0062389_101169172 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300004092|Ga0062389_103045574 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300004152|Ga0062386_100863099 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300005171|Ga0066677_10171777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1199 | Open in IMG/M |
| 3300005186|Ga0066676_10929731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 582 | Open in IMG/M |
| 3300005332|Ga0066388_100762495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1566 | Open in IMG/M |
| 3300005332|Ga0066388_105909727 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300005468|Ga0070707_100261651 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300005536|Ga0070697_100265899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1469 | Open in IMG/M |
| 3300005557|Ga0066704_10905018 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300005566|Ga0066693_10232947 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005569|Ga0066705_10283960 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300005569|Ga0066705_10866595 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300005576|Ga0066708_10569543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 728 | Open in IMG/M |
| 3300005921|Ga0070766_10661739 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 705 | Open in IMG/M |
| 3300006034|Ga0066656_10532874 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 764 | Open in IMG/M |
| 3300006041|Ga0075023_100378944 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300006354|Ga0075021_11117831 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006800|Ga0066660_11196680 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300006954|Ga0079219_11945468 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009038|Ga0099829_10250623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1444 | Open in IMG/M |
| 3300009088|Ga0099830_10135330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1880 | Open in IMG/M |
| 3300009088|Ga0099830_11536666 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300009089|Ga0099828_10161551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1985 | Open in IMG/M |
| 3300009089|Ga0099828_11742627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300009524|Ga0116225_1205791 | Not Available | 889 | Open in IMG/M |
| 3300010046|Ga0126384_11640509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300010047|Ga0126382_11288320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 660 | Open in IMG/M |
| 3300010304|Ga0134088_10209217 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300010329|Ga0134111_10205952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300010335|Ga0134063_10016788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2974 | Open in IMG/M |
| 3300010360|Ga0126372_10034845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3217 | Open in IMG/M |
| 3300010360|Ga0126372_12618255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300010366|Ga0126379_10455591 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300010401|Ga0134121_10081222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2696 | Open in IMG/M |
| 3300011270|Ga0137391_10307696 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1366 | Open in IMG/M |
| 3300011270|Ga0137391_10556429 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300011270|Ga0137391_10582554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300011270|Ga0137391_11416776 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300012096|Ga0137389_10119460 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2121 | Open in IMG/M |
| 3300012096|Ga0137389_11210165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Alteromonadaceae → Alishewanella → Alishewanella aestuarii | 647 | Open in IMG/M |
| 3300012189|Ga0137388_10199187 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300012199|Ga0137383_10587634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 815 | Open in IMG/M |
| 3300012202|Ga0137363_10708688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300012203|Ga0137399_11236507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 629 | Open in IMG/M |
| 3300012203|Ga0137399_11251373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300012205|Ga0137362_10655725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 903 | Open in IMG/M |
| 3300012205|Ga0137362_11765206 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300012207|Ga0137381_10034984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4076 | Open in IMG/M |
| 3300012207|Ga0137381_11693543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300012210|Ga0137378_11666377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300012285|Ga0137370_10698987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 630 | Open in IMG/M |
| 3300012363|Ga0137390_10766894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 924 | Open in IMG/M |
| 3300012363|Ga0137390_11772215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 550 | Open in IMG/M |
| 3300012363|Ga0137390_11882631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300012582|Ga0137358_10209069 | All Organisms → cellular organisms → Bacteria | 1331 | Open in IMG/M |
| 3300012582|Ga0137358_10903945 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300012683|Ga0137398_10233355 | All Organisms → cellular organisms → Bacteria | 1222 | Open in IMG/M |
| 3300012685|Ga0137397_10950060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 635 | Open in IMG/M |
| 3300012922|Ga0137394_10007310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8518 | Open in IMG/M |
| 3300012923|Ga0137359_10530053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1037 | Open in IMG/M |
| 3300012923|Ga0137359_11318383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 610 | Open in IMG/M |
| 3300012924|Ga0137413_10472644 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300012924|Ga0137413_10997277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 656 | Open in IMG/M |
| 3300012925|Ga0137419_10054247 | All Organisms → cellular organisms → Bacteria | 2599 | Open in IMG/M |
| 3300012925|Ga0137419_11196093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300012925|Ga0137419_11533422 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300012927|Ga0137416_10261477 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300012927|Ga0137416_10977973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300012927|Ga0137416_11486296 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300012930|Ga0137407_10058524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3160 | Open in IMG/M |
| 3300015054|Ga0137420_1150529 | All Organisms → cellular organisms → Bacteria | 3960 | Open in IMG/M |
| 3300015241|Ga0137418_10714933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 765 | Open in IMG/M |
| 3300016357|Ga0182032_11568806 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300017654|Ga0134069_1103883 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 928 | Open in IMG/M |
| 3300017822|Ga0187802_10288413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300017823|Ga0187818_10106205 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300017933|Ga0187801_10259105 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300017972|Ga0187781_10319212 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300017994|Ga0187822_10095631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 900 | Open in IMG/M |
| 3300017995|Ga0187816_10142031 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300020170|Ga0179594_10023064 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1912 | Open in IMG/M |
| 3300020579|Ga0210407_10992610 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300020579|Ga0210407_11432086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300020581|Ga0210399_10374875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1188 | Open in IMG/M |
| 3300021168|Ga0210406_10675601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300021170|Ga0210400_10876563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 733 | Open in IMG/M |
| 3300021403|Ga0210397_10874763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 695 | Open in IMG/M |
| 3300021405|Ga0210387_10448047 | Not Available | 1146 | Open in IMG/M |
| 3300021405|Ga0210387_11287849 | Not Available | 632 | Open in IMG/M |
| 3300021407|Ga0210383_10226574 | All Organisms → cellular organisms → Bacteria | 1602 | Open in IMG/M |
| 3300021407|Ga0210383_10926783 | Not Available | 741 | Open in IMG/M |
| 3300021475|Ga0210392_10150736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1588 | Open in IMG/M |
| 3300021476|Ga0187846_10471967 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300021477|Ga0210398_11205594 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300021478|Ga0210402_10557116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1064 | Open in IMG/M |
| 3300024347|Ga0179591_1065229 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2836 | Open in IMG/M |
| 3300025915|Ga0207693_10296706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1266 | Open in IMG/M |
| 3300025928|Ga0207700_10200203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1683 | Open in IMG/M |
| 3300026317|Ga0209154_1067203 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300026322|Ga0209687_1093438 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300026360|Ga0257173_1015341 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 918 | Open in IMG/M |
| 3300026469|Ga0257169_1014401 | All Organisms → cellular organisms → Bacteria | 1058 | Open in IMG/M |
| 3300026529|Ga0209806_1331384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300026551|Ga0209648_10311598 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300026557|Ga0179587_11169106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300027050|Ga0209325_1029569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300027297|Ga0208241_1010356 | All Organisms → cellular organisms → Bacteria | 1304 | Open in IMG/M |
| 3300027651|Ga0209217_1099839 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
| 3300027727|Ga0209328_10173190 | Not Available | 654 | Open in IMG/M |
| 3300027768|Ga0209772_10024125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1740 | Open in IMG/M |
| 3300027846|Ga0209180_10139131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1396 | Open in IMG/M |
| 3300027846|Ga0209180_10181617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1214 | Open in IMG/M |
| 3300027875|Ga0209283_10107306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1830 | Open in IMG/M |
| 3300027903|Ga0209488_10173124 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300027903|Ga0209488_10332454 | All Organisms → cellular organisms → Bacteria | 1131 | Open in IMG/M |
| 3300027915|Ga0209069_10621194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300031231|Ga0170824_124508763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300031564|Ga0318573_10461997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300031564|Ga0318573_10815816 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031718|Ga0307474_10448623 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300031723|Ga0318493_10580041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 624 | Open in IMG/M |
| 3300031747|Ga0318502_10734169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
| 3300031754|Ga0307475_11490306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300031820|Ga0307473_10573635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 774 | Open in IMG/M |
| 3300031823|Ga0307478_10616328 | All Organisms → cellular organisms → Bacteria | 908 | Open in IMG/M |
| 3300031962|Ga0307479_10067526 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3449 | Open in IMG/M |
| 3300032001|Ga0306922_10726091 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300032060|Ga0318505_10588564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300032063|Ga0318504_10282136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
| 3300032160|Ga0311301_11137042 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1010 | Open in IMG/M |
| 3300032174|Ga0307470_10124095 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1531 | Open in IMG/M |
| 3300032174|Ga0307470_11516687 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300032180|Ga0307471_102019275 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300032205|Ga0307472_101595848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300032261|Ga0306920_101177400 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300032261|Ga0306920_101894992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300032783|Ga0335079_10073555 | All Organisms → cellular organisms → Bacteria | 3890 | Open in IMG/M |
| 3300032783|Ga0335079_11419906 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300032805|Ga0335078_12200366 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300032955|Ga0335076_10320896 | All Organisms → cellular organisms → Bacteria | 1436 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.93% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.53% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.16% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.79% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.42% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.42% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.74% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.74% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.05% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.37% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.68% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.68% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027050 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12683J13190_10027296 | 3300001089 | Forest Soil | MQTGSVKWIGEQKFVATSPSGHTLTVDSDRASNKAPGPMELLLL |
| JGI12636J13339_10363222 | 3300001154 | Forest Soil | MQTGSVKWIGEQKFVATSPSGHATTVDSDRESNKA |
| JGI12673J13574_10034241 | 3300001167 | Forest Soil | MQTGSVKWIGEQKFVATSPSGHAMTVDSDRDSNKAPGPMEL |
| JGI25614J43888_1000015717 | 3300002906 | Grasslands Soil | MQTAAVKWIGEEKFVATSPSGHAMAMDSDRESNKAPGPME |
| Ga0062384_1011466851 | 3300004082 | Bog Forest Soil | MQTASVQWIGEQKFVATSPSGHAMAIDSDRQSNKAPGPMELLLMAL |
| Ga0062389_1011691722 | 3300004092 | Bog Forest Soil | MQTASIRWIGEEKFLATSPSGHAMAVDSDRTSNKAPGPMELLLMA |
| Ga0062389_1030455742 | 3300004092 | Bog Forest Soil | MQTARVEWIGEQKFVAISPSGHAITLDADGVSNKAPNPMEL |
| Ga0062386_1008630991 | 3300004152 | Bog Forest Soil | MQTATTQWIGEEKFVSTSPSGHAIVIDSDRTSNKAAGPMDLL |
| Ga0066677_101717773 | 3300005171 | Soil | MQTGSVKWIGGQQFVATSPSGHVITVDSDRSSNKAPGPMELVLL |
| Ga0066676_109297312 | 3300005186 | Soil | MQTASVKWIGEEKFVATSPSGHNITLDSDRESNKAPGPMEL |
| Ga0066388_1007624953 | 3300005332 | Tropical Forest Soil | MQTGSVKWIGKENFVGTSPSGHQVPFDSDRESNKAPGPMEM |
| Ga0066388_1059097271 | 3300005332 | Tropical Forest Soil | MQTCKVQWIGDQKFVAVSPSGHAITIDSDRAANAAPGPMELLLMA |
| Ga0070707_1002616511 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTAKVQWMGEQKFTAISPSGHAVAMDSDRSSNTGPGPMELLLMALGA |
| Ga0070697_1002658993 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | VQKASIKWIGEEKFAATSPSGHAITIDSDRTSNKAPGPMELV |
| Ga0066704_109050182 | 3300005557 | Soil | MQTGSVKWIGDEKFVATSPSGHAMTIDSDRASNKAP |
| Ga0066693_102329471 | 3300005566 | Soil | MQTGSVKWIGDEKFVATSPSGHAMTIDSDRASNKAPG |
| Ga0066705_102839601 | 3300005569 | Soil | MQSGIIKWVGEQKFVATSPSGHAITVDSDRSSNKAPGPMELLLLAL |
| Ga0066705_108665951 | 3300005569 | Soil | MQTGFVKWIGEQKFVATSPSGHAITVDSDRASNKAPGPMELVLLALG |
| Ga0066708_105695431 | 3300005576 | Soil | MQSGIIKWVGEQKFVATSPSGHAITVDSDRSSNKAPGPMEL |
| Ga0070766_106617391 | 3300005921 | Soil | MQTANVKWIGDERFVATGPSGHAVTIDSDRKSNTAMGPME |
| Ga0066656_105328741 | 3300006034 | Soil | MQTASVKWIGEEKFVATSPSGHNMTLDSDRESNRAPGPMELVLMA |
| Ga0075023_1003789441 | 3300006041 | Watersheds | MQTGTVKWIGEQKFAATSPSGHSIIVDSDRESNKSLGPMELVLLALG |
| Ga0075021_111178311 | 3300006354 | Watersheds | MQTGTVKWIGEQKFAATSPSGHSIIVDSDRESNKSLGPMELVLLALGT |
| Ga0066660_111966802 | 3300006800 | Soil | MQTGSVKWIGDEKFVATSPSGHAMTIDSDRASNKAPGPME |
| Ga0079219_119454681 | 3300006954 | Agricultural Soil | MQTGTVKWVGEQKFLATGPSGHAIPVDSDRDSNKAPGPMELVLLALGA |
| Ga0099829_102506231 | 3300009038 | Vadose Zone Soil | MQTATVKWIGEEKFLALGPSGHALAIDSDRQSNTAPGPMEL |
| Ga0099830_101353303 | 3300009088 | Vadose Zone Soil | MQTGIVKWIGEQKFVATSPSGHAMTVDSDRASNKAPGPMELVLLALGA |
| Ga0099830_115366662 | 3300009088 | Vadose Zone Soil | MQTASVKWIGEQKFVATGPSGHALTIDSDRDSNKAPGPMELLL |
| Ga0099828_101615511 | 3300009089 | Vadose Zone Soil | MQTAKVQWIDEQKFVAISPSGHALAMDSDRSSNTGPGPMELLLM |
| Ga0099828_117426271 | 3300009089 | Vadose Zone Soil | MQTASVEWIDEQKFVATSPSGHAVTIDSDRESNKAP |
| Ga0116225_12057911 | 3300009524 | Peatlands Soil | MHTATVQWIGEQRFLATSPSGHGVLVDSDRESNKAP |
| Ga0126384_116405091 | 3300010046 | Tropical Forest Soil | MQTATIQWIGQQKFVAFGPSGHAVPMDADRTANTAPGPMEL |
| Ga0126382_112883201 | 3300010047 | Tropical Forest Soil | MQIASVRWIGEQKFVAIGPSGHAVTLDSDRESNKAPGPMEFVLLA |
| Ga0134088_102092171 | 3300010304 | Grasslands Soil | MQTATVKWIGEQKFVGASPSGHAVALDSDRESNKAPGP |
| Ga0134111_102059522 | 3300010329 | Grasslands Soil | MQTASVKWIDEQKFVATSPSGHAVTIDSDRESNQA |
| Ga0134063_100167884 | 3300010335 | Grasslands Soil | MQTASVKWIGAQQFVATGPSGHAITMDSDRESNKA |
| Ga0126372_100348452 | 3300010360 | Tropical Forest Soil | MQTASVKWVGEQRFSATSPSGHTIKMDSDRQSNTGPGP |
| Ga0126372_126182552 | 3300010360 | Tropical Forest Soil | VQTAKVQWIGDQKFVAVGPSGHALAFDSDRSSNTGPGPMELLLMA |
| Ga0126379_104555911 | 3300010366 | Tropical Forest Soil | MQTASVKWIGEQKFVAIGPSGHAIAFDSDRESNKAPGPMEFL |
| Ga0134121_100812221 | 3300010401 | Terrestrial Soil | MQTAAIKWIGEEKFVATSPSGHAITIDSDRASNKAPGPMELVLMA |
| Ga0137391_103076961 | 3300011270 | Vadose Zone Soil | MQTASVKWVGEQKFIATSPSGHAIAIDADRQSNKAVGPTE |
| Ga0137391_105564292 | 3300011270 | Vadose Zone Soil | MQTAAVKWIGEQEFVATSPSGHAMAIDSDRESNKAP |
| Ga0137391_105825542 | 3300011270 | Vadose Zone Soil | MQTGIVRWIGEEKFVATSPSGHAITIDSDRASNKAPGPMEL |
| Ga0137391_114167762 | 3300011270 | Vadose Zone Soil | MQTAAVKWIGEQKFVATSPSGHAMAMDSDRESNKAPGPMELV |
| Ga0137389_101194601 | 3300012096 | Vadose Zone Soil | MQTASVKWIGEQKFVATSPSGHALTIDSDRASNKAPGPMELLL |
| Ga0137389_112101651 | 3300012096 | Vadose Zone Soil | MQTATVKWIGEEKFLALGPSGHALAIDSDRQSNTAPGPMELL |
| Ga0137388_101991871 | 3300012189 | Vadose Zone Soil | MQTASIQWIGEQKFLAISPSGHAVPFDSDRESNKA |
| Ga0137383_105876341 | 3300012199 | Vadose Zone Soil | MQTGSVKWIDKQRFVATSPSGHAMAIDSDRASNQAPG |
| Ga0137363_107086882 | 3300012202 | Vadose Zone Soil | MQTASVKWIDEQKFVATSPSGHALTIDSDRESNKAP |
| Ga0137399_112365071 | 3300012203 | Vadose Zone Soil | MQTGSVKWIGEQKFVATSPSGHALTIDSDRASNKAPGPMELLL |
| Ga0137399_112513732 | 3300012203 | Vadose Zone Soil | MQSGSVKWIGEQKFVATSPSGHALTIDSDRASNKAPGPMELLL |
| Ga0137362_106557251 | 3300012205 | Vadose Zone Soil | MQTSKVQWIGEQKFVAISPSGHALAMDSDRSSNTGPGP |
| Ga0137362_117652061 | 3300012205 | Vadose Zone Soil | MQTGSVKWIGEQKFVATSPSGHAMTVDSDRESNKAPGPMEL |
| Ga0137381_100349841 | 3300012207 | Vadose Zone Soil | MQTGIVKWIVEQEFVATSPSGHAMTIDSDRASNKAPGPM |
| Ga0137381_116935432 | 3300012207 | Vadose Zone Soil | MQTASVKWIDEQKFVATSPSGHAVTIDSDRESNKAPGPMELLLM |
| Ga0137378_116663771 | 3300012210 | Vadose Zone Soil | MQTASVKWIDEQKFVATSPSGHAVTIDSDRESNKAP |
| Ga0137370_106989871 | 3300012285 | Vadose Zone Soil | MQTARVKWIGKQKFVATSPSGHAMTIDSDRASNQAPGPMELLLL |
| Ga0137390_107668941 | 3300012363 | Vadose Zone Soil | MQTASVKWIGEQKFVATGPSGHAMTIDSDRESNKAPGPMELVLL |
| Ga0137390_117722151 | 3300012363 | Vadose Zone Soil | MQTASVKWIDEQKFVATSPSGHAVTIDSDRESNKAPG |
| Ga0137390_118826312 | 3300012363 | Vadose Zone Soil | MQTGSVKWIGEQKFVATSPSGNAITVDSDRGSNKAPGP |
| Ga0137358_102090693 | 3300012582 | Vadose Zone Soil | MQTGSVKWIGGQRFVATSPSGHPLTIDSDRALNKA |
| Ga0137358_109039452 | 3300012582 | Vadose Zone Soil | MQTASVKWIGDEKFAATSPSGHRIVVDSDRQTNSAPGP |
| Ga0137398_102333551 | 3300012683 | Vadose Zone Soil | MQTASVKWIDGQRFVATGPAGHAIVTDSDRETNSAPGPM |
| Ga0137397_109500602 | 3300012685 | Vadose Zone Soil | MQTGSVKWIGEQKFVAPSPSGHAMTVDSDRASNKAPGPMELLLLALG |
| Ga0137394_100073109 | 3300012922 | Vadose Zone Soil | MQTGSVKWVGEQKFVATSPSGHAMTVDSDRESNKAPGPMELVL |
| Ga0137359_105300533 | 3300012923 | Vadose Zone Soil | MQTASVKWIGEEKFVATSPSGHAINVDSDRHSNTAP |
| Ga0137359_113183831 | 3300012923 | Vadose Zone Soil | MQTGTVKWVGEQKFVATSPSGHAITVDSDRASNKAPGP |
| Ga0137413_104726442 | 3300012924 | Vadose Zone Soil | MQTASVKWIGDEKFAATSPSGHRIVVDSDRQTNSAPGPMEFVLMAL |
| Ga0137413_109972772 | 3300012924 | Vadose Zone Soil | MQTGTVKWVGEQKFVATSPSGHAITVDSDRASNHAPGPMELVL |
| Ga0137419_100542471 | 3300012925 | Vadose Zone Soil | MQTGSVKWIGEQKFVAIGPSGHAITIDSDRTSNNAPGP |
| Ga0137419_111960932 | 3300012925 | Vadose Zone Soil | MQTGSVKWIGGQQFVATSPSGHAMTIDSDRASNKAPG |
| Ga0137419_115334222 | 3300012925 | Vadose Zone Soil | MQTANVKWIGGQQFVAVSPSGHALAMDSDRQSNTGPG |
| Ga0137416_102614773 | 3300012927 | Vadose Zone Soil | MQTASVKWVDGQRFLATGPAGHAIVTDSDRETNTAPGP |
| Ga0137416_109779732 | 3300012927 | Vadose Zone Soil | MQTASVKWIGEQKFVATSPSGHAMTIDSDRASNQAPGPMELLLLALG |
| Ga0137416_114862961 | 3300012927 | Vadose Zone Soil | MQTGSVKWIGEQKFVATSPSGHALTIDSDRASNKAPGPME |
| Ga0137407_100585244 | 3300012930 | Vadose Zone Soil | MQTASVQWIGEEKFVAIGPSGHAITIDSDRSSNKA |
| Ga0137420_11505291 | 3300015054 | Vadose Zone Soil | MQSGSVKWIGEQKFVATSPSGHALTIDSDRASNKAPGPIDGAF |
| Ga0137418_107149331 | 3300015241 | Vadose Zone Soil | MQTGSVKWIGGQQFVATSPSGHAMTIDSDRASNKAPGPMELV |
| Ga0182032_115688062 | 3300016357 | Soil | MQTASVKWIGEQKFVATSPSGHAITLDSDRESNKAAG |
| Ga0134069_11038831 | 3300017654 | Grasslands Soil | MQTGSVKWIGDQKFVATSPSGHALTVDSDRASNKAPGPMELV |
| Ga0187802_102884131 | 3300017822 | Freshwater Sediment | MQTATVKWIGEQKFVATSPSGHAITIDSDRASNKAPGPMELVLM |
| Ga0187818_101062053 | 3300017823 | Freshwater Sediment | MDTSSVKWIGEQKFVATSPSGHAMIMDSDRATNVAP |
| Ga0187801_102591051 | 3300017933 | Freshwater Sediment | MDTSSVKWIGEQKFVATSPSGHAVPMDSDRATNVAPSPM |
| Ga0187781_103192123 | 3300017972 | Tropical Peatland | MQTGSVKWIGEQKFVATSPSGHMIPLDCDGQSNKGATPMELL |
| Ga0187822_100956311 | 3300017994 | Freshwater Sediment | MQTASVKWVDEERFVATSPTGHAIVLDSAGESKTAPGPM |
| Ga0187816_101420311 | 3300017995 | Freshwater Sediment | ILFSGGRMDISSVKWIGEQKFVATSPSGHAMIMDSDRATNVAPSPM |
| Ga0179594_100230644 | 3300020170 | Vadose Zone Soil | MQTGMVRWVEDQKFVATSPSGHTINIDSDRHSNTAP |
| Ga0210407_109926101 | 3300020579 | Soil | MQTASIQWIGEQKFLAVSPSGHAVPFDSDRESNKAPGAMEMVL |
| Ga0210407_114320862 | 3300020579 | Soil | MQTASVQWIGEQKFVAIGPSGHAITIDSDRASNKSPG |
| Ga0210399_103748753 | 3300020581 | Soil | MQTASVQWIGEQKFVAIGPSGHAITIDSDRASNKAPGPMELV |
| Ga0210406_106756012 | 3300021168 | Soil | MQTASIQWIGEQKFLATSPSGHAVPFDSDRDSNKAP |
| Ga0210400_108765631 | 3300021170 | Soil | MQTGSVKWIGEQKFVATSPSGHAMTIDSDRASNKAPGPMEL |
| Ga0210397_108747632 | 3300021403 | Soil | MQTASIKWIGEEKFMATSPSGHAIAIDSDRASNKAA |
| Ga0210387_104480471 | 3300021405 | Soil | MQTASIQWTGGQKFLAVSPSGHSVPFDSDRESNKAPGAMEMV |
| Ga0210387_112878491 | 3300021405 | Soil | MQTASIQWTGEQKFLAASPSGHSVPFDSDRESNKAPGAMEMV |
| Ga0210383_102265741 | 3300021407 | Soil | MQTATIQWTGEQKFLAISPSGHAVPFDSDRESNKAP |
| Ga0210383_109267831 | 3300021407 | Soil | MQTASIQWTGGQKFLSVSPSGHSVPFDSDRESNKAP |
| Ga0210392_101507364 | 3300021475 | Soil | MQKASVEWIGEEKFVATSPSGHAITVDSDRASNKAPGP |
| Ga0187846_104719672 | 3300021476 | Biofilm | MQTGSVKWIGGQKFVATSPSGHIVAVDSDRESNKAPGPME |
| Ga0210398_112055942 | 3300021477 | Soil | MQTGNVKWIGDERFVATGPSGHAVTIDSDRKSNTAMGPM |
| Ga0210402_105571161 | 3300021478 | Soil | MQTASVKWIGEEKFVATSPSGHAIAIDSDRASNKAPGP |
| Ga0179591_10652291 | 3300024347 | Vadose Zone Soil | MQTAKVQWIGEQKFVAIGPSGHALAMDSDRSSIPALAR |
| Ga0207693_102967061 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTAKIKWIGEQKFTAVSPSGHTLRMDSDRTSNTGPGAMELPLMALGACT |
| Ga0207700_102002032 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MQTAKIKWIGEQKFTAVSPSGHTLRMDSDRTSNTGPGAMEL |
| Ga0209154_10672033 | 3300026317 | Soil | MQTGSVKWIGDEKFVATSPSGHAMTIDSDRASNKAPGPM |
| Ga0209687_10934383 | 3300026322 | Soil | MQTASVKWIGEQKFVATSPSGHAITFDSDRESNKAPGPM |
| Ga0257173_10153411 | 3300026360 | Soil | MQTASVKWIGEEKFVATSPSGHAINIDSDRHSNIAPGPM |
| Ga0257169_10144013 | 3300026469 | Soil | MQTASVKWIGEEKFVATSPSGHAINIDSDRHSNTAPGPMELL |
| Ga0209806_13313842 | 3300026529 | Soil | MQSASVTWIGEQKFVATSPSGHAITLDSDRESNQAPGPME |
| Ga0209648_103115983 | 3300026551 | Grasslands Soil | MQTASVKWIGEEKFVATSPSGHAITIDSDRASNKAPGP |
| Ga0179587_111691061 | 3300026557 | Vadose Zone Soil | MQTASIQWIGEQKFLAVSPSGHAVPFDSDRESNKAPGAMEMT |
| Ga0209325_10295692 | 3300027050 | Forest Soil | MQTSKVQWIGEQKFVAISPSGHALALDSDRSSNTGPGAMELL |
| Ga0208241_10103563 | 3300027297 | Forest Soil | MQTASVKWIGEQKFVAISPSGHALTFDSDRESNKAP |
| Ga0209217_10998392 | 3300027651 | Forest Soil | MQTASVKWVGKQAFVATSPSGHAITVDSDRETNSAPGPME |
| Ga0209328_101731902 | 3300027727 | Forest Soil | MQTTSIKWIGEQKFAATSASNHAMVIDSDRHSNAAPGPMEMVLIALA |
| Ga0209772_100241251 | 3300027768 | Bog Forest Soil | MQTASVKWIGGQKFVAIGPSGHAITIDSDRATNHAPG |
| Ga0209180_101391311 | 3300027846 | Vadose Zone Soil | MQIGSVKWIGEQKFLATSPSGHAMTVDSDRASNKA |
| Ga0209180_101816171 | 3300027846 | Vadose Zone Soil | MQTGSVKWIGEQKFVATSPSGHAMTIDSDRASNKAPGPM |
| Ga0209283_101073062 | 3300027875 | Vadose Zone Soil | MQTAKVQWIDEQKFVAISPSGHALAMDSDRSSNTGPGPME |
| Ga0209488_101731243 | 3300027903 | Vadose Zone Soil | MQTASVKWTGGQQFVATSPSGHAMTIDSDRASNKAPGPMEL |
| Ga0209488_103324542 | 3300027903 | Vadose Zone Soil | MQTASVKWIGDQKFAATSPSGNVIVVDSDRQTNSAPGPMDLVL |
| Ga0209069_106211942 | 3300027915 | Watersheds | MQTALVRWAGEQKFLAVSPSGHAIAMDSDRESNKAPGPME |
| Ga0170824_1245087631 | 3300031231 | Forest Soil | MQTAKVQWIGEQKFVAVSPSGHALAMDSDRETNTAPSPMEL |
| Ga0318573_104619971 | 3300031564 | Soil | MQTASVKWIGEQKFVAIGPSGHALAVDSDRASNNAPG |
| Ga0318573_108158162 | 3300031564 | Soil | MQTASTRWVGEQQFLGSSPSGHAMAMDADSQSNKAPNPMEML |
| Ga0307474_104486231 | 3300031718 | Hardwood Forest Soil | MQTASVKWIGEEKFVTTSPSGHAIVVDSDRQTNSA |
| Ga0318493_105800412 | 3300031723 | Soil | MQTASTRWVGEQQFLGSSPSGHAMAMDADSQSNKAPNPM |
| Ga0318502_107341691 | 3300031747 | Soil | MQTASTRWVGEQQFLGSSPSGHAMAMDADSQSNKAPNPMEM |
| Ga0307475_114903062 | 3300031754 | Hardwood Forest Soil | MQTGSVKWTGGQQFVATSPSGHAITIDSDRALNRAP |
| Ga0307473_105736351 | 3300031820 | Hardwood Forest Soil | MQTATVRWTGEQKFIAVSPSGHALAMDSDRNSNTGPGAMELLLMAL |
| Ga0307478_106163282 | 3300031823 | Hardwood Forest Soil | MQTATVKWVGEEKFLALGPSGHALAIDSDRQSNTAPGPMELL |
| Ga0307479_100675262 | 3300031962 | Hardwood Forest Soil | MQTSKVQWIGEQKFVAISPSGHALALDSDRSSNTGP |
| Ga0306922_107260911 | 3300032001 | Soil | MQTASVKWLGEEKFLAIGPSGHAVALDSDRESNKAPGPMEVVL |
| Ga0318505_105885641 | 3300032060 | Soil | MQTASVKWIGEQKFVATGPSGHAVTLDSDRESNQAPGPM |
| Ga0318504_102821361 | 3300032063 | Soil | MQTASVKWIGEQKFVATGPSGHAVTLDSDRESNQAPGPMEL |
| Ga0311301_111370422 | 3300032160 | Peatlands Soil | MQTATVQWIGEQRFLATSPSRHGVLIDSDRESNKAPGPMELVLMAL |
| Ga0307470_101240951 | 3300032174 | Hardwood Forest Soil | MQTAKVQWIGEQKFSAVSPSGHTLRMDSDRTSNTGPGAMELLLMALGAC |
| Ga0307470_115166872 | 3300032174 | Hardwood Forest Soil | MQTASIQWIGEQKFLATSPSGHAVPFDSDRESNKAPG |
| Ga0307471_1020192751 | 3300032180 | Hardwood Forest Soil | MVTAQVQWIGEQKFVATGPSGHAITIDADGKSNKAPGPMELLLLA |
| Ga0307472_1015958482 | 3300032205 | Hardwood Forest Soil | MVTAQVQWIGEQKFVATGPSGHAITIDADGKSNNAPGPM |
| Ga0306920_1011774001 | 3300032261 | Soil | MQTASVKWIGEQKFFGTSPSGHVVPFDSDRESNKAPGPM |
| Ga0306920_1018949922 | 3300032261 | Soil | MPTATVQWIGEQKFAAVSPSGHALVLDSDSKNAPTPMELLLVALG |
| Ga0335079_100735551 | 3300032783 | Soil | MQTGCVKWIGEQKFVSTSPSGHMIPLDCDSGSNKGATPMELLLLA |
| Ga0335079_114199062 | 3300032783 | Soil | MQTASVKWIGEQKFVSIAPSGHAVAFDSDRESNKAPGPME |
| Ga0335078_122003662 | 3300032805 | Soil | MQTASVKWIGEQKFVSIAPSGHAVAFDSDRESNKAPGP |
| Ga0335076_103208961 | 3300032955 | Soil | MQTASVKWIGEQKFVSIAPSGHAVAFDSDRESNKA |
| ⦗Top⦘ |