| Basic Information | |
|---|---|
| Family ID | F049621 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEEL |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 75.17 % |
| % of genes near scaffold ends (potentially truncated) | 24.66 % |
| % of genes from short scaffolds (< 2000 bps) | 78.77 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.63 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (52.055 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.178 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.740 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (65.753 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.63 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 9.59 |
| PF01521 | Fe-S_biosyn | 0.68 |
| PF05257 | CHAP | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0316 | Fe-S cluster assembly iron-binding protein IscA | Posttranslational modification, protein turnover, chaperones [O] | 0.68 |
| COG4841 | Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family | Function unknown [S] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.81 % |
| Unclassified | root | N/A | 32.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000736|JGI12547J11936_1075334 | Not Available | 635 | Open in IMG/M |
| 3300000736|JGI12547J11936_1086634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 577 | Open in IMG/M |
| 3300000756|JGI12421J11937_10054685 | All Organisms → Viruses → Predicted Viral | 1274 | Open in IMG/M |
| 3300000756|JGI12421J11937_10145907 | Not Available | 590 | Open in IMG/M |
| 3300002161|JGI24766J26685_10004283 | All Organisms → Viruses → Predicted Viral | 4128 | Open in IMG/M |
| 3300002161|JGI24766J26685_10027160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1389 | Open in IMG/M |
| 3300002835|B570J40625_100404573 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1324 | Open in IMG/M |
| 3300002835|B570J40625_101598492 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 532 | Open in IMG/M |
| 3300003277|JGI25908J49247_10038458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1307 | Open in IMG/M |
| 3300003277|JGI25908J49247_10151413 | Not Available | 541 | Open in IMG/M |
| 3300003388|JGI25910J50241_10017080 | All Organisms → cellular organisms → Bacteria | 2566 | Open in IMG/M |
| 3300004240|Ga0007787_10474800 | Not Available | 625 | Open in IMG/M |
| 3300005517|Ga0070374_10093539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1566 | Open in IMG/M |
| 3300005517|Ga0070374_10286757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 837 | Open in IMG/M |
| 3300005517|Ga0070374_10358923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 735 | Open in IMG/M |
| 3300005525|Ga0068877_10263819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1007 | Open in IMG/M |
| 3300005525|Ga0068877_10753186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 518 | Open in IMG/M |
| 3300005528|Ga0068872_10488511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 662 | Open in IMG/M |
| 3300005582|Ga0049080_10102213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 974 | Open in IMG/M |
| 3300005583|Ga0049085_10316667 | Not Available | 506 | Open in IMG/M |
| 3300005584|Ga0049082_10168651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 755 | Open in IMG/M |
| 3300005662|Ga0078894_10255411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1589 | Open in IMG/M |
| 3300005662|Ga0078894_10755291 | Not Available | 854 | Open in IMG/M |
| 3300005662|Ga0078894_10827093 | Not Available | 808 | Open in IMG/M |
| 3300005662|Ga0078894_10887466 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 774 | Open in IMG/M |
| 3300005662|Ga0078894_11112644 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 674 | Open in IMG/M |
| 3300005662|Ga0078894_11270607 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 620 | Open in IMG/M |
| 3300005805|Ga0079957_1099641 | Not Available | 1587 | Open in IMG/M |
| 3300006484|Ga0070744_10049435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1234 | Open in IMG/M |
| 3300006484|Ga0070744_10178515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 606 | Open in IMG/M |
| 3300006639|Ga0079301_1003973 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 6214 | Open in IMG/M |
| 3300006639|Ga0079301_1005843 | All Organisms → Viruses → Predicted Viral | 4969 | Open in IMG/M |
| 3300007162|Ga0079300_10017030 | All Organisms → Viruses → Predicted Viral | 2639 | Open in IMG/M |
| 3300007622|Ga0102863_1166210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 649 | Open in IMG/M |
| 3300007653|Ga0102868_1100120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 662 | Open in IMG/M |
| 3300008055|Ga0108970_11803497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 674 | Open in IMG/M |
| 3300008107|Ga0114340_1007603 | Not Available | 5573 | Open in IMG/M |
| 3300008107|Ga0114340_1026467 | Not Available | 4466 | Open in IMG/M |
| 3300008107|Ga0114340_1039498 | All Organisms → Viruses → Predicted Viral | 2118 | Open in IMG/M |
| 3300008107|Ga0114340_1043668 | All Organisms → Viruses → Predicted Viral | 1991 | Open in IMG/M |
| 3300008107|Ga0114340_1047869 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1884 | Open in IMG/M |
| 3300008107|Ga0114340_1117397 | Not Available | 1036 | Open in IMG/M |
| 3300008107|Ga0114340_1243470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 556 | Open in IMG/M |
| 3300008113|Ga0114346_1289332 | Not Available | 574 | Open in IMG/M |
| 3300008114|Ga0114347_1090753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1203 | Open in IMG/M |
| 3300008114|Ga0114347_1092605 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
| 3300008116|Ga0114350_1014107 | Not Available | 5174 | Open in IMG/M |
| 3300008116|Ga0114350_1159194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 616 | Open in IMG/M |
| 3300008117|Ga0114351_1095097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1749 | Open in IMG/M |
| 3300008261|Ga0114336_1075162 | All Organisms → Viruses → Predicted Viral | 1656 | Open in IMG/M |
| 3300008261|Ga0114336_1164334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 970 | Open in IMG/M |
| 3300008264|Ga0114353_1143887 | Not Available | 1208 | Open in IMG/M |
| 3300008450|Ga0114880_1213570 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 635 | Open in IMG/M |
| 3300008962|Ga0104242_1012418 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1495 | Open in IMG/M |
| 3300008962|Ga0104242_1023720 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
| 3300008996|Ga0102831_1280925 | Not Available | 549 | Open in IMG/M |
| 3300009051|Ga0102864_1204233 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 539 | Open in IMG/M |
| 3300009056|Ga0102860_1095417 | Not Available | 824 | Open in IMG/M |
| 3300009158|Ga0114977_10732425 | Not Available | 524 | Open in IMG/M |
| 3300009164|Ga0114975_10272139 | Not Available | 943 | Open in IMG/M |
| 3300009183|Ga0114974_10030940 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 3699 | Open in IMG/M |
| 3300009183|Ga0114974_10347344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 861 | Open in IMG/M |
| 3300009419|Ga0114982_1004002 | Not Available | 5911 | Open in IMG/M |
| 3300009419|Ga0114982_1062930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1161 | Open in IMG/M |
| 3300010156|Ga0068873_1024063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 621 | Open in IMG/M |
| 3300010354|Ga0129333_11315201 | Not Available | 597 | Open in IMG/M |
| 3300012779|Ga0138284_1289399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 541 | Open in IMG/M |
| 3300013004|Ga0164293_10010392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 7815 | Open in IMG/M |
| 3300013004|Ga0164293_10553966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 752 | Open in IMG/M |
| 3300013005|Ga0164292_10654694 | Not Available | 674 | Open in IMG/M |
| 3300013087|Ga0163212_1074011 | Not Available | 1115 | Open in IMG/M |
| (restricted) 3300013126|Ga0172367_10086259 | Not Available | 2263 | Open in IMG/M |
| 3300014960|Ga0134316_1029639 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 617 | Open in IMG/M |
| 3300017788|Ga0169931_10891352 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 561 | Open in IMG/M |
| 3300019146|Ga0188881_10008760 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1236 | Open in IMG/M |
| 3300019784|Ga0181359_1169684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 731 | Open in IMG/M |
| 3300020048|Ga0207193_1260628 | All Organisms → Viruses → Predicted Viral | 1295 | Open in IMG/M |
| 3300020083|Ga0194111_10278409 | Not Available | 1164 | Open in IMG/M |
| 3300020141|Ga0211732_1088158 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
| 3300020151|Ga0211736_10608586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 502 | Open in IMG/M |
| 3300020151|Ga0211736_10844874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 666 | Open in IMG/M |
| 3300020161|Ga0211726_10145120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 970 | Open in IMG/M |
| 3300020161|Ga0211726_10747792 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1256 | Open in IMG/M |
| 3300020205|Ga0211731_11396195 | Not Available | 663 | Open in IMG/M |
| 3300020221|Ga0194127_10170489 | All Organisms → Viruses → Predicted Viral | 1548 | Open in IMG/M |
| 3300020498|Ga0208050_1014271 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 861 | Open in IMG/M |
| 3300020519|Ga0208223_1034727 | Not Available | 628 | Open in IMG/M |
| 3300020527|Ga0208232_1031745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 717 | Open in IMG/M |
| 3300021140|Ga0214168_1021691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1771 | Open in IMG/M |
| 3300021961|Ga0222714_10068454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2363 | Open in IMG/M |
| 3300021961|Ga0222714_10191837 | Not Available | 1187 | Open in IMG/M |
| 3300021961|Ga0222714_10261734 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 965 | Open in IMG/M |
| 3300021962|Ga0222713_10018899 | Not Available | 5843 | Open in IMG/M |
| 3300021962|Ga0222713_10045543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3395 | Open in IMG/M |
| 3300021962|Ga0222713_10074566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2496 | Open in IMG/M |
| 3300021962|Ga0222713_10319316 | Not Available | 982 | Open in IMG/M |
| 3300021962|Ga0222713_10391596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 858 | Open in IMG/M |
| 3300021963|Ga0222712_10093208 | All Organisms → Viruses → Predicted Viral | 2124 | Open in IMG/M |
| 3300021963|Ga0222712_10252993 | Not Available | 1126 | Open in IMG/M |
| 3300021963|Ga0222712_10403918 | Not Available | 829 | Open in IMG/M |
| 3300022407|Ga0181351_1062979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1520 | Open in IMG/M |
| 3300022752|Ga0214917_10006315 | Not Available | 12346 | Open in IMG/M |
| 3300022752|Ga0214917_10414742 | All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon | 549 | Open in IMG/M |
| 3300022752|Ga0214917_10463855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 501 | Open in IMG/M |
| 3300023174|Ga0214921_10001139 | Not Available | 46199 | Open in IMG/M |
| 3300024346|Ga0244775_10101962 | Not Available | 2440 | Open in IMG/M |
| 3300024346|Ga0244775_10167741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1849 | Open in IMG/M |
| 3300024346|Ga0244775_10230903 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1545 | Open in IMG/M |
| 3300027114|Ga0208009_1000832 | Not Available | 8783 | Open in IMG/M |
| 3300027581|Ga0209651_1041657 | All Organisms → Viruses → Predicted Viral | 1387 | Open in IMG/M |
| 3300027586|Ga0208966_1000003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 113953 | Open in IMG/M |
| 3300027586|Ga0208966_1109443 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 753 | Open in IMG/M |
| 3300027595|Ga0255122_1074465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 565 | Open in IMG/M |
| 3300027608|Ga0208974_1020881 | All Organisms → Viruses → Predicted Viral | 2034 | Open in IMG/M |
| 3300027627|Ga0208942_1198164 | Not Available | 516 | Open in IMG/M |
| 3300027642|Ga0209135_1214450 | Not Available | 587 | Open in IMG/M |
| 3300027689|Ga0209551_1199062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 614 | Open in IMG/M |
| 3300027710|Ga0209599_10000956 | Not Available | 15440 | Open in IMG/M |
| 3300027710|Ga0209599_10086024 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 826 | Open in IMG/M |
| 3300027720|Ga0209617_10267295 | Not Available | 645 | Open in IMG/M |
| 3300027754|Ga0209596_1058165 | All Organisms → Viruses → Predicted Viral | 1981 | Open in IMG/M |
| 3300027756|Ga0209444_10278579 | Not Available | 570 | Open in IMG/M |
| 3300027759|Ga0209296_1097661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 1409 | Open in IMG/M |
| 3300027759|Ga0209296_1143860 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1080 | Open in IMG/M |
| 3300027769|Ga0209770_10042821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1940 | Open in IMG/M |
| 3300027793|Ga0209972_10045099 | Not Available | 2438 | Open in IMG/M |
| 3300027805|Ga0209229_10026767 | All Organisms → Viruses → Predicted Viral | 2511 | Open in IMG/M |
| 3300027816|Ga0209990_10343808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 659 | Open in IMG/M |
| 3300028025|Ga0247723_1023035 | All Organisms → Viruses → Predicted Viral | 2065 | Open in IMG/M |
| 3300031758|Ga0315907_10073087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2969 | Open in IMG/M |
| 3300031758|Ga0315907_10774703 | Not Available | 719 | Open in IMG/M |
| 3300031784|Ga0315899_11023947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 732 | Open in IMG/M |
| 3300031784|Ga0315899_11024804 | Not Available | 731 | Open in IMG/M |
| 3300031787|Ga0315900_10666529 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 745 | Open in IMG/M |
| 3300031787|Ga0315900_11093221 | Not Available | 514 | Open in IMG/M |
| 3300031857|Ga0315909_10145405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1962 | Open in IMG/M |
| 3300031857|Ga0315909_10970892 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 516 | Open in IMG/M |
| 3300031951|Ga0315904_10800945 | Not Available | 775 | Open in IMG/M |
| 3300031963|Ga0315901_11005315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 582 | Open in IMG/M |
| 3300032050|Ga0315906_10876166 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 692 | Open in IMG/M |
| 3300032050|Ga0315906_11103118 | Not Available | 585 | Open in IMG/M |
| 3300033980|Ga0334981_0397748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 590 | Open in IMG/M |
| 3300034020|Ga0335002_0253871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1054 | Open in IMG/M |
| 3300034066|Ga0335019_0202278 | All Organisms → Viruses → Predicted Viral | 1284 | Open in IMG/M |
| 3300034092|Ga0335010_0090706 | All Organisms → Viruses → Predicted Viral | 2061 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.18% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 10.96% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.22% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 7.53% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.48% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.48% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 5.48% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 4.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.11% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.42% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 3.42% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 2.05% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 2.05% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.05% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.37% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 0.68% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.68% |
| Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 0.68% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.68% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.68% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.68% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000736 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007653 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3 | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009056 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3 | Environmental | Open in IMG/M |
| 3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010156 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
| 3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
| 3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019146 | Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5 | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020221 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027595 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h | Environmental | Open in IMG/M |
| 3300027608 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027642 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12547J11936_10753341 | 3300000736 | Freshwater And Sediment | MAELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWGQEE* |
| JGI12547J11936_10866342 | 3300000736 | Freshwater And Sediment | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE* |
| JGI12421J11937_100546854 | 3300000756 | Freshwater And Sediment | MTELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWGQEE* |
| JGI12421J11937_101459071 | 3300000756 | Freshwater And Sediment | ELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWGQEE* |
| JGI24766J26685_100042834 | 3300002161 | Freshwater And Sediment | MAELKYFNALINSVVGNDEEKKAAKEYLAEVDPEIWSE* |
| JGI24766J26685_100271603 | 3300002161 | Freshwater And Sediment | MAELKYLNALLASVVGTPDQAKAAKEYLAEVDPEVWGDSPD* |
| B570J40625_1004045732 | 3300002835 | Freshwater | MADLKYFNALMNSVMGNPDQAKAAKEYLAEVDPDIWGQEE* |
| B570J40625_1015984922 | 3300002835 | Freshwater | MAELKYFNALINSVVGNDEERKTAKEYLAEVDPEVWGDSLD* |
| JGI25908J49247_100384583 | 3300003277 | Freshwater Lake | MAELKYFNALMNSVIGDHDQKKAAKEYLAEVDPDIWGQEE* |
| JGI25908J49247_101514133 | 3300003277 | Freshwater Lake | MAELKYFNALMDSVLGNPDQVKAAKEYLAEVDPDIWGQEE* |
| JGI25910J50241_100170804 | 3300003388 | Freshwater Lake | MAELKYFNALMNSVLGNPDQVKAAKEYLAEVDPDIWGQEE* |
| Ga0007787_104748002 | 3300004240 | Freshwater Lake | MADLKYFNSLMLLVTGDEAEKKAAKEYLAEVDPDIWDQQK* |
| Ga0070374_100935393 | 3300005517 | Freshwater Lake | MAELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQEE* |
| Ga0070374_102867572 | 3300005517 | Freshwater Lake | MAELNYFNALMNSVLGNPDQVKAAKEYLAEVDPDIWGQEE* |
| Ga0070374_103589232 | 3300005517 | Freshwater Lake | MAELKYFNALINSVVGDQDQKKAAKEYLAEIDPDIWGQEE* |
| Ga0068877_102638192 | 3300005525 | Freshwater Lake | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA* |
| Ga0068877_107531862 | 3300005525 | Freshwater Lake | MAELKYFNALINSVVGNDDQKKAAKEYLAEVDPEIWGESPD* |
| Ga0068872_104885112 | 3300005528 | Freshwater Lake | MEYFNALMATVMGTEDQKKAAKEYLAEVDPEIWGQEE* |
| Ga0049080_101022131 | 3300005582 | Freshwater Lentic | MAELKYFNALINSVIGDHDQKKAAKEYLAEIDPDIWGQEE* |
| Ga0049085_103166673 | 3300005583 | Freshwater Lentic | MAELKYFNALINSVIGDPDQVKAAKEYLAEVDPDIWGQEE* |
| Ga0049082_101686512 | 3300005584 | Freshwater Lentic | MAELKYLNALLASVVGTPDQAKAAKEYLAEVDPDIWGQEE* |
| Ga0078894_102554111 | 3300005662 | Freshwater Lake | MAELKYFNALINSVVGNDDQKKAAKEYLAEVDPEVWGDSSD* |
| Ga0078894_107552913 | 3300005662 | Freshwater Lake | RRNKMAELKYFNALINSVVGNDEEKKAAKEYLAELDPEIWGE* |
| Ga0078894_108270933 | 3300005662 | Freshwater Lake | NKMADLKYFNALINSVVGNDEERKAAKEYLAEVDPETWSE* |
| Ga0078894_108874661 | 3300005662 | Freshwater Lake | MADLKYFNALMNSVVGNDEERKTAKEYLAEVDPEVWGDSPD* |
| Ga0078894_111126442 | 3300005662 | Freshwater Lake | MAELKFFNALINSVVGNDEEKKSAKEYLAEVDPEVWGDSPD* |
| Ga0078894_112706072 | 3300005662 | Freshwater Lake | MAELNYFNALMNSVMGNPDQVKTAKEYLAEVDPEVWGDSPD* |
| Ga0078894_114929762 | 3300005662 | Freshwater Lake | YFNALMATVMGTDDQRKAAIEYLKEKDPDIWGQEE* |
| Ga0079957_10996411 | 3300005805 | Lake | YFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA* |
| Ga0070744_100494352 | 3300006484 | Estuarine | MAELKFFNALMNSVVGNDEEKKIAKEYLAEVDPEVWGDSPD* |
| Ga0070744_101785152 | 3300006484 | Estuarine | MAELKYFNALMNSVVGNDEERKTAKEYLAEVDPEVWGDSPD* |
| Ga0079301_100397320 | 3300006639 | Deep Subsurface | MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA* |
| Ga0079301_10058439 | 3300006639 | Deep Subsurface | MAELNYFNALINSVVGDQDQKKAAKEYLAEIDPDIWGQEE* |
| Ga0079300_100170302 | 3300007162 | Deep Subsurface | MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE* |
| Ga0102863_11662102 | 3300007622 | Estuarine | MAELKYFNALIDSVLGNPDQVKAAKEYLAEVDPDIWGQEE* |
| Ga0102868_11001202 | 3300007653 | Estuarine | MAELKYFNALMNSVIGNDEERKAAKEYLAEVDPEIWSESKE* |
| Ga0108970_118034972 | 3300008055 | Estuary | MAELKYFNALMNSVIGNDEERKAAKEYLAEVDPEIWNESKE* |
| Ga0114340_10076034 | 3300008107 | Freshwater, Plankton | MADLKYFNALMNSVVGDDEQRKAAKEYLAEVDPEVWGDSPD* |
| Ga0114340_10264677 | 3300008107 | Freshwater, Plankton | MTEIKYLNELINSVVGDENQKKSAKEYLAEVDPDIWSD* |
| Ga0114340_10394981 | 3300008107 | Freshwater, Plankton | MAELKYFNALMNSVVGNDEERKAAKEYLAEVDPEVWGDSPD* |
| Ga0114340_10436681 | 3300008107 | Freshwater, Plankton | MAELKYFNALMNSVVGNDEEKKAAKEYLAEVDPEVWGDSPD* |
| Ga0114340_10478693 | 3300008107 | Freshwater, Plankton | MAELKYFNALMNSVIGNDQERKAAKEYLAEVDPEIWSESKE* |
| Ga0114340_11173973 | 3300008107 | Freshwater, Plankton | MADLKYFNALMATVLGSDQEKAEAKKYLAEVDPEIWSESKE* |
| Ga0114340_12434702 | 3300008107 | Freshwater, Plankton | MTEIKYLNELINSIVGDENQKKSAKEYLAEVDPDIWSD* |
| Ga0114346_12893321 | 3300008113 | Freshwater, Plankton | FNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA* |
| Ga0114347_10907532 | 3300008114 | Freshwater, Plankton | MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWGDSPD* |
| Ga0114347_10926054 | 3300008114 | Freshwater, Plankton | ADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA* |
| Ga0114350_10141075 | 3300008116 | Freshwater, Plankton | MAELKYFNSLMNLVLGDPDQKKAAEEYLAEVDPDIWGQEE* |
| Ga0114350_11591941 | 3300008116 | Freshwater, Plankton | MADLKYFNSLMLLVTGDESEKKAAKEYLAEVDPDIWDQEK* |
| Ga0114351_10950972 | 3300008117 | Freshwater, Plankton | MADLKYFNSLMLLVTGDESEKKAAKEYLAEVDPDIWAQEK* |
| Ga0114336_10751625 | 3300008261 | Freshwater, Plankton | MAELKYLNALLASVVGTPDQVKAAKEYLAEVDPDIWGQEE* |
| Ga0114336_11643342 | 3300008261 | Freshwater, Plankton | MADLKYFNALINSVVGNDEQRKAAKEYLAEVDPEIWSEELQA* |
| Ga0114353_11438874 | 3300008264 | Freshwater, Plankton | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPETWSE* |
| Ga0114880_12135701 | 3300008450 | Freshwater Lake | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIW |
| Ga0104242_10124183 | 3300008962 | Freshwater | MAELKYFNALIATVLGTEEQAAEAKKYLAEVDPEIWREDSE* |
| Ga0104242_10237202 | 3300008962 | Freshwater | MPLGYMNALIASVTGDEHSAKLAKEYLAEVDPEVWKESSD* |
| Ga0102831_12809251 | 3300008996 | Estuarine | MAELKYFNALINSVVGSDDQKKAAKEYLAEVDPDVWGDSPD* |
| Ga0102864_12042331 | 3300009051 | Estuarine | MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEVWGDSPD* |
| Ga0102860_10954172 | 3300009056 | Estuarine | MAELKYFNALINSVVGDPDQKKAAKEYLAEVDPDIWGQEE* |
| Ga0114977_107324252 | 3300009158 | Freshwater Lake | MAELNYFNALMNSVMGNPDQLKAAKEYLAEVDHDIWGQEE* |
| Ga0114975_102721394 | 3300009164 | Freshwater Lake | MAELKYFNALINSVIGAHDQKKAAKEYLAEIDPDIWGQEE* |
| Ga0114974_100309402 | 3300009183 | Freshwater Lake | MVDLKYFNSLMLLVTGDEAEKKAAKEYLAEVDPDIWDQKK* |
| Ga0114974_103473442 | 3300009183 | Freshwater Lake | MTELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQEE* |
| Ga0114982_10040023 | 3300009419 | Deep Subsurface | MAELKYFNALINSVVGNDEEKKAAKEYLAELDPEIWGE* |
| Ga0114982_10629302 | 3300009419 | Deep Subsurface | MAELKYFNALINSVVGNDEERKTAKEYLAEVDPEVWGDSSD* |
| Ga0068873_10240632 | 3300010156 | Freshwater Lake | MAELKYFNALINSVVGNDEEKKAAKEYLAEVDPEIWGDSPD* |
| Ga0129333_113152011 | 3300010354 | Freshwater To Marine Saline Gradient | YFNALINSVVGNDEERKAAKEYLAEVDPEIWGDSPD* |
| Ga0138284_12893992 | 3300012779 | Freshwater Lake | MAELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQGGPC* |
| Ga0164293_1001039220 | 3300013004 | Freshwater | MADLKYFNSLMLLVTGDEAEKKAAKEYLAEVDPDIWDQEK* |
| Ga0164293_105539662 | 3300013004 | Freshwater | MADLKYFNALMATVLGSDQEKSEAKKYLAEVDPEIWSESKE* |
| Ga0164292_106546941 | 3300013005 | Freshwater | LKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE* |
| Ga0163212_10740114 | 3300013087 | Freshwater | MTDLKYFNALMATVLGSDEQKDEAKKYLAEVDPEIWGENSE* |
| (restricted) Ga0172367_100862594 | 3300013126 | Freshwater | MAELKYFNALMATVLGSDEQKDEAKKYLAEVDPEIWGEDSE* |
| Ga0134316_10296392 | 3300014960 | Surface Water | MAELKYFNALMATVLGNDEEREEAKKYLAEVDPEIWDEES* |
| Ga0169931_108913522 | 3300017788 | Freshwater | MTELKYFNALMATVLGSDEQKNEAKKYLAEVDPEIWGEDSE |
| Ga0188881_100087604 | 3300019146 | Freshwater Lake | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA |
| Ga0181359_11696841 | 3300019784 | Freshwater Lake | MAELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWG |
| Ga0207193_12606283 | 3300020048 | Freshwater Lake Sediment | MAELKYFNALMNSVVGNDEERKTAKEYLAEVDPEVWGDSSD |
| Ga0194111_102784094 | 3300020083 | Freshwater Lake | MTDLKYFNALMATVLGSDEQKDEAKKYLAEVDPEIWGENSE |
| Ga0211732_10881583 | 3300020141 | Freshwater | MAELNYFNALMNSVLGDPDQVKAAKEYLAEVDPDIWGQEE |
| Ga0211736_106085861 | 3300020151 | Freshwater | MAELKYFNALMNSVLGNPDQVKAAKEYLAEVDPDIWGQEE |
| Ga0211736_108448742 | 3300020151 | Freshwater | MADLKYFNALINSVVGNDEEKKAAKEYLAEVDPEIWSE |
| Ga0211726_101451202 | 3300020161 | Freshwater | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEDLQA |
| Ga0211726_107477923 | 3300020161 | Freshwater | MADLKYFNCLMLLVTGDESEKKAAKEYLAEVDPDIWGQEK |
| Ga0211731_113961953 | 3300020205 | Freshwater | FNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA |
| Ga0194127_101704894 | 3300020221 | Freshwater Lake | MTDLFYFNALMATVLGSDEQKDEAKKYLAEVDPEIWGENSE |
| Ga0208050_10142712 | 3300020498 | Freshwater | MADLKYFNALMNSVVGNDEQRKAAKEYLAEVDPEIWSEELQA |
| Ga0208223_10347271 | 3300020519 | Freshwater | KMADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE |
| Ga0208232_10317451 | 3300020527 | Freshwater | MADLKYFNALMNSVVGNDEQRKAAKEYLAEVDPDIWGQEE |
| Ga0214168_10216915 | 3300021140 | Freshwater | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEDLQS |
| Ga0222714_100684547 | 3300021961 | Estuarine Water | MAELKYFNALINSVVGNDDQKKAAKEYLAEVDPEIWGDSPD |
| Ga0222714_101918371 | 3300021961 | Estuarine Water | NALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA |
| Ga0222714_102617342 | 3300021961 | Estuarine Water | MSELKYFNALMATVIGTDQEAAEAKKYLAEVDPEIWGEDSE |
| Ga0222713_100188997 | 3300021962 | Estuarine Water | MAELKYFNALMNSVIGNDEERKAAKEYLAEVDPEIWSESKE |
| Ga0222713_1004554311 | 3300021962 | Estuarine Water | MAELKYFNALMNSVIGNDEERKAAKEYLAEVDPEVWGDSPD |
| Ga0222713_100745668 | 3300021962 | Estuarine Water | MSELKYFNALMATVIGTDQEAAEAKKYLAEVDPEIWGE |
| Ga0222713_103193161 | 3300021962 | Estuarine Water | LKYFNALINSVVGNDEERKAAKEYLAEVDPEIWNE |
| Ga0222713_103915962 | 3300021962 | Estuarine Water | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQ |
| Ga0222712_100932081 | 3300021963 | Estuarine Water | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWNE |
| Ga0222712_102529935 | 3300021963 | Estuarine Water | EIKMAELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQEE |
| Ga0222712_104039184 | 3300021963 | Estuarine Water | KMAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWGDSPD |
| Ga0181351_10629792 | 3300022407 | Freshwater Lake | MAELKYFNALMDSVLGNPDQVKAAKEYLAEVDPDIWGQEE |
| Ga0214917_1000631520 | 3300022752 | Freshwater | MAELKYFNALIATVLGTEEQAAEAKKYLAEVDPEIWREDSE |
| Ga0214917_104147421 | 3300022752 | Freshwater | NEEIKMAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWGDSPD |
| Ga0214917_104638551 | 3300022752 | Freshwater | MADLKYFNALMSTVLGNDDQRKAAKEYLAEVDPEIWGEDSE |
| Ga0214921_1000113934 | 3300023174 | Freshwater | MADLKFYNSLMLLITGDESEKKAAKEYLAEVDPDIWGQEE |
| Ga0244775_101019622 | 3300024346 | Estuarine | MAELKFFNALINSVVGNDEERKAAKEYLAEKDPEVWGDSPD |
| Ga0244775_101677411 | 3300024346 | Estuarine | MAELKFFNALMNSVVGNDEEKKIAKEYLAEVDPEVWGDSPD |
| Ga0244775_102309033 | 3300024346 | Estuarine | MAELKYFNALMNSVVGNDEERKTAKEYLAEVDPEVWGDSPD |
| Ga0208009_100083214 | 3300027114 | Deep Subsurface | MAELNYFNALINSVVGDQDQKKAAKEYLAEIDPDIWGQEE |
| Ga0209651_10416572 | 3300027581 | Freshwater Lake | MAELNYFNALMNSVLGNPDQVKAAKEYLAEVDPDIWGQEE |
| Ga0208966_1000003179 | 3300027586 | Freshwater Lentic | MAELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQEE |
| Ga0208966_11094432 | 3300027586 | Freshwater Lentic | MAELKYLNALLASVVGTPDQAKAAKEYLAEVDPDIWG |
| Ga0255122_10744652 | 3300027595 | Freshwater | MAELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWGQE |
| Ga0208974_10208813 | 3300027608 | Freshwater Lentic | MAELKYFNALINSVIGDHDQKKAAKEYLAEIDPDIWGQEE |
| Ga0208942_11981642 | 3300027627 | Freshwater Lentic | MAELKYFNALINSVIGDPDQVKAAKEYLAEVDPDIWGQEE |
| Ga0209135_12144502 | 3300027642 | Freshwater Lake | MAELKYFNALINSVVGDHDQKKAAKEYLAEVDPDIWGQEE |
| Ga0209551_11990622 | 3300027689 | Freshwater Lake | MAELKYFNALMNSVIGDHDQKKAAKEYLAEVDPDIWGQEE |
| Ga0209599_1000095616 | 3300027710 | Deep Subsurface | MAELKYFNALINSVVGNDEEKKAAKEYLAELDPEIWGE |
| Ga0209599_100860242 | 3300027710 | Deep Subsurface | MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE |
| Ga0209617_102672953 | 3300027720 | Freshwater And Sediment | GEIKMAELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWGQEE |
| Ga0209596_10581656 | 3300027754 | Freshwater Lake | MAELNYFNALMNSVMGNPDQVKAAKEYLAEVDPEIWGQEE |
| Ga0209444_102785793 | 3300027756 | Freshwater Lake | LKYFNALMDSVLGNPDQVKAAKEYLAEVDPDIWGQEE |
| Ga0209296_10976612 | 3300027759 | Freshwater Lake | MVDLKYFNSLMLLVTGDEAEKKAAKEYLAEVDPDIWDQKK |
| Ga0209296_11438602 | 3300027759 | Freshwater Lake | MTELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQEE |
| Ga0209770_100428211 | 3300027769 | Freshwater Lake | MAELKYFNALINSVVGNDEEKKAAKEYLAELDPEIWSE |
| Ga0209972_100450991 | 3300027793 | Freshwater Lake | LKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA |
| Ga0209229_100267673 | 3300027805 | Freshwater And Sediment | MAELKYLNALLASVVGTPDQAKAAKEYLAEVDPEVWGDSPD |
| Ga0209990_103438081 | 3300027816 | Freshwater Lake | MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIW |
| Ga0247723_10230356 | 3300028025 | Deep Subsurface Sediment | MAELNYFNALMNSVLGNPDQVKAAKEYLAEIDPDIWGQEE |
| Ga0315907_100730875 | 3300031758 | Freshwater | MAELKYFNSLMNLVLGDPDQKKAAEEYLAEVDPDIWGQEE |
| Ga0315907_107747031 | 3300031758 | Freshwater | KKMADLKYFNALINSVVGNDEERKAAKEYLAEVDPETWSE |
| Ga0315899_110239472 | 3300031784 | Freshwater | MADLKYFNALMATVLGSDQEKAEAKKYLAEVDPEIWSESKE |
| Ga0315899_110248041 | 3300031784 | Freshwater | KMADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA |
| Ga0315900_106665292 | 3300031787 | Freshwater | MADLKYFNALMNSVVGDDEQRKAAKEYLAEVDPEVWGDSPD |
| Ga0315900_110932212 | 3300031787 | Freshwater | MAELKYFNALMNSVVGNDEERKAAKEYLAEVDPEVWGDSPD |
| Ga0315909_101454051 | 3300031857 | Freshwater | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPETWSE |
| Ga0315909_109708922 | 3300031857 | Freshwater | MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEEL |
| Ga0315904_108009453 | 3300031951 | Freshwater | KYFNALINSVVGNDEERKAAKEYLAEVDPEIWGDSPD |
| Ga0315901_110053152 | 3300031963 | Freshwater | MTEIKYLNELINSVVGDENQKKSAKEYLAEVDPDIWSD |
| Ga0315906_108761661 | 3300032050 | Freshwater | MADLKYFNSLMLLVTGDESEKKAAKEYLAEVDPDIWDQEK |
| Ga0315906_111031181 | 3300032050 | Freshwater | NKMADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE |
| Ga0334981_0397748_391_516 | 3300033980 | Freshwater | MADLKYFNALMATVLGSDQEKSEAKKYLAEVDPEIWSESKE |
| Ga0335002_0253871_2_112 | 3300034020 | Freshwater | MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWS |
| Ga0335019_0202278_1172_1282 | 3300034066 | Freshwater | DLKYFNALINSVVGNDEERKAAKEYLAEVDPETWSE |
| Ga0335010_0090706_915_1031 | 3300034092 | Freshwater | MANLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE |
| ⦗Top⦘ |