NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049605

Metagenome / Metatranscriptome Family F049605

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049605
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 50 residues
Representative Sequence IQSFGRQSLFAFPIFWAIAEGPRWLRYPPLAVLGFAANLGLVLLLTRFAP
Number of Associated Samples 122
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.68 %
% of genes near scaffold ends (potentially truncated) 97.95 %
% of genes from short scaffolds (< 2000 bps) 93.15 %
Associated GOLD sequencing projects 118
AlphaFold2 3D model prediction Yes
3D model pTM-score0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (60.959 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(27.397 % of family members)
Environment Ontology (ENVO) Unclassified
(32.877 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(52.740 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.00%    β-sheet: 0.00%    Coil/Unstructured: 50.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.48
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF01370Epimerase 52.74
PF11706zf-CGNR 14.38
PF00330Aconitase 8.90
PF03631Virul_fac_BrkB 5.48
PF00160Pro_isomerase 3.42
PF00528BPD_transp_1 2.74
PF16363GDP_Man_Dehyd 2.05
PF11026DUF2721 0.68
PF13460NAD_binding_10 0.68
PF13950Obsolete Pfam Family 0.68
PF05572Peptidase_M43 0.68
PF13011LZ_Tnp_IS481 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 5.48
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 3.42


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms60.96 %
UnclassifiedrootN/A39.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig45863All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium 68-20521Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_11118292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1106Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104716738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300000956|JGI10216J12902_100453866Not Available712Open in IMG/M
3300000956|JGI10216J12902_101342270Not Available709Open in IMG/M
3300000956|JGI10216J12902_102300120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria501Open in IMG/M
3300000956|JGI10216J12902_110850227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium891Open in IMG/M
3300000956|JGI10216J12902_111043615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium602Open in IMG/M
3300000956|JGI10216J12902_125915722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria530Open in IMG/M
3300001475|JGI12361J15250_1007908Not Available589Open in IMG/M
3300002568|C688J35102_118473827Not Available563Open in IMG/M
3300004081|Ga0063454_100071050All Organisms → cellular organisms → Bacteria → Proteobacteria1511Open in IMG/M
3300004081|Ga0063454_101425706Not Available588Open in IMG/M
3300004114|Ga0062593_100777750Not Available948Open in IMG/M
3300004114|Ga0062593_101501593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria726Open in IMG/M
3300004156|Ga0062589_100597220Not Available957Open in IMG/M
3300004479|Ga0062595_100366209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1013Open in IMG/M
3300004479|Ga0062595_101923030Not Available568Open in IMG/M
3300004643|Ga0062591_100318708All Organisms → cellular organisms → Bacteria1236Open in IMG/M
3300005093|Ga0062594_100536349All Organisms → cellular organisms → Bacteria1003Open in IMG/M
3300005172|Ga0066683_10392686Not Available858Open in IMG/M
3300005175|Ga0066673_10907177Not Available501Open in IMG/M
3300005181|Ga0066678_11134596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria502Open in IMG/M
3300005329|Ga0070683_101096450Not Available765Open in IMG/M
3300005335|Ga0070666_11301807Not Available542Open in IMG/M
3300005337|Ga0070682_100069525All Organisms → cellular organisms → Bacteria2248Open in IMG/M
3300005337|Ga0070682_100371973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1072Open in IMG/M
3300005338|Ga0068868_100918280Not Available797Open in IMG/M
3300005338|Ga0068868_101851521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300005438|Ga0070701_10242347All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1085Open in IMG/M
3300005439|Ga0070711_101291664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300005444|Ga0070694_101009145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300005444|Ga0070694_101253388Not Available622Open in IMG/M
3300005445|Ga0070708_100759521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria912Open in IMG/M
3300005451|Ga0066681_10395824All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300005459|Ga0068867_100240071All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1469Open in IMG/M
3300005468|Ga0070707_100609949Not Available1054Open in IMG/M
3300005545|Ga0070695_100819199Not Available747Open in IMG/M
3300005546|Ga0070696_101193930All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300005547|Ga0070693_100568744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300005560|Ga0066670_10396964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Pleomorphomonadaceae → Methylobrevis → Methylobrevis pamukkalensis845Open in IMG/M
3300005614|Ga0068856_100857500All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium927Open in IMG/M
3300005886|Ga0075286_1057140Not Available556Open in IMG/M
3300005983|Ga0081540_1352060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300006034|Ga0066656_10920585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300006049|Ga0075417_10104459All Organisms → cellular organisms → Bacteria1288Open in IMG/M
3300006577|Ga0074050_12061252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1136Open in IMG/M
3300006581|Ga0074048_13336266Not Available735Open in IMG/M
3300006794|Ga0066658_10197151Not Available1062Open in IMG/M
3300006852|Ga0075433_11527591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria576Open in IMG/M
3300006854|Ga0075425_102155104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300006871|Ga0075434_101331624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300006881|Ga0068865_100149299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1771Open in IMG/M
3300006914|Ga0075436_100580006Not Available825Open in IMG/M
3300007076|Ga0075435_101320508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria632Open in IMG/M
3300009090|Ga0099827_11180444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300009092|Ga0105250_10205310Not Available832Open in IMG/M
3300009094|Ga0111539_10068942All Organisms → cellular organisms → Bacteria4176Open in IMG/M
3300009137|Ga0066709_102179478Not Available764Open in IMG/M
3300009137|Ga0066709_102550193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300009174|Ga0105241_10153628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1885Open in IMG/M
3300009177|Ga0105248_11178338Not Available866Open in IMG/M
3300010038|Ga0126315_10052699All Organisms → cellular organisms → Bacteria2214Open in IMG/M
3300010041|Ga0126312_10239839All Organisms → cellular organisms → Bacteria1272Open in IMG/M
3300010045|Ga0126311_11071718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria662Open in IMG/M
3300010047|Ga0126382_10078205All Organisms → cellular organisms → Bacteria2057Open in IMG/M
3300010322|Ga0134084_10466876Not Available506Open in IMG/M
3300010362|Ga0126377_11096220Not Available865Open in IMG/M
3300012198|Ga0137364_10326597All Organisms → cellular organisms → Bacteria1142Open in IMG/M
3300012207|Ga0137381_11451830Not Available578Open in IMG/M
3300012211|Ga0137377_11164909Not Available701Open in IMG/M
3300012349|Ga0137387_10432787All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300012356|Ga0137371_10219590All Organisms → cellular organisms → Bacteria1486Open in IMG/M
3300012895|Ga0157309_10226981Not Available598Open in IMG/M
3300012958|Ga0164299_11073170Not Available599Open in IMG/M
3300012960|Ga0164301_11119210All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300012961|Ga0164302_10199567All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300012985|Ga0164308_10392418All Organisms → cellular organisms → Bacteria1132Open in IMG/M
3300012986|Ga0164304_11686284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria529Open in IMG/M
3300012989|Ga0164305_10794491Not Available784Open in IMG/M
3300014157|Ga0134078_10418829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300014497|Ga0182008_10839926Not Available536Open in IMG/M
3300015372|Ga0132256_100247103All Organisms → cellular organisms → Bacteria1851Open in IMG/M
3300015374|Ga0132255_100839887All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300018027|Ga0184605_10024355All Organisms → cellular organisms → Bacteria2454Open in IMG/M
3300018027|Ga0184605_10131826All Organisms → cellular organisms → Bacteria1117Open in IMG/M
3300019886|Ga0193727_1021133All Organisms → cellular organisms → Bacteria2330Open in IMG/M
3300019890|Ga0193728_1102398All Organisms → cellular organisms → Bacteria1322Open in IMG/M
3300020006|Ga0193735_1086813Not Available888Open in IMG/M
3300020006|Ga0193735_1143716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria627Open in IMG/M
3300021080|Ga0210382_10092366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1252Open in IMG/M
3300021415|Ga0193694_1029821Not Available764Open in IMG/M
3300023071|Ga0247752_1004780All Organisms → cellular organisms → Bacteria1785Open in IMG/M
3300024246|Ga0247680_1037013Not Available706Open in IMG/M
3300025907|Ga0207645_10978515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria573Open in IMG/M
3300025921|Ga0207652_11863469Not Available507Open in IMG/M
3300025922|Ga0207646_10820758Not Available827Open in IMG/M
3300025927|Ga0207687_10040312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3201Open in IMG/M
3300025931|Ga0207644_10132912All Organisms → cellular organisms → Bacteria1907Open in IMG/M
3300025932|Ga0207690_10314469Not Available1229Open in IMG/M
3300025934|Ga0207686_10089435All Organisms → cellular organisms → Bacteria2029Open in IMG/M
3300025934|Ga0207686_11494984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300025938|Ga0207704_10097304Not Available1951Open in IMG/M
3300025944|Ga0207661_10273898All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300026343|Ga0209159_1047592All Organisms → cellular organisms → Bacteria2137Open in IMG/M
3300026827|Ga0207591_102588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria772Open in IMG/M
3300026867|Ga0207475_1006392All Organisms → cellular organisms → Bacteria → Proteobacteria714Open in IMG/M
3300027821|Ga0209811_10033863All Organisms → cellular organisms → Bacteria1708Open in IMG/M
3300028380|Ga0268265_10225594All Organisms → cellular organisms → Bacteria1643Open in IMG/M
3300028380|Ga0268265_10543397Not Available1102Open in IMG/M
3300028381|Ga0268264_10773630All Organisms → cellular organisms → Bacteria958Open in IMG/M
3300028704|Ga0307321_1025846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1050Open in IMG/M
3300028708|Ga0307295_10075134Not Available892Open in IMG/M
3300028710|Ga0307322_10019523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1555Open in IMG/M
3300028711|Ga0307293_10293935Not Available515Open in IMG/M
3300028714|Ga0307309_10143018Not Available600Open in IMG/M
3300028719|Ga0307301_10270969Not Available555Open in IMG/M
3300028744|Ga0307318_10112836Not Available923Open in IMG/M
3300028755|Ga0307316_10036520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1621Open in IMG/M
3300028755|Ga0307316_10216341All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300028771|Ga0307320_10246047Not Available704Open in IMG/M
3300028771|Ga0307320_10442360Not Available523Open in IMG/M
3300028778|Ga0307288_10470179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria518Open in IMG/M
3300028782|Ga0307306_10175255All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria606Open in IMG/M
3300028793|Ga0307299_10357713Not Available547Open in IMG/M
3300028796|Ga0307287_10058134All Organisms → cellular organisms → Bacteria1431Open in IMG/M
3300028799|Ga0307284_10230413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria733Open in IMG/M
3300028807|Ga0307305_10417838Not Available605Open in IMG/M
3300028807|Ga0307305_10551454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300028810|Ga0307294_10019665All Organisms → cellular organisms → Bacteria1766Open in IMG/M
3300028811|Ga0307292_10290254Not Available684Open in IMG/M
3300028814|Ga0307302_10041799All Organisms → cellular organisms → Bacteria2124Open in IMG/M
3300028814|Ga0307302_10227538Not Available912Open in IMG/M
3300028828|Ga0307312_10682175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300028875|Ga0307289_10130471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1031Open in IMG/M
3300028875|Ga0307289_10241285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300028878|Ga0307278_10208236Not Available871Open in IMG/M
3300028881|Ga0307277_10083556All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300030336|Ga0247826_10503452Not Available915Open in IMG/M
3300030336|Ga0247826_11233266Not Available601Open in IMG/M
3300030511|Ga0268241_10106761Not Available654Open in IMG/M
3300030511|Ga0268241_10191268Not Available516Open in IMG/M
3300031184|Ga0307499_10221646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300031547|Ga0310887_10685361Not Available635Open in IMG/M
3300031547|Ga0310887_10797543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300032205|Ga0307472_101887320Not Available596Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil27.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.27%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil6.16%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.79%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.11%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.74%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.74%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.74%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil2.05%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.05%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.05%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.37%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.37%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.37%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.37%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.68%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.68%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.68%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.68%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.68%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.68%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.68%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.68%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001475Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN102EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005886Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205EnvironmentalOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012895Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021415Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024246Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026827Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes)EnvironmentalOpen in IMG/M
3300026867Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030511Bulk soil microbial communities from Mexico - Amatitan (Am) metaG (v2)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_021739902124908016LFWAVADGPRWLRSIPLAALGFAANIGLLLLLTRFAP
ICChiseqgaiiFebDRAFT_1111829223300000363SoilPIFWAIADGPRVLRSPVLAGLGFAANLALVLLLTRFAP*
INPhiseqgaiiFebDRAFT_10471673813300000364SoilAYTTVVVVVLLLSGTIVSFGRQSVFAFPIFWAIADGPRALRSPALAALGLTANLALVLLLTRLIP*
JGI10216J12902_10045386623300000956SoilQSLFAFPIFWAIADGPRWLRSAPLAVLGFAANIGLVLLLTHFAP*
JGI10216J12902_10134227013300000956SoilLFAFPIFWAIADGPRWLRSPPLAVLGFAANIGLVLLLTHFAP*
JGI10216J12902_10230012023300000956SoilIFWAIGEGPSWLRSRPLLALGFAANLGLALLLTRFAP*
JGI10216J12902_11085022713300000956SoilQSLFAFPIFWAIADGPRVFRWPVLAALGLAANLALVVLLTRFAP*
JGI10216J12902_11104361523300000956SoilRQSLFAFPIFWAIADGPRVLRSPVLAGLGFAANLALVLLLTRFAP*
JGI10216J12902_12591572213300000956SoilGRQSLYAFPIFWAIGEGPPWLRSRPLLALGFFANLGIALLLMRFAP*
JGI12361J15250_100790823300001475SoilGRQSLYAFPIFWAIADGPRWLRYPPFAVLGFASNLALVLLLTHFAP*
C688J35102_11847382723300002568SoilIQSFGRQSLFAFPIFWAIADGPRWLRWRPLAALGFAGNLALVLLLTHFAP*
Ga0063454_10007105013300004081SoilAFPIFWAIADGPRWLRYPPFAVLGFASNLALVLLLTHFAP*
Ga0063454_10142570613300004081SoilLFAFPIFWAIADGPRWLRWRPLAALGFAGNLALVLLLTHFAP*
Ga0062593_10077775023300004114SoilLFAFPIFWAIADGPRWLRSPFLAVAGFAGNVVLVLLLTHFAP*
Ga0062593_10150159313300004114SoilLSGTIQSFGRQSLFAFPIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP*
Ga0062589_10059722023300004156SoilTMQSFGRQSLFAFPIFWAIADGPRWLRSPFLAVAGFAGNVVLVLLLTHFAP*
Ga0062595_10036620923300004479SoilSGTIQSFGRQSLFAFPIFWAIADGPRVLRSPVLAGLGFAANLALVVLLTRFAP*
Ga0062595_10192303013300004479SoilRQSLFAFPIFWAIADGPRWLRSPPLAALGFAGNIVLVLLLTHFAP*
Ga0062591_10031870823300004643SoilRQSLFAFPIFWAIADGPRWLRWPPLAVAGFAGNLALALLLTHFAP*
Ga0062594_10053634923300005093SoilFAFPIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP*
Ga0066683_1039268623300005172SoilLYAFPIFWAIGEGPAWLRRRELAALGFAANLGLALLLTRFAP*
Ga0066673_1090717723300005175SoilRQSLYAFPIFWAIGEGPSWLRSRPLLALGFAANLGLALLLTRFAP*
Ga0066678_1113459623300005181SoilGSGLMQSFGRQSLYAFPIFWAIGEGPAWLRSRPLLALGFAVNLGLALLLTRFAP*
Ga0070683_10109645023300005329Corn RhizosphereGRQSLFAFPIFWAIADGPGWLRWPPLAVAGFAGNLALAVLLTHFAP*
Ga0070666_1130180713300005335Switchgrass RhizosphereAFSTIVVALLIFSGTIQSFGRQSLFAFPIFWAVADGPRWLRAPPLAVLGFAGNIVLALLLTHFAP*
Ga0070682_10006952533300005337Corn RhizosphereFATVVIATLLLSGTMQSFGRQSLFAFPIFWAIADGPRWLRSPFLAVAGFAGNVVLVLLLTHFAP*
Ga0070682_10037197323300005337Corn RhizosphereQSLFAFPIFWAIADGPRWLRSPVLAVAGFAGNVALVLLLTRFAP*
Ga0068868_10091828023300005338Miscanthus RhizosphereLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRSPPLAVLGFSGNIVLVLLLTHFAP*
Ga0068868_10185152123300005338Miscanthus RhizosphereGTIQSFGRQSLFAFPIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP*
Ga0070701_1024234713300005438Corn, Switchgrass And Miscanthus RhizosphereLLIFSGTIQSFGRQSLFAFPIFWAVADGPRWLRAQPLAVLGFAGNIVLALLLTHFAP*
Ga0070711_10129166413300005439Corn, Switchgrass And Miscanthus RhizosphereTMQSFGRQSLFAFPIFWAIADGPRWLRYPPLAALGLVANLGLALLLTRYAP*
Ga0070694_10100914523300005444Corn, Switchgrass And Miscanthus RhizosphereQSLFAFPIFWAIADGPRWLRYPPVAALGFVANLGLALLLTRYAP*
Ga0070694_10125338813300005444Corn, Switchgrass And Miscanthus RhizosphereLLLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRSPPLAVLGFSGNIVLVLLLTHFAP*
Ga0070708_10075952133300005445Corn, Switchgrass And Miscanthus RhizosphereGTIQSFGRQSLFAFPIFWAIGEGPAWLRRPPLAVLGFAANLGLALLLTRFAP*
Ga0066681_1039582413300005451SoilAFPIFWAIGEGPSWLRSRPLLALGFAANLGLALLLTRFAP*
Ga0068867_10024007113300005459Miscanthus RhizosphereGTIQSFGRQSLFAFPIFWAIADGPRWLRWPPLAVVGFAGNLALALLLTHFAP*
Ga0070707_10060994913300005468Corn, Switchgrass And Miscanthus RhizosphereTVESFGRQSLFAFPIFWAIGEGPAWLRRPPLAVLGFAANLGLALLLTRFAP*
Ga0070695_10081919923300005545Corn, Switchgrass And Miscanthus RhizosphereFPIFWALGEGPAWLRKPPLAALGFAANLGLALLITRFAP*
Ga0070696_10119393013300005546Corn, Switchgrass And Miscanthus RhizosphereVVLALLASGLMHSFGRQSLYAFPIFWALGEGPAWLRKPPFAALGFAANLGLALLITRFAP
Ga0070693_10056874423300005547Corn, Switchgrass And Miscanthus RhizosphereQSLFAFPIFWAIADGPRWLRYPPLAALGLVANLGLALLLTRYAP*
Ga0066670_1039696423300005560SoilFAFPIFWALGEGPTWLRRPPLAVLGFAANLALALLLTRFAP*
Ga0068856_10085750023300005614Corn RhizosphereAFATVVVASLLVSGTMQSFGRQSLFAFPIFWAIADGPRWLRSPVLAVAGFAGNVALVLLLTRFAP*
Ga0075286_105714023300005886Rice Paddy SoilLLSGTIQSFGRQSLYAFPIFWAIADGPRWLRWPPLAVLGFAGNLALVLLLTHFAP*
Ga0081540_135206023300005983Tabebuia Heterophylla RhizosphereLLFSGTIQGFGRQTLFAFPIFWAIADGPRWLRSPPLAALGFAGNVVLVLLLTHFAP*
Ga0066656_1092058523300006034SoilFWAIGEGPAWLRSKPLLALGFAANLGLALLLTRFAP*
Ga0075417_1010445913300006049Populus RhizosphereQSFGRQSLFAFPIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP*
Ga0074050_1206125233300006577SoilLLGSGLMHSFGRQSLFAFPIFWALGEGPAWLRRPPLAAAGFVANLGIALLLTRFAP*
Ga0074048_1333626613300006581SoilLMHSFGRQSLFAFPIFWALGEGPAWLRRPPLAAAGFVANLGIALLLTRFAP*
Ga0066658_1019715113300006794SoilLMQSFGRQSLYAFPIFWALGEGPAWLRRPPLAILGFAANLGIALLLTRFAP*
Ga0075433_1152759113300006852Populus RhizosphereLFAFPIFWAIADGPRWLRYPPLALLGFAANLGLALMLTRFAP*
Ga0075425_10215510423300006854Populus RhizosphereQSLFAFPIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP*
Ga0075434_10133162413300006871Populus RhizosphereQSFGRQSLFAFPIFWALADGPRWLRYPPLAVLGFAANLGLALMLTRFAP*
Ga0068865_10014929913300006881Miscanthus RhizosphereFPIFWAIADGPRWLRSPPLAVLGFSGNIVLVLLLTHFAP*
Ga0075436_10058000613300006914Populus RhizosphereAFPIFWAIGEGPSWLRKPPLLALGFAANLGLALLITRFAP*
Ga0075435_10132050823300007076Populus RhizosphereLLLSGTMQSFGRQSLFAFPIFWAIADGPRWLRYPPLAVLGFAANLGLALMLTRFAP*
Ga0099827_1118044423300009090Vadose Zone SoilFAFPIFWALGEGPAWLRKPPIAALGFAANLGLALLLTRFAP*
Ga0105250_1020531023300009092Switchgrass RhizosphereFAFPIFWAIADGPRWLRSTPLAVLGFSGNIVLVLLLTHFAP*
Ga0111539_1006894213300009094Populus RhizosphereWAAYSTVVVVLLILSGTIQSFGRQSLFAFPIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP*
Ga0066709_10217947813300009137Grasslands SoilSFGRQSLYAFPIFWALGEGPTWLRRPPLLALGFAANLGIALLLTRFAP*
Ga0066709_10255019323300009137Grasslands SoilQSFGRQSLYAFPIFWAIGEGPAWLRSRPLLALGFAVNLGLALLLTRFAP*
Ga0105241_1015362833300009174Corn RhizosphereFAFPIFWAIADGPRWLRWPPLAVVGFAGNLALALLLTHFAP*
Ga0105248_1117833813300009177Switchgrass RhizosphereLFAFPIFWAIADGPRWLRSPPLAVLGFSGNIVLVLLLTHFAP*
Ga0126315_1005269933300010038Serpentine SoilVVVLLLLSGTIQSFGRQSLFAFPIFWAVADGPRVLRSPVLAALGFAANLALVLLLTRFAP
Ga0126312_1023983923300010041Serpentine SoilVVVVLLLLSGTIQSFGRQSLFAFPIFWAVADGPRVLRSPVLAALGFAANLALVLLLTRFAP*
Ga0126311_1107171823300010045Serpentine SoilFGRQSLFAFPIFWAIADGPRWLRYPPLAALGFAANLALALLLTRYAP*
Ga0126382_1007820533300010047Tropical Forest SoilVVVLLILSGTIQSFGRQSLFAFPIFWAVADGPRVLRSPVLAGLGFAANLTLVLLLTRFAP
Ga0134084_1046687623300010322Grasslands SoilLYAFPIFWAIGEGPSWLRSRPLLALGFAANLGLALLLTRFAP*
Ga0126377_1109622023300010362Tropical Forest SoilAVADGPRVLRSPVLAGLGFAANLTLVLLLTRFAP*
Ga0137364_1032659713300012198Vadose Zone SoilIFWAIGEGPTWLRSRPLLALGFAANLGLALLLTRFAP*
Ga0137381_1145183013300012207Vadose Zone SoilPIFWALGEGPAWLRKPPIAALGFAANLGLALLLTRFAP*
Ga0137377_1116490913300012211Vadose Zone SoilPIFWAIGEGPAWLRRWPLALLGFAANLALALLLTSFAP*
Ga0137387_1043278723300012349Vadose Zone SoilWAIGEGPAWLRKRPLAALGFAANLALALLLTRFAP*
Ga0137371_1021959013300012356Vadose Zone SoilSLFAFPIFWAIGEGPPWLRKRPLAALGFAANLALALLLTRFAP*
Ga0157309_1022698123300012895SoilSLYAFPIFWAIGEGPRWLRWPPLLALGFAANLALVLLLTRFAP*
Ga0164299_1107317023300012958SoilVVVALLLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRWPPLAVLGFAGNIALVLLLTHFAP*
Ga0164301_1111921013300012960SoilQSFGRQSLFAFPIFWAIADGPRWLRSPFLAVAGFAGNVVLVLLLTHFAP*
Ga0164302_1019956723300012961SoilSTVVVALLLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRWPPLAVLGFAGNIALVLLLTHFAP*
Ga0164308_1039241823300012985SoilFWAIADGPRWLRSPPLAALGFAGNIVLVLLLTHFAP*
Ga0164304_1168628423300012986SoilVVGLLLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRWPPLAVLGFAGNIALVLLLTHFAP
Ga0164305_1079449123300012989SoilFSTVVVALLLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRWPPLAVLGFAGNIALVLLLTHFAP*
Ga0134078_1041882923300014157Grasslands SoilLGSGLMQSFGRQSLYAFPIFWAIGEGPSWLRSRPLLALGFAANLGLALLLTRFAP*
Ga0182008_1083992613300014497RhizosphereLLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRWPPLAVAGFAGNLALALLLTHFAP*
Ga0132256_10024710313300015372Arabidopsis RhizosphereIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP*
Ga0132255_10083988713300015374Arabidopsis RhizosphereVGLLLLSGTIQSFGRQSLFAFPIFWAIADGPRVLRSPVLAALGFAANLALVLLLTRFAP*
Ga0184605_1002435543300018027Groundwater SedimentQSLFAFPIFWAIAEGPRWLRYPPLAVLGFAANLGLVLLLTRFAP
Ga0184605_1013182623300018027Groundwater SedimentFAFPVFWAIADGPRWLRYPPLAVLGFAANIGLVLLLTRFAP
Ga0193727_102113313300019886SoilFWAIADGPRWLRWPPLAVLGFAGNIVLVLLLTHFAP
Ga0193728_110239823300019890SoilGRQSLFAFPVFWAIADGPRWLRYPPLAVLGFAANIGLVLLLTRFAP
Ga0193735_108681323300020006SoilMQSFGRQSLYAFPIFWAIGEGPAWLRRPPLLALGFAANLAIALLLTRFAP
Ga0193735_114371623300020006SoilVGLLLFSGTMQSFGRQSLFAFPIFWAIAEGPRWLRYPPLAVLGFAANLGLVLLLTRFAP
Ga0210382_1009236613300021080Groundwater SedimentSGTMQSFGRQSLFAFPIFWAIADGPRWLRYPPLAVLGFAANLGLALLLTRYAP
Ga0193694_102982123300021415SoilRQSLFAFPIFWAIADGPRWLRSPPFAVLGFAGNIVLVLLLTHFAP
Ga0247752_100478013300023071SoilVLLILSGTIQSFGRQSLFAFPIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP
Ga0247680_103701323300024246SoilQSFGRQSLFAFPIFWAIADGPRWLRSPFLAVAGFAGNVVLVLLLTHFAP
Ga0207645_1097851513300025907Miscanthus RhizosphereGTMQSFGRQSLFAFPIFWAIADGPRWLRYPPVAALGFVANLGLALLLTRYAP
Ga0207652_1186346913300025921Corn RhizosphereIFWAIADGPRWLRSPFLAVAGFAGNVVLVLLLTHFAP
Ga0207646_1082075813300025922Corn, Switchgrass And Miscanthus RhizosphereLASGLMHSFGRQSLYAFPIFCALGEGPAWLRKPPFAALGFAANLGLALLITRFAP
Ga0207687_1004031213300025927Miscanthus RhizosphereTAVVALLLLSGTMQSFGRQSLFAFPIFWAIADGPRWLRYPPVAALGFVANLGLALLLTRYAP
Ga0207644_1013291233300025931Switchgrass RhizosphereVESFGRQSLFAFPIFWAIADGPGWLRWPPLAVAGFAGNLALAVLLTHFAP
Ga0207690_1031446913300025932Corn RhizosphereVVGLLLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRSPPLAVLGFSGNIVLVLLLTHFAP
Ga0207686_1008943543300025934Miscanthus RhizosphereFATAVVALLLLSGTMQSFGRQSLFAFPIFWAIADGPRWLRYPPLAALGLVANLGLALLLTRYAP
Ga0207686_1149498413300025934Miscanthus RhizosphereAYSTVVVALLLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRWPPLAVVGFAGNLALALLLTHFAP
Ga0207704_1009730433300025938Miscanthus RhizosphereFPIFWAIADGPRWLRSPPLAVLGFSGNIVLVLLLTHFAP
Ga0207661_1027389813300025944Corn RhizosphereVLLISGTVESFGRQSLFAFPIFWAIADGPGWLRWPPLAVAGFAGNLALAVLLTHFAP
Ga0209159_104759213300026343SoilLIGSGLMQSFGRQSLYAFPIFWAIGEGPAWLRSKPLLALGFAANLGLALLLTRFAP
Ga0207591_10258823300026827SoilVVVLLILSGTIQSFGRQSLFAFPIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP
Ga0207475_100639223300026867SoilMTGVVVLLILSGTIQSFGRQSLFAFPIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP
Ga0209811_1003386333300027821Surface SoilSFGRQSLFAFPIFWAIADGPRWLRWPPLAVLGFAGNITLVLLLTHFAP
Ga0268265_1022559413300028380Switchgrass RhizosphereVALLLLSGTMQSFGRQSLFAFPIFWAIADGPRWLRYPPVAALGFVANLGLALLLTRYAP
Ga0268265_1054339723300028380Switchgrass RhizosphereFWAIADGPRWLRSPPLAVLGFSGNIVLVLLLTHFAP
Ga0268264_1077363013300028381Switchgrass RhizosphereFWAIADGPRWLRYPPVAALGFVANLGLALLLTRYAP
Ga0307321_102584613300028704SoilFGRQSLFAFPIFWAIAEGPRWLRYPPLAVLGFAANLGLVLLLTRFAP
Ga0307295_1007513423300028708SoilTVQSFGRQSLFAFPIFWAIADGPRWLRYPQLAVLGFAGNLALVLLLTRFAP
Ga0307322_1001952313300028710SoilLLIVSGTMQSFGRQSLFAFPIFWAIAEGPRWLRYPPLAVLGFAANLGLVLLLTRFAP
Ga0307293_1029393523300028711SoilLSGTIQSFGRQSLFAFPVFWAVADGPRWLRSAPLAALGFAANLALVLLLTRFAP
Ga0307309_1014301813300028714SoilLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRWPPLAVLGFAGNIALVLLLTHFAP
Ga0307301_1027096913300028719SoilLFSGLMQSFGRQSLFAFPIFWAIADGPRWLRYPPLAVLGFAGNLALVLLLTRFAP
Ga0307318_1011283613300028744SoilLLLSGTIQSFGRQSLFAFPVFWAIADGPRWLRYPPLAALGFAANIGLVLLLTRFAP
Ga0307316_1003652033300028755SoilALLLLSGTMQSFGRQSLFAFPIFWAIADGPRWLRYPPLAALGLVANLGLALLLTRYAP
Ga0307316_1021634123300028755SoilASGLMQSFGRQSLYAFPIFWAIGEGPAWLRRPPLLALGFAANLAIALLLTRFAP
Ga0307320_1024604723300028771SoilLLSGTIQSFGRQSLFAFPVFWAIADGPRWLRYPPLAALGFAANIGLVLLLTRFAP
Ga0307320_1044236013300028771SoilLLLFSGLMQSFGRQSLFAFPIFWAIADGPRWLRYPPLAVLGFAGNLALVLLLTRFAP
Ga0307288_1047017913300028778SoilAFATAVVGLLIVSGTMQSFGRQSLFAFPIFWAIAEGPRWLRYPPLAVLGFAANLGLVLLLTRFAP
Ga0307306_1017525523300028782SoilIQSFGRQSLFAFPIFWAIAEGPRWLRYPPLAVLGFAANLGLVLLLTRFAP
Ga0307299_1035771313300028793SoilGRQSLFAFPIFWALGEGPAWLRRPPLAVLGFAANLGLALLLTRFAP
Ga0307287_1005813413300028796SoilLSGTMQSFGRQSLFAFPIFWAIADGPRWLRYPPVAALGFVANLGLALLLTRYAP
Ga0307284_1023041323300028799SoilMQSFGRQSLFAFPIFWAIAEGPRWLRYPPLAVLGFAANLGLVLLLTRFAP
Ga0307305_1041783823300028807SoilTVVVASLLLSGTVQSFGRQSLFAFPIFWAIADGPRWLRYPPLAVLGFAGNLALVLLLTRFAP
Ga0307305_1055145413300028807SoilWAAFSTAVITLLLLSGTIQSFGRQSLFAFPIFWAVADGPRWLRSPPLAVLGFAGNIALVLLLTHFAP
Ga0307294_1001966533300028810SoilLLLSGTIQSFGRQSLFAFPIFWAIADGPRWLRWPPLAVLGFAGNIALVLLLTHFAP
Ga0307292_1029025413300028811SoilTIQSFGRQSLFAFPIFWAIADGPRWLRWPPLAVLGFAGNIALVLLLTHFAP
Ga0307302_1004179913300028814SoilATVVVASLLLSGTVQSFGRQSLFAFPIFWAIADGPRWLRYPQLAVLGFAGNLALVLLLTRFAP
Ga0307302_1022753823300028814SoilVAGLLLLSGTIQSFGRQSLFAFPVFWAIADGPRWLRYPPLAVLGFAANIGLVLLLTRFAP
Ga0307312_1068217513300028828SoilAVVALLLLSGTMQSFGRQSLFAFPIFWAIADGPRWLRYPPLAALGFVANLGLALLLTRYA
Ga0307289_1013047113300028875SoilFAFPIFWAIAEGPRWLRYPPLAVLGFAANLGLVLLLTRFAP
Ga0307289_1024128523300028875SoilQSFGRQSLFAFPIFWAVADGPRWLRSPPLAVLGFAGNIALVLLLTHFAP
Ga0307278_1020823623300028878SoilIQSFGRQSLFAFPVFWAIADGPCWLRYPPLAALGFAANIGLVLLLTRFAP
Ga0307277_1008355643300028881SoilAFATAVIALLLLSGTMQSFGRQSLFAFPIFWAIADGPRPLRHPLLAALGFAANLGLVLLLTRFAP
Ga0247826_1050345223300030336SoilIQSFGRQSLFAFPIFWAVAEGPRWLRWPPLAALGFAANLALVLLLTRFAP
Ga0247826_1123326623300030336SoilGTIQSFGRQSLFAFPIFWAIADGPRWLRSPPLAALGFAGNIVLVLLLTHFAP
Ga0268241_1010676123300030511SoilATVVVGLLLLSGTIQSFGRQSLFAFPIFWAVADGPRVFRSPVLGALGFAANLALVLVLTRFAP
Ga0268241_1019126813300030511SoilFWAIADGPRPFRSPVLAALGFSANLALVLFLTRFAP
Ga0307499_1022164613300031184SoilTMQSFGRQSLFAFPIFWAIADGPRWLRYPPLAVLGFAANLGLALLLTRYAP
Ga0310887_1068536123300031547SoilATVVIATLLLSGTMQSFGRQSLFAFPIFWAIADGPRWLRSPFLAVAGFAGNVVLVLLLTHFAP
Ga0310887_1079754313300031547SoilVVLLILSGTIQSFGRQSLFAFPIFWAVADGPRVLRSPVLAGLGFAANLALVLLLTRFAP
Ga0307472_10188732023300032205Hardwood Forest SoilQSLYAFPIFWALGEGPAWLRRPPLAALGFAANLGIALLLTRFAP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.