Metagenome / Metatranscriptome Family F049621

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F049621
Family Type	Metagenome / Metatranscriptome
Number of Sequences	146
Average Sequence Length	40 residues
Representative Sequence	MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEEL
Number of Associated Samples	95
Number of Associated Scaffolds	146

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Viruses
% of genes with valid RBS motifs	75.17 %
% of genes near scaffold ends (potentially truncated)	24.66 %
% of genes from short scaffolds (< 2000 bps)	78.77 %
Associated GOLD sequencing projects	87
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.63

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Duplodnaviria (52.055 % of family members)
NCBI Taxonomy ID	2731341
Taxonomy	All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.178 % of family members)
Environment Ontology (ENVO)	Unclassified (52.740 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (65.753 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 51.47% β-sheet: 0.00% Coil/Unstructured: 48.53%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.63
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.63
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 146 Family Scaffolds
PF06067	DUF932	9.59
PF01521	Fe-S_biosyn	0.68
PF05257	CHAP	0.68

COG ID	Name	Functional Category	% Frequency in 146 Family Scaffolds
COG0316	Fe-S cluster assembly iron-binding protein IscA	Posttranslational modification, protein turnover, chaperones [O]	0.68
COG4841	Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF family	Function unknown [S]	0.68

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	67.81 %
Unclassified	root	N/A	32.19 %

Name	Rank	Taxonomy	Distribution
Viruses	superkingdom	All Organisms → Viruses	65.75 %
Unclassified	root	N/A	32.19 %
cellular organisms	root	All Organisms → cellular organisms	2.05 %

Name	Rank	Taxonomy	Distribution
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	52.05 %
Unclassified	root	N/A	32.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.70 %
Archaea	superkingdom	All Organisms → cellular organisms → Archaea	1.37 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	52.05 %
Unclassified	root	N/A	32.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.70 %
unclassified Archaea	no rank	All Organisms → cellular organisms → Archaea → unclassified Archaea	0.68 %
Euryarchaeota	phylum	All Organisms → cellular organisms → Archaea → Euryarchaeota	0.68 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	52.05 %
Unclassified	root	N/A	32.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.70 %
unclassified Euryarchaeota	no rank	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota	0.68 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.68 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	52.05 %
Unclassified	root	N/A	32.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.70 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.68 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.68 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.68 %

Name	Rank	Taxonomy	Distribution
unclassified Caudoviricetes	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes	47.95 %
Unclassified	root	N/A	32.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.70 %
Caudovirales	order	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	1.37 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.68 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.68 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.68 %

Name	Rank	Taxonomy	Distribution
Freshwater phage uvFW-CGR-AMD-COM-C403	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	47.95 %
Unclassified	root	N/A	32.19 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	13.70 %
Siphoviridae	family	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	1.37 %
Euryarchaeota archaeon	species	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	0.68 %
archaeon	species	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	0.68 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.68 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300000736\|JGI12547J11936_1075334	Not Available	635	Open in IMG/M
3300000736\|JGI12547J11936_1086634	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	577	Open in IMG/M
3300000756\|JGI12421J11937_10054685	All Organisms → Viruses → Predicted Viral	1274	Open in IMG/M
3300000756\|JGI12421J11937_10145907	Not Available	590	Open in IMG/M
3300002161\|JGI24766J26685_10004283	All Organisms → Viruses → Predicted Viral	4128	Open in IMG/M
3300002161\|JGI24766J26685_10027160	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1389	Open in IMG/M
3300002835\|B570J40625_100404573	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1324	Open in IMG/M
3300002835\|B570J40625_101598492	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	532	Open in IMG/M
3300003277\|JGI25908J49247_10038458	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1307	Open in IMG/M
3300003277\|JGI25908J49247_10151413	Not Available	541	Open in IMG/M
3300003388\|JGI25910J50241_10017080	All Organisms → cellular organisms → Bacteria	2566	Open in IMG/M
3300004240\|Ga0007787_10474800	Not Available	625	Open in IMG/M
3300005517\|Ga0070374_10093539	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1566	Open in IMG/M
3300005517\|Ga0070374_10286757	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	837	Open in IMG/M
3300005517\|Ga0070374_10358923	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	735	Open in IMG/M
3300005525\|Ga0068877_10263819	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1007	Open in IMG/M
3300005525\|Ga0068877_10753186	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	518	Open in IMG/M
3300005528\|Ga0068872_10488511	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	662	Open in IMG/M
3300005582\|Ga0049080_10102213	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	974	Open in IMG/M
3300005583\|Ga0049085_10316667	Not Available	506	Open in IMG/M
3300005584\|Ga0049082_10168651	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	755	Open in IMG/M
3300005662\|Ga0078894_10255411	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1589	Open in IMG/M
3300005662\|Ga0078894_10755291	Not Available	854	Open in IMG/M
3300005662\|Ga0078894_10827093	Not Available	808	Open in IMG/M
3300005662\|Ga0078894_10887466	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	774	Open in IMG/M
3300005662\|Ga0078894_11112644	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	674	Open in IMG/M
3300005662\|Ga0078894_11270607	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	620	Open in IMG/M
3300005805\|Ga0079957_1099641	Not Available	1587	Open in IMG/M
3300006484\|Ga0070744_10049435	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1234	Open in IMG/M
3300006484\|Ga0070744_10178515	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	606	Open in IMG/M
3300006639\|Ga0079301_1003973	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	6214	Open in IMG/M
3300006639\|Ga0079301_1005843	All Organisms → Viruses → Predicted Viral	4969	Open in IMG/M
3300007162\|Ga0079300_10017030	All Organisms → Viruses → Predicted Viral	2639	Open in IMG/M
3300007622\|Ga0102863_1166210	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	649	Open in IMG/M
3300007653\|Ga0102868_1100120	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	662	Open in IMG/M
3300008055\|Ga0108970_11803497	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	674	Open in IMG/M
3300008107\|Ga0114340_1007603	Not Available	5573	Open in IMG/M
3300008107\|Ga0114340_1026467	Not Available	4466	Open in IMG/M
3300008107\|Ga0114340_1039498	All Organisms → Viruses → Predicted Viral	2118	Open in IMG/M
3300008107\|Ga0114340_1043668	All Organisms → Viruses → Predicted Viral	1991	Open in IMG/M
3300008107\|Ga0114340_1047869	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1884	Open in IMG/M
3300008107\|Ga0114340_1117397	Not Available	1036	Open in IMG/M
3300008107\|Ga0114340_1243470	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	556	Open in IMG/M
3300008113\|Ga0114346_1289332	Not Available	574	Open in IMG/M
3300008114\|Ga0114347_1090753	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1203	Open in IMG/M
3300008114\|Ga0114347_1092605	All Organisms → Viruses → Predicted Viral	1186	Open in IMG/M
3300008116\|Ga0114350_1014107	Not Available	5174	Open in IMG/M
3300008116\|Ga0114350_1159194	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	616	Open in IMG/M
3300008117\|Ga0114351_1095097	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1749	Open in IMG/M
3300008261\|Ga0114336_1075162	All Organisms → Viruses → Predicted Viral	1656	Open in IMG/M
3300008261\|Ga0114336_1164334	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	970	Open in IMG/M
3300008264\|Ga0114353_1143887	Not Available	1208	Open in IMG/M
3300008450\|Ga0114880_1213570	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	635	Open in IMG/M
3300008962\|Ga0104242_1012418	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1495	Open in IMG/M
3300008962\|Ga0104242_1023720	All Organisms → Viruses → Predicted Viral	1057	Open in IMG/M
3300008996\|Ga0102831_1280925	Not Available	549	Open in IMG/M
3300009051\|Ga0102864_1204233	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	539	Open in IMG/M
3300009056\|Ga0102860_1095417	Not Available	824	Open in IMG/M
3300009158\|Ga0114977_10732425	Not Available	524	Open in IMG/M
3300009164\|Ga0114975_10272139	Not Available	943	Open in IMG/M
3300009183\|Ga0114974_10030940	All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	3699	Open in IMG/M
3300009183\|Ga0114974_10347344	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	861	Open in IMG/M
3300009419\|Ga0114982_1004002	Not Available	5911	Open in IMG/M
3300009419\|Ga0114982_1062930	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1161	Open in IMG/M
3300010156\|Ga0068873_1024063	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	621	Open in IMG/M
3300010354\|Ga0129333_11315201	Not Available	597	Open in IMG/M
3300012779\|Ga0138284_1289399	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	541	Open in IMG/M
3300013004\|Ga0164293_10010392	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	7815	Open in IMG/M
3300013004\|Ga0164293_10553966	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	752	Open in IMG/M
3300013005\|Ga0164292_10654694	Not Available	674	Open in IMG/M
3300013087\|Ga0163212_1074011	Not Available	1115	Open in IMG/M
(restricted) 3300013126\|Ga0172367_10086259	Not Available	2263	Open in IMG/M
3300014960\|Ga0134316_1029639	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	617	Open in IMG/M
3300017788\|Ga0169931_10891352	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	561	Open in IMG/M
3300019146\|Ga0188881_10008760	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1236	Open in IMG/M
3300019784\|Ga0181359_1169684	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	731	Open in IMG/M
3300020048\|Ga0207193_1260628	All Organisms → Viruses → Predicted Viral	1295	Open in IMG/M
3300020083\|Ga0194111_10278409	Not Available	1164	Open in IMG/M
3300020141\|Ga0211732_1088158	All Organisms → Viruses → Predicted Viral	1035	Open in IMG/M
3300020151\|Ga0211736_10608586	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	502	Open in IMG/M
3300020151\|Ga0211736_10844874	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	666	Open in IMG/M
3300020161\|Ga0211726_10145120	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	970	Open in IMG/M
3300020161\|Ga0211726_10747792	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1256	Open in IMG/M
3300020205\|Ga0211731_11396195	Not Available	663	Open in IMG/M
3300020221\|Ga0194127_10170489	All Organisms → Viruses → Predicted Viral	1548	Open in IMG/M
3300020498\|Ga0208050_1014271	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	861	Open in IMG/M
3300020519\|Ga0208223_1034727	Not Available	628	Open in IMG/M
3300020527\|Ga0208232_1031745	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	717	Open in IMG/M
3300021140\|Ga0214168_1021691	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1771	Open in IMG/M
3300021961\|Ga0222714_10068454	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	2363	Open in IMG/M
3300021961\|Ga0222714_10191837	Not Available	1187	Open in IMG/M
3300021961\|Ga0222714_10261734	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	965	Open in IMG/M
3300021962\|Ga0222713_10018899	Not Available	5843	Open in IMG/M
3300021962\|Ga0222713_10045543	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	3395	Open in IMG/M
3300021962\|Ga0222713_10074566	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	2496	Open in IMG/M
3300021962\|Ga0222713_10319316	Not Available	982	Open in IMG/M
3300021962\|Ga0222713_10391596	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	858	Open in IMG/M
3300021963\|Ga0222712_10093208	All Organisms → Viruses → Predicted Viral	2124	Open in IMG/M
3300021963\|Ga0222712_10252993	Not Available	1126	Open in IMG/M
3300021963\|Ga0222712_10403918	Not Available	829	Open in IMG/M
3300022407\|Ga0181351_1062979	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1520	Open in IMG/M
3300022752\|Ga0214917_10006315	Not Available	12346	Open in IMG/M
3300022752\|Ga0214917_10414742	All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	549	Open in IMG/M
3300022752\|Ga0214917_10463855	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	501	Open in IMG/M
3300023174\|Ga0214921_10001139	Not Available	46199	Open in IMG/M
3300024346\|Ga0244775_10101962	Not Available	2440	Open in IMG/M
3300024346\|Ga0244775_10167741	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1849	Open in IMG/M
3300024346\|Ga0244775_10230903	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1545	Open in IMG/M
3300027114\|Ga0208009_1000832	Not Available	8783	Open in IMG/M
3300027581\|Ga0209651_1041657	All Organisms → Viruses → Predicted Viral	1387	Open in IMG/M
3300027586\|Ga0208966_1000003	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	113953	Open in IMG/M
3300027586\|Ga0208966_1109443	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	753	Open in IMG/M
3300027595\|Ga0255122_1074465	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	565	Open in IMG/M
3300027608\|Ga0208974_1020881	All Organisms → Viruses → Predicted Viral	2034	Open in IMG/M
3300027627\|Ga0208942_1198164	Not Available	516	Open in IMG/M
3300027642\|Ga0209135_1214450	Not Available	587	Open in IMG/M
3300027689\|Ga0209551_1199062	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	614	Open in IMG/M
3300027710\|Ga0209599_10000956	Not Available	15440	Open in IMG/M
3300027710\|Ga0209599_10086024	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	826	Open in IMG/M
3300027720\|Ga0209617_10267295	Not Available	645	Open in IMG/M
3300027754\|Ga0209596_1058165	All Organisms → Viruses → Predicted Viral	1981	Open in IMG/M
3300027756\|Ga0209444_10278579	Not Available	570	Open in IMG/M
3300027759\|Ga0209296_1097661	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae	1409	Open in IMG/M
3300027759\|Ga0209296_1143860	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1080	Open in IMG/M
3300027769\|Ga0209770_10042821	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1940	Open in IMG/M
3300027793\|Ga0209972_10045099	Not Available	2438	Open in IMG/M
3300027805\|Ga0209229_10026767	All Organisms → Viruses → Predicted Viral	2511	Open in IMG/M
3300027816\|Ga0209990_10343808	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	659	Open in IMG/M
3300028025\|Ga0247723_1023035	All Organisms → Viruses → Predicted Viral	2065	Open in IMG/M
3300031758\|Ga0315907_10073087	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	2969	Open in IMG/M
3300031758\|Ga0315907_10774703	Not Available	719	Open in IMG/M
3300031784\|Ga0315899_11023947	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	732	Open in IMG/M
3300031784\|Ga0315899_11024804	Not Available	731	Open in IMG/M
3300031787\|Ga0315900_10666529	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	745	Open in IMG/M
3300031787\|Ga0315900_11093221	Not Available	514	Open in IMG/M
3300031857\|Ga0315909_10145405	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1962	Open in IMG/M
3300031857\|Ga0315909_10970892	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	516	Open in IMG/M
3300031951\|Ga0315904_10800945	Not Available	775	Open in IMG/M
3300031963\|Ga0315901_11005315	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	582	Open in IMG/M
3300032050\|Ga0315906_10876166	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	692	Open in IMG/M
3300032050\|Ga0315906_11103118	Not Available	585	Open in IMG/M
3300033980\|Ga0334981_0397748	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	590	Open in IMG/M
3300034020\|Ga0335002_0253871	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403	1054	Open in IMG/M
3300034066\|Ga0335019_0202278	All Organisms → Viruses → Predicted Viral	1284	Open in IMG/M
3300034092\|Ga0335010_0090706	All Organisms → Viruses → Predicted Viral	2061	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	99.32%
Host-Associated	Host-Associated	0.68%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	93.15%
Terrestrial	Environmental → Terrestrial	6.16%
Plants	Host-Associated → Plants	0.68%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	78.08%
Marine	Environmental → Aquatic → Marine	15.07%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	6.16%
Leaf	Host-Associated → Plants → Leaf	0.68%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	34.93%
Lentic	Environmental → Aquatic → Freshwater → Lentic	33.56%
Unclassified	Environmental → Aquatic → Marine → Unclassified	10.96%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	8.22%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	6.16%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	3.42%
Groundwater	Environmental → Aquatic → Freshwater → Groundwater	0.68%
River	Environmental → Aquatic → Freshwater → River	0.68%
Coastal	Environmental → Aquatic → Marine → Coastal	0.68%
Unclassified	Host-Associated → Plants → Leaf → Unclassified	0.68%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	34.25%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	26.03%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	10.96%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	8.22%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	6.16%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	6.16%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	3.42%
Hypolimnion	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion	1.37%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	0.68%
Unclassified	Environmental → Aquatic → Freshwater → Groundwater → Unclassified	0.68%
Unclassified	Environmental → Aquatic → Freshwater → River → Unclassified	0.68%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	0.68%
Unclassified	Host-Associated → Plants → Leaf → Unclassified → Unclassified	0.68%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	19.18%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	10.96%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	9.59%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	8.22%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	7.53%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	5.48%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.48%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	5.48%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	4.79%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	4.11%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	3.42%
Estuarine	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine	3.42%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment	2.05%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment	2.05%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	2.05%
Freshwater And Sediment	Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment	1.37%
Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake	0.68%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment	0.68%
Surface Water	Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water	0.68%
Freshwater	Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater	0.68%
Freshwater To Marine Saline Gradient	Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient	0.68%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	0.68%
Estuary	Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary	0.68%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300000736	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011	Environmental	Open in IMG/M
3300000756	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011	Environmental	Open in IMG/M
3300002161	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003277	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD	Environmental	Open in IMG/M
3300003388	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN	Environmental	Open in IMG/M
3300004240	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005525	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG	Environmental	Open in IMG/M
3300005528	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG	Environmental	Open in IMG/M
3300005582	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF	Environmental	Open in IMG/M
3300005583	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300005662	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)	Environmental	Open in IMG/M
3300005805	Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA	Environmental	Open in IMG/M
3300006484	Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300007162	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11	Environmental	Open in IMG/M
3300007622	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02	Environmental	Open in IMG/M
3300007653	Estuarine microbial communities from the Columbia River estuary - metaG 1546C-3	Environmental	Open in IMG/M
3300008055	Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393	Host-Associated	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008113	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008117	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA	Environmental	Open in IMG/M
3300008261	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA	Environmental	Open in IMG/M
3300008264	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR	Environmental	Open in IMG/M
3300008450	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs	Environmental	Open in IMG/M
3300008962	Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5	Environmental	Open in IMG/M
3300008996	Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747	Environmental	Open in IMG/M
3300009051	Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02	Environmental	Open in IMG/M
3300009056	Estuarine microbial communities from the Columbia River estuary - metaG 1449A-3	Environmental	Open in IMG/M
3300009158	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG	Environmental	Open in IMG/M
3300009164	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009419	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT	Environmental	Open in IMG/M
3300010156	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaG	Environmental	Open in IMG/M
3300010354	Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA	Environmental	Open in IMG/M
3300012779	Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300013004	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG	Environmental	Open in IMG/M
3300013005	Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG	Environmental	Open in IMG/M
3300013087	Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L	Environmental	Open in IMG/M
3300013126 (restricted)	Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m	Environmental	Open in IMG/M
3300014960	Surface water microbial communities from Bangladesh - BaraHaldiaSW0709	Environmental	Open in IMG/M
3300017788	Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L	Environmental	Open in IMG/M
3300019146	Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020048	Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915	Environmental	Open in IMG/M
3300020083	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m	Environmental	Open in IMG/M
3300020141	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1	Environmental	Open in IMG/M
3300020151	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020205	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1	Environmental	Open in IMG/M
3300020221	Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100m	Environmental	Open in IMG/M
3300020498	Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020519	Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300020527	Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300021140	Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion	Environmental	Open in IMG/M
3300021961	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D	Environmental	Open in IMG/M
3300021962	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023174	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505	Environmental	Open in IMG/M
3300024346	Whole water sample coassembly	Environmental	Open in IMG/M
3300027114	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)	Environmental	Open in IMG/M
3300027581	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes)	Environmental	Open in IMG/M
3300027586	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)	Environmental	Open in IMG/M
3300027595	Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Colum_RepC_8h	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027627	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes)	Environmental	Open in IMG/M
3300027642	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (SPAdes)	Environmental	Open in IMG/M
3300027689	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027710	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)	Environmental	Open in IMG/M
3300027720	Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027756	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027769	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes)	Environmental	Open in IMG/M
3300027793	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300027805	Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)	Environmental	Open in IMG/M
3300027816	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300031963	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116	Environmental	Open in IMG/M
3300032050	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122	Environmental	Open in IMG/M
3300033980	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007	Environmental	Open in IMG/M
3300034020	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055	Environmental	Open in IMG/M
3300034066	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI12547J11936_10753341	3300000736	Freshwater And Sediment	MAELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWGQEE*
JGI12547J11936_10866342	3300000736	Freshwater And Sediment	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE*
JGI12421J11937_100546854	3300000756	Freshwater And Sediment	MTELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWGQEE*
JGI12421J11937_101459071	3300000756	Freshwater And Sediment	ELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWGQEE*
JGI24766J26685_100042834	3300002161	Freshwater And Sediment	MAELKYFNALINSVVGNDEEKKAAKEYLAEVDPEIWSE*
JGI24766J26685_100271603	3300002161	Freshwater And Sediment	MAELKYLNALLASVVGTPDQAKAAKEYLAEVDPEVWGDSPD*
B570J40625_1004045732	3300002835	Freshwater	MADLKYFNALMNSVMGNPDQAKAAKEYLAEVDPDIWGQEE*
B570J40625_1015984922	3300002835	Freshwater	MAELKYFNALINSVVGNDEERKTAKEYLAEVDPEVWGDSLD*
JGI25908J49247_100384583	3300003277	Freshwater Lake	MAELKYFNALMNSVIGDHDQKKAAKEYLAEVDPDIWGQEE*
JGI25908J49247_101514133	3300003277	Freshwater Lake	MAELKYFNALMDSVLGNPDQVKAAKEYLAEVDPDIWGQEE*
JGI25910J50241_100170804	3300003388	Freshwater Lake	MAELKYFNALMNSVLGNPDQVKAAKEYLAEVDPDIWGQEE*
Ga0007787_104748002	3300004240	Freshwater Lake	MADLKYFNSLMLLVTGDEAEKKAAKEYLAEVDPDIWDQQK*
Ga0070374_100935393	3300005517	Freshwater Lake	MAELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQEE*
Ga0070374_102867572	3300005517	Freshwater Lake	MAELNYFNALMNSVLGNPDQVKAAKEYLAEVDPDIWGQEE*
Ga0070374_103589232	3300005517	Freshwater Lake	MAELKYFNALINSVVGDQDQKKAAKEYLAEIDPDIWGQEE*
Ga0068877_102638192	3300005525	Freshwater Lake	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA*
Ga0068877_107531862	3300005525	Freshwater Lake	MAELKYFNALINSVVGNDDQKKAAKEYLAEVDPEIWGESPD*
Ga0068872_104885112	3300005528	Freshwater Lake	MEYFNALMATVMGTEDQKKAAKEYLAEVDPEIWGQEE*
Ga0049080_101022131	3300005582	Freshwater Lentic	MAELKYFNALINSVIGDHDQKKAAKEYLAEIDPDIWGQEE*
Ga0049085_103166673	3300005583	Freshwater Lentic	MAELKYFNALINSVIGDPDQVKAAKEYLAEVDPDIWGQEE*
Ga0049082_101686512	3300005584	Freshwater Lentic	MAELKYLNALLASVVGTPDQAKAAKEYLAEVDPDIWGQEE*
Ga0078894_102554111	3300005662	Freshwater Lake	MAELKYFNALINSVVGNDDQKKAAKEYLAEVDPEVWGDSSD*
Ga0078894_107552913	3300005662	Freshwater Lake	RRNKMAELKYFNALINSVVGNDEEKKAAKEYLAELDPEIWGE*
Ga0078894_108270933	3300005662	Freshwater Lake	NKMADLKYFNALINSVVGNDEERKAAKEYLAEVDPETWSE*
Ga0078894_108874661	3300005662	Freshwater Lake	MADLKYFNALMNSVVGNDEERKTAKEYLAEVDPEVWGDSPD*
Ga0078894_111126442	3300005662	Freshwater Lake	MAELKFFNALINSVVGNDEEKKSAKEYLAEVDPEVWGDSPD*
Ga0078894_112706072	3300005662	Freshwater Lake	MAELNYFNALMNSVMGNPDQVKTAKEYLAEVDPEVWGDSPD*
Ga0078894_114929762	3300005662	Freshwater Lake	YFNALMATVMGTDDQRKAAIEYLKEKDPDIWGQEE*
Ga0079957_10996411	3300005805	Lake	YFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA*
Ga0070744_100494352	3300006484	Estuarine	MAELKFFNALMNSVVGNDEEKKIAKEYLAEVDPEVWGDSPD*
Ga0070744_101785152	3300006484	Estuarine	MAELKYFNALMNSVVGNDEERKTAKEYLAEVDPEVWGDSPD*
Ga0079301_100397320	3300006639	Deep Subsurface	MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA*
Ga0079301_10058439	3300006639	Deep Subsurface	MAELNYFNALINSVVGDQDQKKAAKEYLAEIDPDIWGQEE*
Ga0079300_100170302	3300007162	Deep Subsurface	MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE*
Ga0102863_11662102	3300007622	Estuarine	MAELKYFNALIDSVLGNPDQVKAAKEYLAEVDPDIWGQEE*
Ga0102868_11001202	3300007653	Estuarine	MAELKYFNALMNSVIGNDEERKAAKEYLAEVDPEIWSESKE*
Ga0108970_118034972	3300008055	Estuary	MAELKYFNALMNSVIGNDEERKAAKEYLAEVDPEIWNESKE*
Ga0114340_10076034	3300008107	Freshwater, Plankton	MADLKYFNALMNSVVGDDEQRKAAKEYLAEVDPEVWGDSPD*
Ga0114340_10264677	3300008107	Freshwater, Plankton	MTEIKYLNELINSVVGDENQKKSAKEYLAEVDPDIWSD*
Ga0114340_10394981	3300008107	Freshwater, Plankton	MAELKYFNALMNSVVGNDEERKAAKEYLAEVDPEVWGDSPD*
Ga0114340_10436681	3300008107	Freshwater, Plankton	MAELKYFNALMNSVVGNDEEKKAAKEYLAEVDPEVWGDSPD*
Ga0114340_10478693	3300008107	Freshwater, Plankton	MAELKYFNALMNSVIGNDQERKAAKEYLAEVDPEIWSESKE*
Ga0114340_11173973	3300008107	Freshwater, Plankton	MADLKYFNALMATVLGSDQEKAEAKKYLAEVDPEIWSESKE*
Ga0114340_12434702	3300008107	Freshwater, Plankton	MTEIKYLNELINSIVGDENQKKSAKEYLAEVDPDIWSD*
Ga0114346_12893321	3300008113	Freshwater, Plankton	FNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA*
Ga0114347_10907532	3300008114	Freshwater, Plankton	MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWGDSPD*
Ga0114347_10926054	3300008114	Freshwater, Plankton	ADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA*
Ga0114350_10141075	3300008116	Freshwater, Plankton	MAELKYFNSLMNLVLGDPDQKKAAEEYLAEVDPDIWGQEE*
Ga0114350_11591941	3300008116	Freshwater, Plankton	MADLKYFNSLMLLVTGDESEKKAAKEYLAEVDPDIWDQEK*
Ga0114351_10950972	3300008117	Freshwater, Plankton	MADLKYFNSLMLLVTGDESEKKAAKEYLAEVDPDIWAQEK*
Ga0114336_10751625	3300008261	Freshwater, Plankton	MAELKYLNALLASVVGTPDQVKAAKEYLAEVDPDIWGQEE*
Ga0114336_11643342	3300008261	Freshwater, Plankton	MADLKYFNALINSVVGNDEQRKAAKEYLAEVDPEIWSEELQA*
Ga0114353_11438874	3300008264	Freshwater, Plankton	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPETWSE*
Ga0114880_12135701	3300008450	Freshwater Lake	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIW
Ga0104242_10124183	3300008962	Freshwater	MAELKYFNALIATVLGTEEQAAEAKKYLAEVDPEIWREDSE*
Ga0104242_10237202	3300008962	Freshwater	MPLGYMNALIASVTGDEHSAKLAKEYLAEVDPEVWKESSD*
Ga0102831_12809251	3300008996	Estuarine	MAELKYFNALINSVVGSDDQKKAAKEYLAEVDPDVWGDSPD*
Ga0102864_12042331	3300009051	Estuarine	MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEVWGDSPD*
Ga0102860_10954172	3300009056	Estuarine	MAELKYFNALINSVVGDPDQKKAAKEYLAEVDPDIWGQEE*
Ga0114977_107324252	3300009158	Freshwater Lake	MAELNYFNALMNSVMGNPDQLKAAKEYLAEVDHDIWGQEE*
Ga0114975_102721394	3300009164	Freshwater Lake	MAELKYFNALINSVIGAHDQKKAAKEYLAEIDPDIWGQEE*
Ga0114974_100309402	3300009183	Freshwater Lake	MVDLKYFNSLMLLVTGDEAEKKAAKEYLAEVDPDIWDQKK*
Ga0114974_103473442	3300009183	Freshwater Lake	MTELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQEE*
Ga0114982_10040023	3300009419	Deep Subsurface	MAELKYFNALINSVVGNDEEKKAAKEYLAELDPEIWGE*
Ga0114982_10629302	3300009419	Deep Subsurface	MAELKYFNALINSVVGNDEERKTAKEYLAEVDPEVWGDSSD*
Ga0068873_10240632	3300010156	Freshwater Lake	MAELKYFNALINSVVGNDEEKKAAKEYLAEVDPEIWGDSPD*
Ga0129333_113152011	3300010354	Freshwater To Marine Saline Gradient	YFNALINSVVGNDEERKAAKEYLAEVDPEIWGDSPD*
Ga0138284_12893992	3300012779	Freshwater Lake	MAELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQGGPC*
Ga0164293_1001039220	3300013004	Freshwater	MADLKYFNSLMLLVTGDEAEKKAAKEYLAEVDPDIWDQEK*
Ga0164293_105539662	3300013004	Freshwater	MADLKYFNALMATVLGSDQEKSEAKKYLAEVDPEIWSESKE*
Ga0164292_106546941	3300013005	Freshwater	LKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE*
Ga0163212_10740114	3300013087	Freshwater	MTDLKYFNALMATVLGSDEQKDEAKKYLAEVDPEIWGENSE*
(restricted) Ga0172367_100862594	3300013126	Freshwater	MAELKYFNALMATVLGSDEQKDEAKKYLAEVDPEIWGEDSE*
Ga0134316_10296392	3300014960	Surface Water	MAELKYFNALMATVLGNDEEREEAKKYLAEVDPEIWDEES*
Ga0169931_108913522	3300017788	Freshwater	MTELKYFNALMATVLGSDEQKNEAKKYLAEVDPEIWGEDSE
Ga0188881_100087604	3300019146	Freshwater Lake	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA
Ga0181359_11696841	3300019784	Freshwater Lake	MAELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWG
Ga0207193_12606283	3300020048	Freshwater Lake Sediment	MAELKYFNALMNSVVGNDEERKTAKEYLAEVDPEVWGDSSD
Ga0194111_102784094	3300020083	Freshwater Lake	MTDLKYFNALMATVLGSDEQKDEAKKYLAEVDPEIWGENSE
Ga0211732_10881583	3300020141	Freshwater	MAELNYFNALMNSVLGDPDQVKAAKEYLAEVDPDIWGQEE
Ga0211736_106085861	3300020151	Freshwater	MAELKYFNALMNSVLGNPDQVKAAKEYLAEVDPDIWGQEE
Ga0211736_108448742	3300020151	Freshwater	MADLKYFNALINSVVGNDEEKKAAKEYLAEVDPEIWSE
Ga0211726_101451202	3300020161	Freshwater	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEDLQA
Ga0211726_107477923	3300020161	Freshwater	MADLKYFNCLMLLVTGDESEKKAAKEYLAEVDPDIWGQEK
Ga0211731_113961953	3300020205	Freshwater	FNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA
Ga0194127_101704894	3300020221	Freshwater Lake	MTDLFYFNALMATVLGSDEQKDEAKKYLAEVDPEIWGENSE
Ga0208050_10142712	3300020498	Freshwater	MADLKYFNALMNSVVGNDEQRKAAKEYLAEVDPEIWSEELQA
Ga0208223_10347271	3300020519	Freshwater	KMADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE
Ga0208232_10317451	3300020527	Freshwater	MADLKYFNALMNSVVGNDEQRKAAKEYLAEVDPDIWGQEE
Ga0214168_10216915	3300021140	Freshwater	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEDLQS
Ga0222714_100684547	3300021961	Estuarine Water	MAELKYFNALINSVVGNDDQKKAAKEYLAEVDPEIWGDSPD
Ga0222714_101918371	3300021961	Estuarine Water	NALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA
Ga0222714_102617342	3300021961	Estuarine Water	MSELKYFNALMATVIGTDQEAAEAKKYLAEVDPEIWGEDSE
Ga0222713_100188997	3300021962	Estuarine Water	MAELKYFNALMNSVIGNDEERKAAKEYLAEVDPEIWSESKE
Ga0222713_1004554311	3300021962	Estuarine Water	MAELKYFNALMNSVIGNDEERKAAKEYLAEVDPEVWGDSPD
Ga0222713_100745668	3300021962	Estuarine Water	MSELKYFNALMATVIGTDQEAAEAKKYLAEVDPEIWGE
Ga0222713_103193161	3300021962	Estuarine Water	LKYFNALINSVVGNDEERKAAKEYLAEVDPEIWNE
Ga0222713_103915962	3300021962	Estuarine Water	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQ
Ga0222712_100932081	3300021963	Estuarine Water	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWNE
Ga0222712_102529935	3300021963	Estuarine Water	EIKMAELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQEE
Ga0222712_104039184	3300021963	Estuarine Water	KMAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWGDSPD
Ga0181351_10629792	3300022407	Freshwater Lake	MAELKYFNALMDSVLGNPDQVKAAKEYLAEVDPDIWGQEE
Ga0214917_1000631520	3300022752	Freshwater	MAELKYFNALIATVLGTEEQAAEAKKYLAEVDPEIWREDSE
Ga0214917_104147421	3300022752	Freshwater	NEEIKMAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWGDSPD
Ga0214917_104638551	3300022752	Freshwater	MADLKYFNALMSTVLGNDDQRKAAKEYLAEVDPEIWGEDSE
Ga0214921_1000113934	3300023174	Freshwater	MADLKFYNSLMLLITGDESEKKAAKEYLAEVDPDIWGQEE
Ga0244775_101019622	3300024346	Estuarine	MAELKFFNALINSVVGNDEERKAAKEYLAEKDPEVWGDSPD
Ga0244775_101677411	3300024346	Estuarine	MAELKFFNALMNSVVGNDEEKKIAKEYLAEVDPEVWGDSPD
Ga0244775_102309033	3300024346	Estuarine	MAELKYFNALMNSVVGNDEERKTAKEYLAEVDPEVWGDSPD
Ga0208009_100083214	3300027114	Deep Subsurface	MAELNYFNALINSVVGDQDQKKAAKEYLAEIDPDIWGQEE
Ga0209651_10416572	3300027581	Freshwater Lake	MAELNYFNALMNSVLGNPDQVKAAKEYLAEVDPDIWGQEE
Ga0208966_1000003179	3300027586	Freshwater Lentic	MAELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQEE
Ga0208966_11094432	3300027586	Freshwater Lentic	MAELKYLNALLASVVGTPDQAKAAKEYLAEVDPDIWG
Ga0255122_10744652	3300027595	Freshwater	MAELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWGQE
Ga0208974_10208813	3300027608	Freshwater Lentic	MAELKYFNALINSVIGDHDQKKAAKEYLAEIDPDIWGQEE
Ga0208942_11981642	3300027627	Freshwater Lentic	MAELKYFNALINSVIGDPDQVKAAKEYLAEVDPDIWGQEE
Ga0209135_12144502	3300027642	Freshwater Lake	MAELKYFNALINSVVGDHDQKKAAKEYLAEVDPDIWGQEE
Ga0209551_11990622	3300027689	Freshwater Lake	MAELKYFNALMNSVIGDHDQKKAAKEYLAEVDPDIWGQEE
Ga0209599_1000095616	3300027710	Deep Subsurface	MAELKYFNALINSVVGNDEEKKAAKEYLAELDPEIWGE
Ga0209599_100860242	3300027710	Deep Subsurface	MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE
Ga0209617_102672953	3300027720	Freshwater And Sediment	GEIKMAELNYFNALMNSVMGNPDQVKAAKEYLAEVDPDIWGQEE
Ga0209596_10581656	3300027754	Freshwater Lake	MAELNYFNALMNSVMGNPDQVKAAKEYLAEVDPEIWGQEE
Ga0209444_102785793	3300027756	Freshwater Lake	LKYFNALMDSVLGNPDQVKAAKEYLAEVDPDIWGQEE
Ga0209296_10976612	3300027759	Freshwater Lake	MVDLKYFNSLMLLVTGDEAEKKAAKEYLAEVDPDIWDQKK
Ga0209296_11438602	3300027759	Freshwater Lake	MTELKYFNALINSVIGDHDQKKAAKEYLAEVDPDIWGQEE
Ga0209770_100428211	3300027769	Freshwater Lake	MAELKYFNALINSVVGNDEEKKAAKEYLAELDPEIWSE
Ga0209972_100450991	3300027793	Freshwater Lake	LKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA
Ga0209229_100267673	3300027805	Freshwater And Sediment	MAELKYLNALLASVVGTPDQAKAAKEYLAEVDPEVWGDSPD
Ga0209990_103438081	3300027816	Freshwater Lake	MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIW
Ga0247723_10230356	3300028025	Deep Subsurface Sediment	MAELNYFNALMNSVLGNPDQVKAAKEYLAEIDPDIWGQEE
Ga0315907_100730875	3300031758	Freshwater	MAELKYFNSLMNLVLGDPDQKKAAEEYLAEVDPDIWGQEE
Ga0315907_107747031	3300031758	Freshwater	KKMADLKYFNALINSVVGNDEERKAAKEYLAEVDPETWSE
Ga0315899_110239472	3300031784	Freshwater	MADLKYFNALMATVLGSDQEKAEAKKYLAEVDPEIWSESKE
Ga0315899_110248041	3300031784	Freshwater	KMADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEELQA
Ga0315900_106665292	3300031787	Freshwater	MADLKYFNALMNSVVGDDEQRKAAKEYLAEVDPEVWGDSPD
Ga0315900_110932212	3300031787	Freshwater	MAELKYFNALMNSVVGNDEERKAAKEYLAEVDPEVWGDSPD
Ga0315909_101454051	3300031857	Freshwater	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPETWSE
Ga0315909_109708922	3300031857	Freshwater	MAELKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSEEL
Ga0315904_108009453	3300031951	Freshwater	KYFNALINSVVGNDEERKAAKEYLAEVDPEIWGDSPD
Ga0315901_110053152	3300031963	Freshwater	MTEIKYLNELINSVVGDENQKKSAKEYLAEVDPDIWSD
Ga0315906_108761661	3300032050	Freshwater	MADLKYFNSLMLLVTGDESEKKAAKEYLAEVDPDIWDQEK
Ga0315906_111031181	3300032050	Freshwater	NKMADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE
Ga0334981_0397748_391_516	3300033980	Freshwater	MADLKYFNALMATVLGSDQEKSEAKKYLAEVDPEIWSESKE
Ga0335002_0253871_2_112	3300034020	Freshwater	MADLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWS
Ga0335019_0202278_1172_1282	3300034066	Freshwater	DLKYFNALINSVVGNDEERKAAKEYLAEVDPETWSE
Ga0335010_0090706_915_1031	3300034092	Freshwater	MANLKYFNALINSVVGNDEERKAAKEYLAEVDPEIWSE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters