NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049674

Metagenome / Metatranscriptome Family F049674

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049674
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 110 residues
Representative Sequence MLEGRYFRRVQXGYHPIFQNIDAVTNXGXNLVSLSGVIFSYLNFFVNRLLIPFSSVTSIIGFMLLLTISMQLLSGFFLGXYYIPEPGLVVELREEMFNDTRFGAEVF
Number of Associated Samples 136
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 16.55 %
% of genes near scaffold ends (potentially truncated) 93.84 %
% of genes from short scaffolds (< 2000 bps) 89.73 %
Associated GOLD sequencing projects 134
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (66.438 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(15.069 % of family members)
Environment Ontology (ENVO) Unclassified
(36.986 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(50.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 46.67%    β-sheet: 0.00%    Coil/Unstructured: 53.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF00507Oxidored_q4 28.77
PF13631Cytochrom_B_N_2 4.79
PF00033Cytochrome_B 3.42
PF00137ATP-synt_C 2.05
PF00032Cytochrom_B_C 0.68
PF00238Ribosomal_L14 0.68
PF00410Ribosomal_S8 0.68
PF00252Ribosomal_L16 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG0838NADH:ubiquinone oxidoreductase subunit 3 (chain A)Energy production and conversion [C] 28.77
COG1290Cytochrome b subunit of the bc complexEnergy production and conversion [C] 4.11
COG0636FoF1-type ATP synthase, membrane subunit c/Archaeal/vacuolar-type H+-ATPase, subunit KEnergy production and conversion [C] 2.05
COG0093Ribosomal protein L14Translation, ribosomal structure and biogenesis [J] 0.68
COG0096Ribosomal protein S8Translation, ribosomal structure and biogenesis [J] 0.68
COG0197Ribosomal protein L16/L10AETranslation, ribosomal structure and biogenesis [J] 0.68

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms76.03 %
UnclassifiedrootN/A23.97 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000736|JGI12547J11936_1085666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata581Open in IMG/M
3300001355|JGI20158J14315_10174437All Organisms → cellular organisms → Bacteria634Open in IMG/M
3300001846|ACM22_1087585All Organisms → cellular organisms → Bacteria → Proteobacteria673Open in IMG/M
3300002154|JGI24538J26636_10023549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia1515Open in IMG/M
3300003429|JGI25914J50564_10178692Not Available504Open in IMG/M
3300003499|JGI25930J51415_1022243All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1185Open in IMG/M
3300003684|Ga0005851_1031910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea582Open in IMG/M
3300004124|Ga0066178_10100569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis787Open in IMG/M
3300004128|Ga0066180_10215461All Organisms → cellular organisms → Bacteria → Proteobacteria744Open in IMG/M
3300004463|Ga0063356_101328250All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis1053Open in IMG/M
3300004507|Ga0008280_1033295All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia5904Open in IMG/M
3300004765|Ga0007745_1007708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga lotononidis529Open in IMG/M
3300004769|Ga0007748_10195960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1070Open in IMG/M
3300004769|Ga0007748_10225437All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea661Open in IMG/M
3300004787|Ga0007755_1049557Not Available666Open in IMG/M
3300004789|Ga0007752_10115745All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300004792|Ga0007761_10167263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea570Open in IMG/M
3300004792|Ga0007761_10209936All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300004793|Ga0007760_10236926Not Available525Open in IMG/M
3300004795|Ga0007756_10144125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea687Open in IMG/M
3300004836|Ga0007759_10125939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1839Open in IMG/M
3300005583|Ga0049085_10298906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata523Open in IMG/M
3300005662|Ga0078894_10001468All Organisms → cellular organisms → Bacteria17508Open in IMG/M
3300005662|Ga0078894_10034163All Organisms → cellular organisms → Bacteria4214Open in IMG/M
3300005662|Ga0078894_10929093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata753Open in IMG/M
3300006357|Ga0075502_1176020All Organisms → cellular organisms → Bacteria1198Open in IMG/M
3300006396|Ga0075493_1070189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata531Open in IMG/M
3300006405|Ga0075510_10911499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1362Open in IMG/M
3300007169|Ga0102976_1116901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia1958Open in IMG/M
3300007171|Ga0102977_1161980All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1251Open in IMG/M
3300007552|Ga0102818_1099540Not Available577Open in IMG/M
3300007861|Ga0105736_1009250All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1628Open in IMG/M
3300008258|Ga0114840_1052904Not Available638Open in IMG/M
3300009068|Ga0114973_10461679Not Available660Open in IMG/M
3300009155|Ga0114968_10649933Not Available555Open in IMG/M
3300009161|Ga0114966_10060006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2665Open in IMG/M
3300009185|Ga0114971_10500509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata680Open in IMG/M
3300009247|Ga0103861_10005322All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1491Open in IMG/M
3300009247|Ga0103861_10040879All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Noviherbaspirillum → Noviherbaspirillum autotrophicum695Open in IMG/M
3300009404|Ga0103853_1018545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata692Open in IMG/M
3300009432|Ga0115005_10686969All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata822Open in IMG/M
3300009436|Ga0115008_11250788Not Available565Open in IMG/M
3300009441|Ga0115007_10210937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1253Open in IMG/M
3300009442|Ga0115563_1344251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea537Open in IMG/M
3300009543|Ga0115099_10528230All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1765Open in IMG/M
3300009608|Ga0115100_11034275Not Available977Open in IMG/M
3300009677|Ga0115104_10610968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia4235Open in IMG/M
3300009677|Ga0115104_11317212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1418Open in IMG/M
3300009679|Ga0115105_10247933All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1262Open in IMG/M
3300009679|Ga0115105_10548370All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata581Open in IMG/M
3300010883|Ga0133547_11125291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia1507Open in IMG/M
3300010885|Ga0133913_10072787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea9220Open in IMG/M
3300011268|Ga0151620_1104114All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata893Open in IMG/M
3300012212|Ga0150985_101275083Not Available696Open in IMG/M
3300012469|Ga0150984_105954407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata557Open in IMG/M
3300012702|Ga0157596_1013964Not Available799Open in IMG/M
3300012716|Ga0157605_1061756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Loktanella → Loktanella fryxellensis627Open in IMG/M
3300012720|Ga0157613_1048754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea781Open in IMG/M
3300012729|Ga0157625_1165360All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea646Open in IMG/M
3300012730|Ga0157602_1011574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea640Open in IMG/M
3300012731|Ga0157616_1320742All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea665Open in IMG/M
3300012748|Ga0157553_1104784Not Available559Open in IMG/M
3300012758|Ga0138285_1004270All Organisms → Viruses → Predicted Viral1771Open in IMG/M
3300012762|Ga0157554_1108865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea709Open in IMG/M
3300012763|Ga0138289_1114329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1653Open in IMG/M
3300012781|Ga0138286_1060582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1169Open in IMG/M
3300013006|Ga0164294_10622077Not Available731Open in IMG/M
3300013295|Ga0170791_10959641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia3275Open in IMG/M
3300013295|Ga0170791_14070538Not Available2238Open in IMG/M
3300016683|Ga0180042_110160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata705Open in IMG/M
3300016740|Ga0182096_1039489All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1428Open in IMG/M
3300019025|Ga0193545_10132702All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata530Open in IMG/M
3300019244|Ga0180111_1332757All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata548Open in IMG/M
3300020013|Ga0182086_1140853Not Available708Open in IMG/M
3300020083|Ga0194111_10442965Not Available849Open in IMG/M
3300020169|Ga0206127_1273883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata573Open in IMG/M
3300020221|Ga0194127_10093267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia2253Open in IMG/M
3300020253|Ga0211685_1035397Not Available720Open in IMG/M
3300020441|Ga0211695_10190707Not Available721Open in IMG/M
3300020521|Ga0208482_1028067Not Available745Open in IMG/M
3300020529|Ga0208233_1023999Not Available780Open in IMG/M
3300020566|Ga0208222_1086201Not Available520Open in IMG/M
3300020595|Ga0206126_10100082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1436Open in IMG/M
3300020715|Ga0214254_1039422Not Available587Open in IMG/M
3300021131|Ga0214206_1040824Not Available512Open in IMG/M
3300021345|Ga0206688_10202576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea768Open in IMG/M
3300021348|Ga0206695_1088564Not Available733Open in IMG/M
3300021849|Ga0210304_1103117Not Available636Open in IMG/M
3300021957|Ga0222717_10188273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia1232Open in IMG/M
3300021962|Ga0222713_10391038Not Available858Open in IMG/M
3300021964|Ga0222719_10328591Not Available979Open in IMG/M
3300022714|Ga0242671_1075628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata603Open in IMG/M
3300024343|Ga0244777_10022374All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia3998Open in IMG/M
3300024343|Ga0244777_10926697All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata507Open in IMG/M
3300024346|Ga0244775_10765998All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata774Open in IMG/M
3300024561|Ga0255288_1063961All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata827Open in IMG/M
3300024572|Ga0255268_1133490All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata617Open in IMG/M
3300024574|Ga0255275_1213922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata510Open in IMG/M
3300025138|Ga0209634_1228270Not Available689Open in IMG/M
3300025375|Ga0208259_1032814All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea739Open in IMG/M
3300025621|Ga0209504_1115682Not Available680Open in IMG/M
3300025747|Ga0255247_1035656Not Available612Open in IMG/M
3300025894|Ga0209335_10418779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia534Open in IMG/M
3300026183|Ga0209932_1122706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea557Open in IMG/M
3300026418|Ga0247564_1055669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea685Open in IMG/M
3300026470|Ga0247599_1110251All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata574Open in IMG/M
3300026572|Ga0255270_1021629All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1607Open in IMG/M
3300026573|Ga0255269_1152030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea621Open in IMG/M
3300027127|Ga0255071_1043672All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata655Open in IMG/M
3300027139|Ga0255082_1012664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1452Open in IMG/M
3300027143|Ga0255105_1068463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata583Open in IMG/M
3300027148|Ga0255115_1096926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata500Open in IMG/M
3300027151|Ga0255063_1088109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata563Open in IMG/M
3300027154|Ga0255111_1055942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea767Open in IMG/M
3300027255|Ga0208681_1015418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia1506Open in IMG/M
3300027594|Ga0255120_1033362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1001Open in IMG/M
3300027644|Ga0209356_1034334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1646Open in IMG/M
3300027708|Ga0209188_1079486All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1365Open in IMG/M
3300027744|Ga0209355_1334367Not Available562Open in IMG/M
3300027752|Ga0209192_10317267All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata556Open in IMG/M
3300027754|Ga0209596_1407790All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata508Open in IMG/M
3300027769|Ga0209770_10168770All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea876Open in IMG/M
3300027772|Ga0209768_10082564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1615Open in IMG/M
3300027798|Ga0209353_10466079Not Available508Open in IMG/M
3300027810|Ga0209302_10044909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia2382Open in IMG/M
3300027849|Ga0209712_10639955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium589Open in IMG/M
3300027885|Ga0209450_10338955Not Available1091Open in IMG/M
3300027976|Ga0209702_10138390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1089Open in IMG/M
3300028113|Ga0255234_1019707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1695Open in IMG/M
3300028113|Ga0255234_1026683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1480Open in IMG/M
3300028137|Ga0256412_1055491All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1386Open in IMG/M
3300028282|Ga0256413_1227385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea666Open in IMG/M
3300028290|Ga0247572_1006074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea2308Open in IMG/M
3300031261|Ga0302140_11132417All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea528Open in IMG/M
3300031446|Ga0170820_16093696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata1415Open in IMG/M
3300031542|Ga0308149_1006692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1397Open in IMG/M
3300031784|Ga0315899_10729968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea916Open in IMG/M
3300031857|Ga0315909_10263427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1314Open in IMG/M
3300032050|Ga0315906_10179111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium2018Open in IMG/M
3300032275|Ga0315270_10118512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea1566Open in IMG/M
3300032515|Ga0348332_12151912All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata523Open in IMG/M
3300033981|Ga0334982_0313983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata734Open in IMG/M
3300034019|Ga0334998_0307376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata939Open in IMG/M
3300034167|Ga0335017_0044093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia2630Open in IMG/M
3300034355|Ga0335039_0491005Not Available616Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake15.07%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater10.27%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater9.59%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine7.53%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.85%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine6.16%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.42%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine3.42%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater2.05%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake2.05%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater2.05%
River WaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water2.05%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.05%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.05%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment1.37%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.37%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater1.37%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.37%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.37%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.37%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.37%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.37%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.68%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.68%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.68%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.68%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.68%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.68%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.68%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.68%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.68%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine0.68%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.68%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.68%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.68%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.68%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.68%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.68%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.68%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000736Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001846Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM22, ROCA_DNA119_0.2um_25bEnvironmentalOpen in IMG/M
3300002154Marine eukaryotic phytoplankton communities from the South Atlantic Ocean - 30m ANT-15 MetagenomeEnvironmentalOpen in IMG/M
3300003429Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SNEnvironmentalOpen in IMG/M
3300003499Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DNEnvironmentalOpen in IMG/M
3300003684Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA - 2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004124Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2)EnvironmentalOpen in IMG/M
3300004128Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (version 2)EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004507Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004765Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004769Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004787Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004789Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004792Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004793Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004795Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004836Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006396Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006405Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007169Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007171Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projectsEnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007861Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3umEnvironmentalOpen in IMG/M
3300008258Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NAEnvironmentalOpen in IMG/M
3300009068Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaGEnvironmentalOpen in IMG/M
3300009155Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaGEnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009185Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaGEnvironmentalOpen in IMG/M
3300009247Microbial communities of water from Amazon river, Brazil - RCM14EnvironmentalOpen in IMG/M
3300009404Microbial communities of water from Amazon river, Brazil - RCM6EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009608Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_2Apr14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011268Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012702Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012720Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012729Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012730Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012731Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012748Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES045 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012758Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012762Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES046 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012763Freshwater microbial communities from Lake Simoncouche, Canada - S_140108_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012781Freshwater microbial communities from Lake Simoncouche, Canada - S_130712_E_mt (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013006Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016683Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES128 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016740Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041413YT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019244Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020013Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041406CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020253Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945)EnvironmentalOpen in IMG/M
3300020441Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006)EnvironmentalOpen in IMG/M
3300020521Freshwater microbial communities from Lake Mendota, WI - 26SEP2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020529Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020566Freshwater microbial communities from Lake Mendota, WI - 13SEP2009 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300020715Freshwater microbial communities from Trout Bog Lake, WI - 27JUL2009 hypolimnionEnvironmentalOpen in IMG/M
3300021131Freshwater microbial communities from Trout Bog Lake, WI - 07JUL2009 epilimnionEnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021849Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022714Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024343Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fractionEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024561Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024572Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024574Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025375Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH22May08 (SPAdes)EnvironmentalOpen in IMG/M
3300025621Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 (SPAdes)EnvironmentalOpen in IMG/M
3300025747Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300026183Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300026418Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 12R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026572Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepB_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027127Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepC_8hEnvironmentalOpen in IMG/M
3300027139Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8hEnvironmentalOpen in IMG/M
3300027143Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300027148Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepB_8hEnvironmentalOpen in IMG/M
3300027151Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepA_0hEnvironmentalOpen in IMG/M
3300027154Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8hEnvironmentalOpen in IMG/M
3300027255Estuarine microbial communities from the Columbia River estuary - metaG 1558A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027594Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepA_8hEnvironmentalOpen in IMG/M
3300027644Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027744Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027752Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes)EnvironmentalOpen in IMG/M
3300027754Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027769Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027772Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027885Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028113Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031261Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1EnvironmentalOpen in IMG/M
3300031392Saline water microbial communities from Organic Lake, Antarctica - #917EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300034019Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049EnvironmentalOpen in IMG/M
3300034167Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Apr2015-rr0082EnvironmentalOpen in IMG/M
3300034355Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Oct2015-rr0135EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12547J11936_108566613300000736Freshwater And SedimentMWVTTRVEIQYYYLLEGRYFRRVQ*GYHPIFQNIDAVTNWG*NLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLSYTHILKKIYLKNY
JGI20158J14315_1017443723300001355Pelagic MarineMLEGRTIRRVL*GYHPSFQNIDAVTN*S*NLVSLSSVVFSYLNFFVNRLILPFSSVTSIIGFMLLICIGLQLLSGFFLG*YYMPEPGLVVELREEMFNDTRFGAEVF
ACM22_108758513300001846Marine PlanktonMLEGRNFRRVL*GYHPNFQNIDIITN*T*NLISLSSMIFSYMNFFVNRLLLPFSSVTSIIGFMLLLTMLMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVYYMHVRGVDTLMVLSYIHILKKIFLKNY
JGI24538J26636_1002354933300002154MarineMLEGRNLRRVL*GYHPTFQNLDAVTN*G*NLISLSSMVFSYLNFFVNRLILPFQSVTSIIGFMLLICIGMQLLSGFFLA*YYMPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLMLLSYMHIMK
JGI25914J50564_1017869223300003429Freshwater LakeMWIKI*VEIQYYQLLEGKYFRRVQ*GYHPIFQNIDAVTNWG*NLISLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLLLTISMQLLSGFFLG*YYIPEPGLVIELR
JGI25930J51415_102224313300003499Freshwater LakeLLEGKYFRRVQ*GYHPIFQNIDAVTN*G*NLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLLLTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLSYTH
Ga0005851_103191023300003684Freshwater And SedimentLITNVTHYIDNINLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIGLQLVSGFFLG*YYIPEP
Ga0066178_1010056913300004124Freshwater LakeLLEGKYFRRVQ*GYHPIFQNIDAVTNWG*NLISLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLLLTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLSYTHILKKIYLKNYVT
Ga0066180_1021546113300004128Freshwater LakeMLEGRYFRRVQ*GYHPIFQNIDAVTN*G*NLVSLSGVIFSYLNIFVNRLVIPFSSVTSIIGFMLLLTIVMQLMSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVR
Ga0063356_10132825013300004463Arabidopsis Thaliana RhizosphereMKGMRFTDNTKCMLEGRYFRRVQ*GYHPIFQSIDAVTN*G*NMVSLSGVFFSYLNFFVNRLVLPFSSATSVVGFMLLIAIVLQLLSGFYLG*YYIPEPGLVIELREEMFNDTRFGAEIFYMHVRGVDTIFVLSYMHILKKIYLKN
Ga0008280_103329593300004507MarineMLEGRYFRRVQ*GYHPIFQNIDAVTN*G*NLVSLSGVIFSYINFFVNRLVLPFSSVTSVIGFMLLLTIGMQLLSGF
Ga0007745_100770813300004765Freshwater LakeLLEGKYFRRVQ*GYHPIFQNIDAVTNWG*NLISLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLLLTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLSYTHILK
Ga0007748_1019596023300004769Freshwater LakeMWIKI*VEIQYYQLLEGKYFRRVQ*GYHPIFQNIDAVTNWG*NLISLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLLLTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLSYTHILKKIYLKNYV
Ga0007748_1022543713300004769Freshwater LakeMLYIDNINLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIILQLVSGFFLG*YYIPEPGLVIELREEMF
Ga0007755_104955713300004787Freshwater LakeLLITNVTLCTDSINLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIALQLVSGFFLG*YYIPEPGLVIELREEMFND
Ga0007752_1011574513300004789Freshwater LakeMLYIDNINLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIILQLVSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMH
Ga0007761_1016726313300004792Freshwater LakeMLFIDNINLFEGRYFRRVQ*GYHPIFQGIDAVTS*G*NLVSLSGVVFSYLNFFVNRLLIPFSSVTSIIGFMLLISISLQLVSGFF
Ga0007761_1020993613300004792Freshwater LakeMLYIDNINLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIILQLVSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHV
Ga0007760_1023692623300004793Freshwater LakeLLEGKYFRRVQ*GYHPIFQNIDAVTNWG*NLISLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLLLTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYM
Ga0007756_1014412523300004795Freshwater LakeMHYIDNINLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIGLQLVSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEV
Ga0007759_1012593923300004836Freshwater LakeLLEGKYFRRVQ*GYHPIFQNIDAVTNWG*NLISLSGVIFSYLSFYVNRLVIPFSSVTSIIGFILLLTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYM
Ga0049085_1029890613300005583Freshwater LenticMWIKI*VEIQYYQLLEGKYFRRVQ*GYHPIFQNIDAVTNWG*NLISLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLLLTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLSYTHILKKIYL
Ga0078894_1000146813300005662Freshwater LakeLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGMFFSYLNFFVNRLVLPFSSVTSVIGFMLLIAISLQLLSGFYLG*YYI
Ga0078894_1003416313300005662Freshwater LakeLITNVTLCTDSINLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIALQLVSGFFLG*YYIPEPGLVIELREEMFND
Ga0078894_1092909323300005662Freshwater LakeMIYYYYMFEGRNFRKVQ*GYHPIFQSLDAVSN*S*NLVSLSGTIFSYLNLFVNRLVIPFSSVTSIIGFMLLLTICLQLLSGFFLG*YYIPEPG
Ga0075502_117602013300006357AqueousMLEGRYFRRIS*GYHPSFQTIDAVTN*G*NLVSLSGVIFSYLNLFINRLVIPFSSVTSIIGFMLFSVIVLQLLSGFFLGWYYMPEPGLVIELREEMFNDTRFGAEVFYMHV
Ga0075493_107018923300006396AqueousLLEGRQIRRVQ*GYHPIFQNLDAVTN*G*NLVSLSGVVFSYLNFFANRLVLSYFSVTSIIGFMLMLSIMFQLLSGFFLA*YYIPEPGLVVELREEMFNDTRFGSEVFYMHIRGVDTLMVLSYVHILKK
Ga0075510_1091149923300006405AqueousYHPSFQNIDAVTS*N*NLISLSSVIFSYANFFVNRLLIPFSSATSILGFMLLLCIMMQLLSGFFLA*YYMPEPGLVVELREEMFNDTRFGAEVFFAHVRSR*
Ga0102976_111690113300007169Freshwater LakeMLEGRYFRRVQ*GYHPIFQNIDAVTN*G*NLVSLSGVVFSYLNIFVNRLVIPFSSVTSIIGFMLLITIVMQLLSGFFLG*YYIPEPGLVI
Ga0102977_116198023300007171Freshwater LakeLLEGRFFSKVQ*GYTPTFNNNDVITN*G*NLISLSAIIFSYLNFFINRLVIPFSSVTSVIGFMLLLVICLQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTI
Ga0102818_109954013300007552EstuarineMLEGRSFRRAL*GYHSSFQNIDVVTN*S*NLISLSSMIFSYLNFFVNRLVLPFSSVTSIIGFMLLISIVLQLVSGFFLG*YY
Ga0105736_100925013300007861Estuary WaterVFEGKSIRKVQ*GYHPTFNNNDLITS*N*NLVSLSGSVFSYLNLFVNRLLIPYSSVTSIIGFMLLITIVLQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVL
Ga0114840_105290423300008258Freshwater, PlanktonMLEGRNFRKAL*GYHPSFQNIDIVTN*S*NLISLSSLVFSYLNFFVNRLLLPFSSVTSIIGFMLFICILMQLLSGFFLA*YYVSEPGLVVEF
Ga0114973_1046167923300009068Freshwater LakeMLEGRNFRKAL*GYHPSFQNIDIITN*S*NLISLSSLIFSYLNFFVNKLLLPFSSVTSIIGFMLFICIIMQLLSGFFLA*YYVSEPGLVVEFREEMFNDTRFGAEVFYMHVR
Ga0114968_1064993313300009155Freshwater LakeMWVTTRVEIQYYYLLEGRYFRRVQ*GYHPIFQNIDAVTNWG*NLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVF
Ga0114966_1006000643300009161Freshwater LakeLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLIAIALQLVSGFFLG*YYIPEPG*VI*
Ga0114971_1050050913300009185Freshwater LakeMIYYYYMFEGRNFRKVQ*GYHPIFQSLDAVSN*S*NLVSLSGTIFSYLNLFVNRLVIPFSSVTSIIGFMLLLTICLQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGV
Ga0103861_1000532213300009247River WaterYHPIFQGIDAVTS*G*NLVSLSGVIFSYLNFFVNRLVLPFSSVTSVIGFMLLISIVLQLLSGFYLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHIRGVDTIFVLSYMHILKKFTLKIILALNQMVEF*
Ga0103861_1004087913300009247River WaterRVQ*GYHPIFQNIDAVSN*G*NLVSLSGVIFSYLNIFVNRLVLPFSSVTSIIGFMLLLTIVMQLMSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVLSYMHILKKNIS*
Ga0103853_101854513300009404River WaterYHPIFQGIDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLIAIALQLLSGFYLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVLSYMHILKKNLPQKLH*
Ga0115005_1068696913300009432MarineMLEGRTFRRALWGYHPSFQNIDIVTNWSWNLISLSSMVFSYLNFYVNRLVLPFSSVTSIIGFMLLLSIVMQLLSGFFLGWYYIPEPGLVVELREEMFNDTRFGAEVFYMHVRGVD
Ga0115008_1125078813300009436MarineMLEGRNFRKALWGYQPSFQNIDAVTS*N*NLISLSSVVFSYLNFFVNRLLIPFSSATSILGFMLLLCIMMQLVSRLFLA*YYMPEPGLVVELREEM
Ga0115007_1021093713300009441MarineMVEGRYFRKVQ*GYHPTFQNLDAISV*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSIIGFMLLLTIIMQLLSGFYLG*YYIPEPGLVVELREEMFNDTRF
Ga0115563_134425113300009442Pelagic MarineMLEGRNFRKAL*GYHPIFQNIDIITN*TWNLISLSSLVFSYLNFFVNRLLLPFSSVTSIIGFMLLLAIVMQLLSGFFLG*YYIPEPGLVVELREEMFNDTRFGAEV
Ga0115099_1052823033300009543MarineMLEGRNFRRAL*GYHPVFQNIDIITN*T*NLISLSSLVFSYLNFFVNRLLLPFSSVTSILGFMLLLTMVMQVLSGFFLG*YYIPEPGLVIELREEMFN
Ga0115100_1103427513300009608MarineMLEGRNFRRAL*GYHSSFQNIDVVTN*S*NLVSLSSMIFSYLNFYVNRLVLPFSSVTSIIGFMLLISIVMQIMSGFFLG*YYIPEPGLVVELREEMFNDTRFGGEVF*MHLRGVDSIMLL
Ga0115104_1061096813300009677MarineMLEGRYFRKVQ*GYHPVFQNIDAVTN*G*NLVSLSGTIFSYLNFFVNRLVIPFSSVTSIIGFMLFITIIMQLMSGFFLG*YYMPEPGLVIELREEMFNDTRFGAEV
Ga0115104_1131721243300009677MarineRNVRRVL*GYHPTFQNLDAVTN*G*NLVSLSSMVFSYLNFFVNRLILPFQSVTSIIGFMLLMCIVMQLLSGFFLA*YYMPEPGLVIE*
Ga0115105_1024793343300009679MarineRNFRKVLWGYHPSFQNIDIITNWTWNLISLSSMVFSFLNFFVNRLVLPFSSVTSVIGFMLVFTIAMQILSGFFLG*
Ga0115105_1054837013300009679MarineRNFRKALWGYHPSFQNIDIVTNWTWNLVSLSSMIFSYLNFYVNRLILPFSSVTSVIGFMLVLTIAMQIMSGFFLG*
Ga0133547_1112529133300010883MarineMLEGRYFRRVQ*GYHPIFQNIDAVAS*S*NLVSLSGVIFSYLNFFVNRLVIPFSSVTSIIGFMLLICILFQLFSGFFLA*YYIPEPGLVIELREEMFNDTRFGFEV
Ga0133913_10072787133300010885Freshwater LakeMLEGRNFRKAL*GYHPSFQNIDIITN*S*NLISLSSLIFSYLNFFVNKLLLPFSSVTSIIGFMLFICIIMQLLSGFFLA*YYVSEPGLVVEFREEMFNNTRFGAEVFYMHVRGVDTLMILSYMHILK
Ga0151620_110411423300011268FreshwaterMLIALNSLVDNMWVTTRVEIQYYYLLEGRYFRRVQ*GYHPIFQNIDAVTNWG*NLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLSYTHILKKIYLK
Ga0150985_10127508313300012212Avena Fatua RhizosphereMLEGRYIREAQ*SYTPSFQNIDIVSS*N*NLISLSSSFFSYLALFVNRLVLPFSSVSSVIGFMLLLAIVFQLLSGFYLG*YYIPEPGLVVELREEMFNDTR
Ga0150984_10595440713300012469Avena Fatua RhizosphereMLCIDSINKYCQFLLEGRYFRRVQ*GYHPIFQNIDAVSN*G*NLISLSGVVFSYLNFFVNRLILPFSSVTSVIGFMLLIAIVMQLLSGFFLG*YYIPEPGLVVELREEMFNDTRFGAEVFYMHVRGVD
Ga0157596_101396413300012702FreshwaterMWVTTRVEIQYYYLLEGRYFRRVQ*GYHPIFQNIDAVTNWG*NLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVR
Ga0157605_106175613300012716FreshwaterEGRYFRRVQ*GYHPIFQGIDAVTS*G*NLVSLSGVVFSYLNFFVNRLVLPFSSVTSIIGFMLLISISLQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVLSYMHILKKIYLKNYISA*
Ga0157613_104875423300012720FreshwaterMHYIDNINLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIGLQLVSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVLSYMHILKKIYLKNYISSES
Ga0157625_116536013300012729FreshwaterLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIVLQLLSGFYLG*YYIPEPGL
Ga0157602_101157413300012730FreshwaterLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIVLQLLSGFYLG*YYIPEPGLVVELREEMFNDTR
Ga0157616_132074213300012731FreshwaterLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGVFFSYLFFFVNRLVLPFSSVTSVIGFMLLISIVLQLLSGFYLG*YYIPEPGLVVELREEMFNDTR
Ga0157553_110478413300012748FreshwaterMFEGRNFRKVQ*GYHPIFQSLDAVSN*S*NLVSLSGTIFSYLNLFVNRLVIPFSSVTSIIGFMLLLTICLQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVF
Ga0138285_100427023300012758Freshwater LakeMLEGRNFRKAL*GYHPSFQNIDIVTN*S*NLISLSSLVFSYLNFFVNRLLLPFSSVTSIIGFMLFICILMQLLSGFFLA*YYVAEPGLVVEFREEMFNDTRFGAEVFYMHVRGVDTLMILSYMHILKKST*
Ga0157554_110886523300012762FreshwaterLFEGRYFRRVQ*GYHPIFQGVDAVTS*G*NLVSLSGMIFSYLNFFVNRLVLPFSSVTSVIGFMLLIAISLQLLSGFYLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVLSYMHILKK
Ga0138289_111432923300012763Freshwater LakeMLEGRYFRRVQ*GYHPIFQNIDAVTN*G*NLISLSGVIFSYLNFFVNRLLIPFSSVTSIIGFMLLLTILMQLLSGFFF*
Ga0138286_106058213300012781Freshwater LakeRNFRKAL*GYHPSFQNIDIVTN*S*NLISLSSLVFSYLNFFVNRLLLPFSSVTSIIGFMLFICILMQLLSGFFLA*YYVAEPGLVVEFREEMFNDTRFGAEVFYMHVRGVDTLMILSYMHILKKSI*
Ga0164294_1062207713300013006FreshwaterMLEGRNFRKAL*GYHPSFQNIDIVTN*S*NLISLSSLVFSYLNFFVNRLLLPFSSVTSIIGFMLFICILMQLLSGFFLA*YYVAEPGLVVEFREEMFNDTRFG
Ga0170791_1095964163300013295FreshwaterMLEGRYFRRVQ*GYHPIFQNIDAVTN*G*NLVSLSGVIFSYLNVFVNRLVIPFSSVTSIIGFMLLLTIVMQLLSGFFLG*YYIPEPG
Ga0170791_1407053823300013295FreshwaterMLEGRYFRRVQ*GYHPIFQNIDAVTN*G*NLVSLSGVIFSYLNVFVNRLVIPFSSVTSIIGFMLLLTIVMQLLSGFFLG*YYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVLSYMHILKKFTLKIT*
Ga0180042_11016013300016683FreshwaterMWVTTRVEIRYYYLLEGRYFRRVQXGYHPIFQNIDAVTNWGXNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVL
Ga0182096_103948913300016740Salt MarshMLEGRNFRKALXGYHPSFQNIDSVTSWNXNLISLSSVVFSYLNFFVNRLLIPFSSATSILGFMLLLCIMMQLLSGFFLAXYYMPEPGLVVELREEMFNDTRFGAEVFFAHVRGV
Ga0193545_1013270223300019025MarineRHMLEGRNFRKALWGYHPTFQNIDIIVNXTXNLISISSLIFSYINFFVNRLLLPFSSVTSIIGFMLLLTMTMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRYGEKYIICT
Ga0180111_133275713300019244Groundwater SedimentMIFFLKSVIRHLTQRRVQXGYHPIFQSIDAVVAXGXNLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLIAIIFQLLSGFFLGXYYMPEPGLVVELREEMFNDTRFG
Ga0182086_114085313300020013Salt MarshMLEGRNFRKALXGYHPSFQNIDSVTSWNXNLISLSSVVFSYLNFFVNRLLIPFSSATSILGFMLLLCIMMQLLSGFFLAXYYMPEPGLVVELREEMFNDTRF
Ga0194111_1044296513300020083Freshwater LakeMLEGRYFRRVQXGYHPIFQNIDAVTNXGXNLVSLSGVIFSYLNFFVNRLLIPFSSVTSIIGFMLLLTISMQLLSGFFLGXYYIPEPGLVVELREEMFNDTRFGAEVF
Ga0206127_127388313300020169SeawaterMFDGRYLRGAKWSYTPQXSTGDAVTSXGXNLVSLSGVIFSYLNFFVNRLLLPFSSVTSIIGFMLTICIGLQVLSGFYLGXYYIPEPGLVIELREEMFNDTRFGAEVFSMHVRGVDTIFVL
Ga0194127_1009326733300020221Freshwater LakeMLEGRYFRRVQXGYHPIFQNIDAVTNXGXNLVSLSGVIFSYLNFFVNRLLIPFSSVTSIIGFMLLLTIGMQLLSGFFLGXY
Ga0211685_103539713300020253MarineMLEGRNFRRALWGYHPTFQNIDIITTXTXNMISISSLIFSYLNFFVNRLLLPFSSVTSILGFMLLLTMVMQVLSGFFLG
Ga0211695_1019070713300020441MarineMLEGRNFRRALXGYHPTFQNIDIITTXTXNIISISSLIFSYLNFFVNRLLLPFSSVTSILGFMLLITMVMQVLSGFFLGXYYIPEPGLVI
Ga0208482_102806713300020521FreshwaterMLEGRYFRRVQXGYHPIFQNIDAVTNXGXNLVSLSGVIFSYLNFFVNRLLIPFSSVTSIIGFMLLMTIMMQLLSGFFLGXYYIPEPG
Ga0208233_102399923300020529FreshwaterMLEGRYFRRVQXGYHPIFQNIDAVTNXGXNLVSLSGVIFSYLNFFVNRLLIPFSSVTSIIGFMLLMTIMMQLLSGFFLGXYY
Ga0208222_108620113300020566FreshwaterMWVTTRVEIRYYYLLEGRYFRRVQXGYHPIFQNIDAVTNWGXNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGA
Ga0206126_1010008213300020595SeawaterMIEGRTMRRVLXGYHPSFQNIDAVTNXSXNLVSLSSVVFSYLNFFVNRLILPFSSVTSIIGFMLLICIVMQLLSGFFLGXYYMPEPGLVVELREEMFNDTRFGAEVFYMHVRGVDALMVFSYM
Ga0214254_103942223300020715FreshwaterMIYYYYMFEGRNFRKVQXGYHPIFQSLDAVSNXSXNLVSLSGTIFSYLNLFVNRLVIPFSSVTSIIGFMLLLTICLQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHV
Ga0214206_104082423300021131FreshwaterMIYYYYMFEGRNFRKVQXGYHPIFQSLDAVSNXSXNLVSLSGTIFSYLNLFVNRLVIPFSSVTSIIGFMLLLTICLQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYM
Ga0206688_1020257633300021345SeawaterNFRKALWGYHPSFQNIDIVTNWTWNLVSLSSMIFSYANFYVNRLVLPFSSVTSIIGFMLIMVIVLQILSGFFFRLIFYA
Ga0206695_108856413300021348SeawaterMLEGRNFRRALXGYHPVFQNIDIITNXTXNLISLSSLVFSYLNFFVNRLLLPFSSVTSILGFMLLLTMVMQVLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVYYMHVRGVDTLM
Ga0210304_110311713300021849EstuarineMIYYYYMFEGRNFRKVQXGYHPIFQSLDAVSNXSXNLVSLSGTIFSYLNLFVNRLVIPFSSVTSIIGFMLLLTICLQLLSGFFLGXYYIPEPGLVIELREEMFND
Ga0222717_1018827313300021957Estuarine WaterMLEGRYFRKVQXGYHPVFQNIDAVTNXGXNLVSLSGTIFSYLNFFVNRLVIPFSSVTSIIGFMLFITIIMQLMSGFFLGXYYMPEPGLVIE
Ga0222713_1039103813300021962Estuarine WaterMLEGRNFRRALXGYHSSFQNLDTITNXTXNLISLSSMIFSYLNFYVNKLVLPFSSVTSVIGFMLLLSIVMQLLSGFFLGXYYIPEPGLVVELREEMFNDTRF
Ga0222719_1032859133300021964Estuarine WaterMLEGRTFRRVLXGYNPSFQNIDAASNXTXNLVSLSSMVFSYLNFYVNRLLLPFSSVTSIIGFMLLLSILMQLLSGFFLGXYYIPEPGL
Ga0242671_107562823300022714SoilLHXGYSPNFQSIDAVSNXNXNLISLSGMFFSYLNFFVNRLVLPFSSVTSVIGFMLLIAIVMQLLSGFF
Ga0244777_1002237473300024343EstuarineMLEGRYFRRVQXGYHPIFQNIDAVTNXGXNLISLSGVIFSYLNFFVNRLLIPFSSVTSIIGFMLLMTIVMQLLSGFFLGWYYIPEPGLVVELREEMFNDTRFGAEVFYMHLRGVDTIFVLSY
Ga0244777_1092669723300024343EstuarineMIYYYYMFEGRNFRKVQXGYHPIFQSLDAVSNXSXNLVSLSGTIFSYLNLFVNRLVIPFSSVTSIIGFMLLLTICLQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIF
Ga0244775_1076599813300024346EstuarineMLEGRNFRKVQXGYHPIFQSTDSVTNXGXHLVSLSGSIFSYLNFFVNRLVLPFSSVTSVIGFMLLLTILMQLLSGFFLGXYYIPEPGLVVELREEMFNDTRFGAEVFYMHVRGVDSIM
Ga0255288_106396123300024561FreshwaterRVQXGYHPIFQGVDAVTSXGXNLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIALQLLSGFYLGXYYIPEPGLVVELREEMFNDTRFGSEVFFFLFKFFRKSISFTVF
Ga0255268_113349023300024572FreshwaterTNVMHYIDNINLFEGRYFRRVQXGYHPIFQGIDAVTSXGXNLVSLSGVVFSYLNFFVNRLVLPFSSVTSVIGFMLLISIGLQLVSGFYLGXYYIPEPGLVIELREEMFNDTRFGAVVFYMHVRGVDTIFVYLICTF
Ga0255275_121392223300024574FreshwaterRVQXGYHPIFQGVDAVTSXGXNLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIALQLLSGFYLGXYYIPEPGLVVELREEMFNDTRFGSEVFLYAH
Ga0209634_122827013300025138MarineMLEGRNFRRALXGYHPTFQNIDIITNXTXNLISLSSLIFSYLNFFVNRLLLPFSSVTSILGFMLLLTMLMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVYYMHVRG
Ga0208259_103281413300025375FreshwaterMLEGRYFRRVQXGYHPIFQNIDAVTNXGXNLVSLSGVIFSYLNLFINRLVIPFSSVTSIIGFMLLLTIMMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVLSY
Ga0209504_111568213300025621Pelagic MarineMLEGRLIRKVLWGYHPTFQNIDAGSNXTXNLVSLSSMIFSYLNFFVNRLLLPFSSVTSIIGFMLLLAIVMQLLSGFFLGXYYIPEPGLVVELREEMFNDTRFGAEVFYMHV
Ga0255247_103565613300025747FreshwaterMALNSLVDNMWVTTRVEIQYYYLLEGRYFRRVQXGYHPIFQNIDAVTNWGXNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVF
Ga0209335_1041877913300025894Pelagic MarineMLEGRNVRRVLXGYHPTFQNLDLVTNXGXNLVSLSSMVFSYLNFFVNRLILPFQSVTSIIGFMLLLCICMQLLSGFFLAXYYMPEPGLVIELREEMFNDTRFGAEVFYMHV
Ga0209932_112270623300026183Pond WaterMLEGRYFRRAQWGYHPIFQNLDAVTNWAXNLISLSGTIFSYLNAFVNRLVLPFSSVTSIIGFMLLLTIMMQLLSGFYLGXYYIPEPGL
Ga0247564_105566923300026418SeawaterLWGYHPSFQNIDIVTNWSWNLISLSSMIFSYLNFYVNRLVLPFSSVTSIIGFMLLLSIVMQLLSGFFLGWYYIPEPGLVVELREEMFNDTRFGA
Ga0247599_111025113300026470SeawaterRTFRRALWGYHPSFQNIDIVTNWSWNLISLSSMIFSYLNFYVNRLVLPFSSVTSIIGFMLLLSIVMQLLSGFFLGWYYIPEPGLVVELREEMFNDTRFGAEVFYMHVRGVDTLMVLSFLT
Ga0255270_102162913300026572FreshwaterNAMHYIDNINLFEGRYFRRVQXGYHPIFQGIDAVTSXGXNLVSLSGVVFSYLNFFVNRLVLPFSSVTSVIGFMLLISIVLQLLSGFFF
Ga0255269_115203023300026573FreshwaterMHYIDNINLFEGRYFRRVQXGYHPIFQGIDAVTSXGXNLVSLSGVVFSYLNFFVNRLVLPFSSVTSVIGFMLLIAIVLQLLSGFFLGXYYIPEPGLVIELREEMF
Ga0255071_104367213300027127FreshwaterMWVTTRVEIQYYYLLEGRYFRRVQXGYHPIFQNIDAVTNWGXNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLSY
Ga0255082_101266413300027139FreshwaterMIYYYYMFEGRNFRKVQXGYHPIFQSLDAVSNXSXNLVSLSGTIFSYLNLFVNRLVIPFSSVTSIIGFMLLLTICLQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGV
Ga0255105_106846313300027143FreshwaterMWVTTRVEIQYYYLLEGRYFRRVQXGYHPIFQNIDAVTNWGXNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLSYT
Ga0255115_109692613300027148FreshwaterMWVTTRVEIQYYYLLEGRYFRRVQXGYHPIFQNIDAVTNWGXNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVD
Ga0255063_108810913300027151FreshwaterMIYYYYMFEGRNFRKVQXGYHPIFQSLDAVSNXSXNLVSLSGTIFSYLNLFVNRLVIPFSSVTSIIGFMLLLTICLQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVLSYV
Ga0255111_105594213300027154FreshwaterMWVTTRVEIQYYYLLEGRYFRRVQXGYHPIFQNIDAVTNWGXNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDT
Ga0208681_101541823300027255EstuarineMHYIDKSSLSERTTYFMLEGRSFRRALXGYHPSFQNIDVVTNXSXNLVSLSSMIFSYLNFFVNRLVLPFSSVTSIIGFMLFLSILMQLLSGFFLGXYYIPEPGLVVELREEMFNDTRF
Ga0255120_103336223300027594FreshwaterMWVTTRVEIQYYYLLEGRYFRRVQXGYHPIFQNIDAVTNWGXNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLS
Ga0209356_103433413300027644Freshwater LakeMWIKIXVEIQYYQLLEGKYFRRVQXGYHPIFQNIDAVTNWGXNLISLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLLLTISMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFVLSY
Ga0209188_107948623300027708Freshwater LakeMIYYYYMFEGRNFRKVQXGYHPIFQSLDAVSNXSXNLVSLSGTIFSYLNLFVNRLVIPFSSVTSIIGFMLLLTICLQLLSGFFLGXYYIPEPGLVIELREEMFNERRRPRRKGKPVIKKAKXILI
Ga0209355_133436713300027744Freshwater LakeMWIKIXVEIQYYQLLEGKYFRRVQXGYHPIFQNIDAVTNWGXNLISLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLLLTISMQLLSGFFLGXYYIPEPGLVIELREE
Ga0209192_1031726713300027752MarineMLEGRYFRKVQXGYHPIFQNIDIITNXGXNLISLSGVVFSYLNFFVNRLVIPFSSVTSIVGFMLFITICMQIASGFFLGWYYMPEPGLVIEL
Ga0209596_140779013300027754Freshwater LakeMWVTTRVEIQYYYLLEGRYFRRVQXGYHPIFQNIDAVTNWGXNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRG
Ga0209770_1016877023300027769Freshwater LakeLFEGRYFRRVQXGYHPIFQGVDAVTSXGXNLVSLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIALQLLSGFYLGXYYIPEPGLVVELREEMFNDTRFGSEVFYMHIRGVDTIFVLSYMH
Ga0209768_1008256413300027772Freshwater LakeMWIKIXVEIQYYQLLEGKYFRRVQXGYHPIFQNIDAVTNWGXNLISLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLLLTISMQLLSGFFLGXYYIPEPGLVIELREEMF
Ga0209353_1046607913300027798Freshwater LakeVFEGKSIRKVQXGYHPTFNNNDLITSXNXNLVSLSGSVFSYLNLFVNRLLIPYSSVTSIIGFMLLITIVLQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFG
Ga0209302_1004490913300027810MarineMLEGRNFRRALXGYHPTFQNIDIVTNXTXNLVSLSSMIFSYVNFYVNRLVLPFSSVTSIIGFMLMLVIVMQIMSGFFLGXYFMPEPGLVLELREEMFND
Ga0209712_1063995513300027849MarineMLEGRYFRKVQXGYHPIFQNIDAVTNXGXNLVSLSGTIFSYLNFYVNRLIVPFXSVTSIIGFMLMLTIVMQLLSGFFLGXYYMPEPGLVIELREEMFN
Ga0209450_1033895513300027885Freshwater Lake SedimentMLEGRYFRRVQXGYHPIFQNIDAVTNXGXNLVSLSGVIFSYLNLFVNRLVLPFSSVTSIIGFMLLLTIVMQLLSGFFLGXYYIPEPGL
Ga0209702_1013839013300027976FreshwaterLLEGRYIRRVQXGYHPIFQGVDAITSXGXNLISLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLISIVLQLLSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTIFVLSYMH
Ga0255234_101970723300028113FreshwaterLITIVTLFIDNINLFEGRYFRRVQXGYHPIFQGIDAVTSXGXNLVSLSGVVFSYLNFFVNRLVLPFSSVTSIIGFMLLISIALQLVSGFFLGXYYIPEPGLVIELREEMFNDTRFGAEVFLYAR
Ga0255234_102668313300028113FreshwaterLFESRYISKLYXGYNPTFNNLDILTNXGXNLISLSGVVFSYLNFFINRLVIPFSSVTSIIGFMLLLVILLQLLSGFFLGXYYVPEPGLVIELREEMFNDTRF
Ga0256412_105549133300028137SeawaterSFRRALXGYHPSFQNIDIITNXSXNLVSLSSMIFSYLNFFVNRLVLPFSSVTSIIGFMLLLSILSQLLSGFFLGXYYIPEPGLVVELREEMFNDTRFGAEVFYMHVRGVDTLMVLSYPYHEKNLS
Ga0256413_122738513300028282SeawaterFRRALXGYHSSFQNIDLITNWSWNLISLSSMVFSYLNFFVNRLVLPFSSVTSIIGFMLLISIVMQLLSGFFLGXYYIPEPGLVVELREEMFNDTRFGAEVFXMHLRGVDTVMLLSYMHIF
Ga0247572_100607423300028290SeawaterMLEGRNFRRALXGYHPVFQNIDIITNXTXNLISLSSLVFSYLNFFVNRLLLPFSSVTSILGFMLLLTMVMQVLSGFFF
Ga0302140_1113241713300031261BogVLLTEGRYFRRVQXGYHPIFQSIDAVVAXGXNLISLSGVVFSYLNFFVNRLVLPFSSVTSVIGFMLLIAIVLQLVSGFFLGXYYIPEPGLVIE
Ga0307975_104721913300031392Saline WaterLFEGRKLRYTTWSYLPSFKGFDAVSNXTWDLVSFSGKYFAYLNFYVNRLLLPFSSVTSIFGFVLLVAIMLQLLSGFFLAWYYIPEPGLVIEMREEMFEETRFGTEVFSMH
Ga0170820_1609369633300031446Forest SoilRRVQXGYHPIFQNIDAVVAXGXNLISLSGVFFSYLNFFVNRLVLPFSSVTSVIGFMLLIAIILQILSGFFLG
Ga0308149_100669213300031542MarineGRNFRKALWGYHPSFQNIDIVTNWTWNLVSLSSMIFSYANFFVNRLVLPFSSVTSIIGFMLLLTIVLQIASGFFLG
Ga0315899_1072996823300031784FreshwaterVQXGYHPIFQGIDAVTSXGXNLVSLSGVVFSYLNFFVNRLLIPFSSVTSIIGFMLLISISLQLVSGFFLGXYYIPEPGLVIELREEMFNDTRF
Ga0315909_1026342723300031857FreshwaterMLEGRNFRKVQXGYHPIFQSTDSVTNXGXHLVSISGAIFSYLNFFVNRLLIPFSSVTSIIGFMLLLTILMQLLSGFFLGXYYIPEPGLVVELREEMFNDTRFGAEVFXM
Ga0315906_1017911113300032050FreshwaterMLEGRNFRKALXGYHPSFQNIDIVTNXSXNLISLSSLVFSYLNFFVNRLLLPFSSVTSIIGFMLFICILMQLLSGFFLAXYYVAEP
Ga0315270_1011851213300032275SedimentMKIKIYMFKIRNTTXHSLPSFGGLDAVNNXAXSLIYLSGNIISYMNHYVNKLLLPFSSTTSIMGFMLLLTIAMQLTSGFFLGXYYIPEPGLVIELREEMFNDTRFGVEVFYMHVRGVDVL
Ga0348332_1215191213300032515Plant LitterMMEGRYFRKVQXGYHPIFQSIDAVTSXGXNLISFSGVIMSYLNFFVNRLVLPFTSVTSVIGFMLLVAIMLQLVSGFFLGXYYMPEPGLVVELREEMFNDTRFGAETFYMHVR
Ga0334982_0313983_339_7343300033981FreshwaterMWVTTRVEIQYYYLLEGRYFRRVQWGYHPIFQNIDAVTNWGWNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGWYYIPEPGLVIELREEMFNDTRFGAEVFYMHVRGVDTLFV
Ga0334998_0307376_2_3253300034019FreshwaterMWVTTRVEIQYYYLLEGRYFRRVQWGYHPIFQNIDAVTNWGWNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGWYYIPEPGLVIELREE
Ga0335017_0044093_2_3223300034167FreshwaterMLEGRYFRRVQWGYHPIFQNIDAVTNWGWNLVSLSGVIFSYLNIFVNRLVIPFSSVTSIIGFMLLLTIVMQLMSGFFLGWYYIPEPGLVIELREEMFNDTRFGAEVF
Ga0335039_0491005_292_6153300034355FreshwaterMWVTTRVEIRYYYLLEGRYFRRVQWGYHPIFQNIDAVTNWGWNLVSLSGVIFSYLSFYVNRLVIPFSSVTSIIGFMLILTISMQLLSGFFLGWYYIPEPGLVIELREE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.