| Basic Information | |
|---|---|
| Family ID | F049539 |
| Family Type | Metagenome |
| Number of Sequences | 146 |
| Average Sequence Length | 40 residues |
| Representative Sequence | INRIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKAQ |
| Number of Associated Samples | 130 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.63 % |
| % of genes from short scaffolds (< 2000 bps) | 96.58 % |
| Associated GOLD sequencing projects | 127 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (42.466 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (8.219 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.616 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (35.616 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.31% β-sheet: 0.00% Coil/Unstructured: 62.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF00227 | Proteasome | 81.51 |
| PF01494 | FAD_binding_3 | 8.90 |
| PF13450 | NAD_binding_8 | 2.05 |
| PF05834 | Lycopene_cycl | 1.37 |
| PF13098 | Thioredoxin_2 | 0.68 |
| PF00535 | Glycos_transf_2 | 0.68 |
| PF13421 | Band_7_1 | 0.68 |
| PF01266 | DAO | 0.68 |
| PF00175 | NAD_binding_1 | 0.68 |
| PF13211 | DUF4019 | 0.68 |
| PF00890 | FAD_binding_2 | 0.68 |
| PF02777 | Sod_Fe_C | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG0638 | 20S proteasome, alpha and beta subunits | Posttranslational modification, protein turnover, chaperones [O] | 81.51 |
| COG3484 | Predicted proteasome-type protease | Posttranslational modification, protein turnover, chaperones [O] | 81.51 |
| COG5405 | ATP-dependent protease HslVU (ClpYQ), peptidase subunit | Posttranslational modification, protein turnover, chaperones [O] | 81.51 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 17.81 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 8.90 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 8.90 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 8.90 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.96 % |
| Unclassified | root | N/A | 39.04 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004048|Ga0055494_10052187 | Not Available | 790 | Open in IMG/M |
| 3300004067|Ga0055485_10071334 | Not Available | 834 | Open in IMG/M |
| 3300004463|Ga0063356_103245860 | Not Available | 701 | Open in IMG/M |
| 3300004782|Ga0062382_10051672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1514 | Open in IMG/M |
| 3300005172|Ga0066683_10273847 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1048 | Open in IMG/M |
| 3300005218|Ga0068996_10081988 | Not Available | 697 | Open in IMG/M |
| 3300005338|Ga0068868_100064956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2898 | Open in IMG/M |
| 3300005355|Ga0070671_100168356 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1853 | Open in IMG/M |
| 3300005456|Ga0070678_101836672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 572 | Open in IMG/M |
| 3300005539|Ga0068853_100981326 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 813 | Open in IMG/M |
| 3300005616|Ga0068852_100613985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1093 | Open in IMG/M |
| 3300005617|Ga0068859_100527875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 1275 | Open in IMG/M |
| 3300005719|Ga0068861_101085392 | Not Available | 768 | Open in IMG/M |
| 3300005841|Ga0068863_100205911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1893 | Open in IMG/M |
| 3300005843|Ga0068860_100820488 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300005879|Ga0075295_1064519 | Not Available | 512 | Open in IMG/M |
| 3300005887|Ga0075292_1052871 | Not Available | 591 | Open in IMG/M |
| 3300006056|Ga0075163_10873121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 936 | Open in IMG/M |
| 3300006755|Ga0079222_11849538 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 586 | Open in IMG/M |
| 3300006804|Ga0079221_10488435 | Not Available | 795 | Open in IMG/M |
| 3300006903|Ga0075426_10693086 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 764 | Open in IMG/M |
| 3300006954|Ga0079219_10000587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7731 | Open in IMG/M |
| 3300007258|Ga0099793_10517881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 593 | Open in IMG/M |
| 3300009137|Ga0066709_102076916 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 786 | Open in IMG/M |
| 3300009147|Ga0114129_11985440 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 704 | Open in IMG/M |
| 3300009176|Ga0105242_10901439 | Not Available | 884 | Open in IMG/M |
| 3300009177|Ga0105248_12753218 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009551|Ga0105238_11914159 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 626 | Open in IMG/M |
| 3300010051|Ga0133939_1050047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 9306 | Open in IMG/M |
| 3300010373|Ga0134128_12187668 | All Organisms → cellular organisms → Eukaryota | 609 | Open in IMG/M |
| 3300010401|Ga0134121_10781138 | Not Available | 915 | Open in IMG/M |
| 3300010401|Ga0134121_10805795 | Not Available | 903 | Open in IMG/M |
| 3300012200|Ga0137382_11228285 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012351|Ga0137386_10367162 | Not Available | 1036 | Open in IMG/M |
| 3300012680|Ga0136612_10131700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1271 | Open in IMG/M |
| 3300012957|Ga0164303_11187362 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 557 | Open in IMG/M |
| 3300012984|Ga0164309_11195216 | Not Available | 638 | Open in IMG/M |
| 3300012985|Ga0164308_11237543 | Not Available | 675 | Open in IMG/M |
| 3300013102|Ga0157371_10428530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 970 | Open in IMG/M |
| 3300013105|Ga0157369_12587911 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300013297|Ga0157378_12022533 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 626 | Open in IMG/M |
| 3300013306|Ga0163162_10432017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1449 | Open in IMG/M |
| 3300013306|Ga0163162_11765428 | Not Available | 707 | Open in IMG/M |
| 3300013306|Ga0163162_12591411 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 583 | Open in IMG/M |
| 3300014885|Ga0180063_1245568 | Not Available | 573 | Open in IMG/M |
| 3300014968|Ga0157379_10852771 | Not Available | 862 | Open in IMG/M |
| 3300014968|Ga0157379_11485827 | Not Available | 659 | Open in IMG/M |
| 3300015085|Ga0167632_1005705 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1802 | Open in IMG/M |
| 3300015373|Ga0132257_101088287 | Not Available | 1008 | Open in IMG/M |
| 3300015374|Ga0132255_103304633 | Not Available | 687 | Open in IMG/M |
| 3300015374|Ga0132255_103634198 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 656 | Open in IMG/M |
| 3300017659|Ga0134083_10550627 | Not Available | 522 | Open in IMG/M |
| 3300017961|Ga0187778_10096924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1830 | Open in IMG/M |
| 3300018074|Ga0184640_10475287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 553 | Open in IMG/M |
| 3300018481|Ga0190271_10888894 | Not Available | 1015 | Open in IMG/M |
| 3300018482|Ga0066669_10381415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1185 | Open in IMG/M |
| 3300018482|Ga0066669_10601604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 964 | Open in IMG/M |
| 3300019879|Ga0193723_1100394 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300021178|Ga0210408_10712890 | Not Available | 790 | Open in IMG/M |
| 3300021405|Ga0210387_11825611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 512 | Open in IMG/M |
| 3300021432|Ga0210384_11070902 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 709 | Open in IMG/M |
| 3300021445|Ga0182009_10314063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae | 793 | Open in IMG/M |
| 3300022214|Ga0224505_10264115 | Not Available | 654 | Open in IMG/M |
| 3300022889|Ga0247785_1013974 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 849 | Open in IMG/M |
| 3300025315|Ga0207697_10043688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1843 | Open in IMG/M |
| 3300025893|Ga0207682_10451621 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 608 | Open in IMG/M |
| 3300025911|Ga0207654_10233250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1227 | Open in IMG/M |
| 3300025913|Ga0207695_11680848 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300025919|Ga0207657_10674168 | Not Available | 804 | Open in IMG/M |
| 3300025922|Ga0207646_10860258 | Not Available | 806 | Open in IMG/M |
| 3300025925|Ga0207650_11864827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 508 | Open in IMG/M |
| 3300025931|Ga0207644_10557206 | Not Available | 949 | Open in IMG/M |
| 3300025936|Ga0207670_11662139 | Not Available | 543 | Open in IMG/M |
| 3300025936|Ga0207670_11781397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300025937|Ga0207669_10429096 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1042 | Open in IMG/M |
| 3300025945|Ga0207679_10881114 | Not Available | 818 | Open in IMG/M |
| 3300025949|Ga0207667_10834273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 917 | Open in IMG/M |
| 3300025960|Ga0207651_10015691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4412 | Open in IMG/M |
| 3300025981|Ga0207640_12080261 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300026088|Ga0207641_10331397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1446 | Open in IMG/M |
| 3300026088|Ga0207641_11135972 | Not Available | 780 | Open in IMG/M |
| 3300026089|Ga0207648_11550665 | Not Available | 623 | Open in IMG/M |
| 3300026121|Ga0207683_10792267 | Not Available | 880 | Open in IMG/M |
| 3300026294|Ga0209839_10245294 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 563 | Open in IMG/M |
| 3300026537|Ga0209157_1157141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1014 | Open in IMG/M |
| 3300027543|Ga0209999_1093528 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 583 | Open in IMG/M |
| 3300027716|Ga0209682_10051976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 994 | Open in IMG/M |
| 3300027783|Ga0209448_10051095 | Not Available | 1391 | Open in IMG/M |
| 3300027871|Ga0209397_10262396 | Not Available | 816 | Open in IMG/M |
| 3300027885|Ga0209450_10703812 | Not Available | 733 | Open in IMG/M |
| 3300027897|Ga0209254_10761951 | All Organisms → cellular organisms → Eukaryota | 660 | Open in IMG/M |
| 3300027902|Ga0209048_10911725 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 567 | Open in IMG/M |
| 3300028380|Ga0268265_10402308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1266 | Open in IMG/M |
| 3300028592|Ga0247822_10960723 | Not Available | 704 | Open in IMG/M |
| 3300028596|Ga0247821_10417586 | Not Available | 840 | Open in IMG/M |
| 3300028596|Ga0247821_10968409 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 569 | Open in IMG/M |
| 3300028741|Ga0302256_10149751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Ramlibacter → environmental samples → uncultured Ramlibacter sp. | 630 | Open in IMG/M |
| 3300028809|Ga0247824_10955181 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 539 | Open in IMG/M |
| 3300028868|Ga0302163_10061858 | Not Available | 903 | Open in IMG/M |
| 3300028869|Ga0302263_10337432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300029984|Ga0311332_10540702 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 917 | Open in IMG/M |
| 3300029999|Ga0311339_11124149 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 725 | Open in IMG/M |
| 3300030047|Ga0302286_10190232 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1037 | Open in IMG/M |
| 3300030114|Ga0311333_10582659 | Not Available | 924 | Open in IMG/M |
| 3300030114|Ga0311333_10732492 | Not Available | 826 | Open in IMG/M |
| 3300030294|Ga0311349_10888781 | Not Available | 837 | Open in IMG/M |
| 3300030294|Ga0311349_10917136 | Not Available | 823 | Open in IMG/M |
| 3300030294|Ga0311349_11135088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 730 | Open in IMG/M |
| 3300030294|Ga0311349_11691110 | Not Available | 585 | Open in IMG/M |
| 3300030838|Ga0311335_11211861 | Not Available | 542 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1115578 | Not Available | 659 | Open in IMG/M |
| 3300031707|Ga0315291_11047974 | Not Available | 682 | Open in IMG/M |
| 3300031746|Ga0315293_11300624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300031751|Ga0318494_10827563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 542 | Open in IMG/M |
| 3300031777|Ga0318543_10142107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1051 | Open in IMG/M |
| 3300031777|Ga0318543_10188308 | Not Available | 915 | Open in IMG/M |
| 3300031819|Ga0318568_10816298 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 578 | Open in IMG/M |
| 3300031820|Ga0307473_10290709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1023 | Open in IMG/M |
| 3300031824|Ga0307413_10352477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1136 | Open in IMG/M |
| 3300031873|Ga0315297_10589511 | Not Available | 934 | Open in IMG/M |
| 3300031893|Ga0318536_10671578 | Not Available | 516 | Open in IMG/M |
| 3300031903|Ga0307407_11424384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 546 | Open in IMG/M |
| 3300031954|Ga0306926_11110898 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
| 3300031954|Ga0306926_12657584 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 545 | Open in IMG/M |
| 3300031995|Ga0307409_101075504 | Not Available | 825 | Open in IMG/M |
| 3300031997|Ga0315278_11976324 | Not Available | 545 | Open in IMG/M |
| 3300032008|Ga0318562_10722958 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 572 | Open in IMG/M |
| 3300032025|Ga0318507_10407271 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 592 | Open in IMG/M |
| 3300032053|Ga0315284_11593420 | Not Available | 687 | Open in IMG/M |
| 3300032075|Ga0310890_11457751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 563 | Open in IMG/M |
| 3300032143|Ga0315292_10899344 | Not Available | 738 | Open in IMG/M |
| 3300032163|Ga0315281_10452271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1375 | Open in IMG/M |
| 3300032163|Ga0315281_11660298 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 621 | Open in IMG/M |
| 3300032177|Ga0315276_10149601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2422 | Open in IMG/M |
| 3300032205|Ga0307472_101473495 | Not Available | 663 | Open in IMG/M |
| 3300032516|Ga0315273_11140882 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300032828|Ga0335080_12410999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 501 | Open in IMG/M |
| 3300032955|Ga0335076_10683821 | Not Available | 908 | Open in IMG/M |
| 3300033004|Ga0335084_11829985 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 594 | Open in IMG/M |
| 3300033413|Ga0316603_12067732 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 538 | Open in IMG/M |
| 3300033482|Ga0316627_102754032 | Not Available | 522 | Open in IMG/M |
| 3300033521|Ga0316616_102002444 | Not Available | 767 | Open in IMG/M |
| 3300033557|Ga0316617_102343852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 552 | Open in IMG/M |
| 3300033805|Ga0314864_0171889 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 558 | Open in IMG/M |
| 3300034354|Ga0364943_0052593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1350 | Open in IMG/M |
| 3300034965|Ga0370497_0150375 | All Organisms → cellular organisms → Eukaryota | 583 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 8.22% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 6.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.85% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.42% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.74% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.74% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 2.05% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 2.05% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.05% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.05% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.05% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.05% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.05% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.05% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.05% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.37% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.37% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.37% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.37% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.37% |
| Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.68% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.68% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.68% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.68% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.68% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.68% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.68% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.68% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.68% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.68% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.68% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.68% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.68% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.68% |
| Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.68% |
| Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004048 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004782 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005879 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_301 | Environmental | Open in IMG/M |
| 3300005887 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_403 | Environmental | Open in IMG/M |
| 3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012680 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015085 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4B, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022889 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027716 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027871 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027902 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028741 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_4 | Environmental | Open in IMG/M |
| 3300028809 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48 | Environmental | Open in IMG/M |
| 3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
| 3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Host-Associated | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033805 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034965 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_04D_17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0055494_100521872 | 3300004048 | Natural And Restored Wetlands | INRIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKAQ* |
| Ga0055485_100713341 | 3300004067 | Natural And Restored Wetlands | LLNLINRIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKAQ* |
| Ga0063356_1032458601 | 3300004463 | Arabidopsis Thaliana Rhizosphere | NAITRIETLGKAVQITGATPIVRALLLLIGISPRHFVKKVD* |
| Ga0062382_100516723 | 3300004782 | Wetland Sediment | LLNTINRIEKQRRSVQIVGASPIVRALLLLIGISPRHFVKKSE* |
| Ga0066683_102738471 | 3300005172 | Soil | LNSISNTESQRKTVQIMGASPIIRALLLLIGISPRHFIKKAQ* |
| Ga0068996_100819882 | 3300005218 | Natural And Restored Wetlands | LNAINRVEAQRKAVQILGVSPIVRALLLLIGISPRHFLKKAQ* |
| Ga0068868_1000649561 | 3300005338 | Miscanthus Rhizosphere | AIGRVEQQRKAVQIMGASPIIRALLLLIGISPRHFLKKPQ* |
| Ga0070671_1001683561 | 3300005355 | Switchgrass Rhizosphere | LLNLIGRIESQHKSVQIIGASPIIRALLLLIGVSPRHFLKKAQ* |
| Ga0070678_1018366722 | 3300005456 | Miscanthus Rhizosphere | MLNTINRIEAQRKSVQISGASPIIRALLLLIGISPRHFVRKAA* |
| Ga0068853_1009813263 | 3300005539 | Corn Rhizosphere | ALFNTISRVEAQGKAVQIVGASPIVRALLLLIGISPRHFVKKGE* |
| Ga0068852_1006139851 | 3300005616 | Corn Rhizosphere | INRIEGQRKSVQISGASPIIRALLLLIGISPRHFVRKAA* |
| Ga0068859_1005278753 | 3300005617 | Switchgrass Rhizosphere | RIELQRKTVQIVGASPIIRALLLLIGVSPRHFVKKPQ* |
| Ga0068861_1010853922 | 3300005719 | Switchgrass Rhizosphere | LLNAITRIETLGKAVQITGTSPIVRALLLLIGISPRHFVKKVD* |
| Ga0068863_1002059111 | 3300005841 | Switchgrass Rhizosphere | LNLIGRIESQHKSVQIVGASPIIRALLLLIGVSPRHFVKKPQ* |
| Ga0068860_1008204881 | 3300005843 | Switchgrass Rhizosphere | ALLNLINRIESQRKAVQIVGASAIIRALLLLIGVSPRHFVKKPQ* |
| Ga0075295_10645192 | 3300005879 | Rice Paddy Soil | ITRIEAQGKAVQIAGASPIVRALLLLIGISPRHFVKKTG* |
| Ga0075292_10528711 | 3300005887 | Rice Paddy Soil | NTITRIEAQGKAVQIAGASPIVRALLLLIGISPRHFVKKTG* |
| Ga0075163_108731211 | 3300006056 | Wastewater Effluent | LLNAISRVEAQRKAVQIVGAAPIVRALLMLIGISPRHFLKKPQ* |
| Ga0079222_118495382 | 3300006755 | Agricultural Soil | ALANAISRIESQGKGVQIFGATPIVRALLLLIGISPRHFVKKTA* |
| Ga0079221_104884353 | 3300006804 | Agricultural Soil | EGQRKTVQIIGASPILRALLLLIGISPRHFVKKAA* |
| Ga0075426_106930861 | 3300006903 | Populus Rhizosphere | LLNTINRIEAQRKTVQLMGASPIIRALLLLIGISPRHFVKKAE* |
| Ga0079219_100005871 | 3300006954 | Agricultural Soil | NAITRIEGQGKAVQILGATPIVRALLLLIGISPRHFVKKAG* |
| Ga0099793_105178812 | 3300007258 | Vadose Zone Soil | RAESQRKGVQIIGASPIIRALLLLIGISPRHFVKKSQ* |
| Ga0066709_1020769162 | 3300009137 | Grasslands Soil | NAIIRAEGQRKTVQIAGATPIIRALLLLIGISPRHFIKKPQ* |
| Ga0114129_119854402 | 3300009147 | Populus Rhizosphere | LNAVIRAEGQRKTVQIAGASPIIRALLLLIGISPRHFIKKPQ* |
| Ga0105242_109014393 | 3300009176 | Miscanthus Rhizosphere | ALLNAITRIETLGKAVQITGATPIVRALLLLIGISPRHFVKKVD* |
| Ga0105248_127532182 | 3300009177 | Switchgrass Rhizosphere | LNAIDKIESQRKTVHIVGASPIIRALLLLIGISPRHFVKSSA* |
| Ga0105238_119141592 | 3300009551 | Corn Rhizosphere | LLNAITRIETLGKAVQIIGATPIVRALLLLIGISPRHFVKKAD* |
| Ga0133939_10500479 | 3300010051 | Industrial Wastewater | XRVEGQRKAVQIVGASPIIRALLLLIGISPRHFLKKPQ* |
| Ga0134128_121876681 | 3300010373 | Terrestrial Soil | ITRIEGQRKTVQIIGASPILRALLLLIGISPRHFVKKAA* |
| Ga0134121_107811381 | 3300010401 | Terrestrial Soil | NKLENQRKVVQIFGATPIICGILLLIGVPPGHFVKKPA* |
| Ga0134121_108057951 | 3300010401 | Terrestrial Soil | NAINRVEAQRKAVQFLGVSPIVRALLLLIGISPRHFLKKAQ* |
| Ga0137382_112282852 | 3300012200 | Vadose Zone Soil | IEGQRKTVQIIGASPIVRALLLLIGISPRHFVKKPA* |
| Ga0137386_103671621 | 3300012351 | Vadose Zone Soil | TESQRKTVQIAGASPIIRALLLLIGISPRHFIKTAQ* |
| Ga0136612_101317003 | 3300012680 | Polar Desert Sand | NRIEAQRKAVQVLGASPIIRALLLLIGLSPRHFVKKVG* |
| Ga0164303_111873622 | 3300012957 | Soil | AIGRIEAQGRAVQIVGATPIVRALLLLIGISPRHFVKKSE* |
| Ga0164309_111952162 | 3300012984 | Soil | AMLNTITRIESQRKSVQISGASPIIRALLLLIGISPRHFVKKSD* |
| Ga0164308_112375431 | 3300012985 | Soil | NRIESQRKAVQIIGASPIIRALLLLIGISPRHFLKRAT* |
| Ga0157371_104285301 | 3300013102 | Corn Rhizosphere | SRAETQRKSIQIVGASPIIRALLLLIGISPRHFIKKAT* |
| Ga0157369_125879112 | 3300013105 | Corn Rhizosphere | ITRIETLGKAVQITGATPIVRALLLLIGISPRHFVKKVD* |
| Ga0157378_120225331 | 3300013297 | Miscanthus Rhizosphere | IEAQRKAVQIVGVTPIIRALLLLLGVSPRHFVKKAE* |
| Ga0163162_104320173 | 3300013306 | Switchgrass Rhizosphere | NAIDKIESQRKTVHIVGASPIIRALLLLIGISPRHFVKSSA* |
| Ga0163162_117654281 | 3300013306 | Switchgrass Rhizosphere | RIESQRKAVQIVGASAIIRALLLLIGVSPRHFVKKPQ* |
| Ga0163162_125914112 | 3300013306 | Switchgrass Rhizosphere | LFNAISRVEGQGKAVQILGASPIVRALLLLIGISPRHFVKKAD* |
| Ga0180063_12455681 | 3300014885 | Soil | RVESQRKSVQIFGATPIIRALLLLIGISPRHFVKKPQ* |
| Ga0157379_108527713 | 3300014968 | Switchgrass Rhizosphere | RIELQHKSVQLVGASPIIRALLLLIGVSPRHFVKKPQ* |
| Ga0157379_114858271 | 3300014968 | Switchgrass Rhizosphere | NPINRIESQRKAVQIVGASPIIRALLLLIGISPRHFLKKLQ* |
| Ga0167632_10057051 | 3300015085 | Glacier Forefield Soil | AESQRKGVQIIGASPIIRALLLLIGISPRHFVKKSQ* |
| Ga0132257_1010882871 | 3300015373 | Arabidopsis Rhizosphere | NRIEAQRKTVQFVGASPIIRALLLLIGISPRHFVKKAQ* |
| Ga0132255_1033046331 | 3300015374 | Arabidopsis Rhizosphere | ALFNVISRVEAQGKGVQILGASPIVRALLLLIGISPRHFVKKAD* |
| Ga0132255_1036341981 | 3300015374 | Arabidopsis Rhizosphere | NLIGRIESQHKSVQIVGASPIIRALLLLIGVSPRHFVKKPQ* |
| Ga0134083_105506271 | 3300017659 | Grasslands Soil | TINRIEAQRKTVQFMGASPIIRALLLLIGISPRHFVKKAD |
| Ga0187778_100969241 | 3300017961 | Tropical Peatland | NLISRTESQHKTVQIIGASPIVRALLMLIGISPRHFIKKAE |
| Ga0184640_104752872 | 3300018074 | Groundwater Sediment | IIRAEGQRKTVQIAGASPIIRALLLLLGISPRHFIKKPQ |
| Ga0190271_108888941 | 3300018481 | Soil | NVIGRIESQHKSVQIVGASPIIRALLLLIGVSPRHFVKKPA |
| Ga0066669_103814153 | 3300018482 | Grasslands Soil | GQIVEAQRKAVQFLGVSPIVRALLLLIGISPRHFLKKAQ |
| Ga0066669_106016041 | 3300018482 | Grasslands Soil | ITRIEGQRKTVQIIGASPIVRALLLLIGISPRHFVRKAA |
| Ga0193723_11003942 | 3300019879 | Soil | AFSNAIIRAESQRKGVQIIGASPIIRALLLLIGISPRHFVKKAQ |
| Ga0210408_107128902 | 3300021178 | Soil | NAIVRAESQRKGVQIIGASPIIRALLLLIGISPRHFVKKSQ |
| Ga0210387_118256111 | 3300021405 | Soil | ALSNAIIRAESQRKGVQIVGASPIIRALLLLIGISPRHFVKKPQ |
| Ga0210384_110709021 | 3300021432 | Soil | GAFSNAIIRAESQRKGVQIIGASPIIRALLLLIGISPRHFVKKAQ |
| Ga0182009_103140633 | 3300021445 | Soil | NRIEGQRKSVQITGASPIIRALLLLIGISPRHFVRKAS |
| Ga0224505_102641152 | 3300022214 | Sediment | EAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKAQ |
| Ga0247785_10139741 | 3300022889 | Soil | LLNAINRVEAQRKAVQFLGVSPIVRALLLLIGISPRHFLKKAQ |
| Ga0207697_100436881 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | GALLNLIGRIESQHKSVQIVGASPIIRALLLLIGVSPRHFVKKPQ |
| Ga0207682_104516211 | 3300025893 | Miscanthus Rhizosphere | LNAINRVEQQRKAVQIQGASPIIRALLTLIGISPRHFLKKPQ |
| Ga0207654_102332503 | 3300025911 | Corn Rhizosphere | NAISRAESQRKSIQIIGASPIIRALLLLIGISPRHFIKKAT |
| Ga0207695_116808481 | 3300025913 | Corn Rhizosphere | NAITRIEGQGKAVQILGATPIVRALLLLIGISPRHFVKKAG |
| Ga0207657_106741681 | 3300025919 | Corn Rhizosphere | RVEGQGKAVQIVGASPIVRALLLLIGISPRHFVKKAD |
| Ga0207646_108602581 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ARTESQRKTVQIAGASPIIRALLLLIGISPRHFIKTAQ |
| Ga0207650_118648271 | 3300025925 | Switchgrass Rhizosphere | RAESQRKSIQIIGASPIIRALLLLIGISPRHFIKKAT |
| Ga0207644_105572061 | 3300025931 | Switchgrass Rhizosphere | KIESQRKTVHIVGASPIIRALLLLIGISPRHFVKSSA |
| Ga0207670_116621392 | 3300025936 | Switchgrass Rhizosphere | NNVEKQRKVVEIFGATPIIVAILLLIGLTPGHFVKKAP |
| Ga0207670_117813972 | 3300025936 | Switchgrass Rhizosphere | EQQRKAVQIAGATPIIRALLLLIGISPRHFVKKPT |
| Ga0207669_104290963 | 3300025937 | Miscanthus Rhizosphere | EQQRKAVQIQGASPIIRALLTLIGISPRHFLKKPQ |
| Ga0207679_108811142 | 3300025945 | Corn Rhizosphere | NAITRIATLGKAVQITGATPIVRALLLLIGISPRHFVKKVD |
| Ga0207667_108342731 | 3300025949 | Corn Rhizosphere | FNAISRVEGQGKAVQILGASPIVRALLLLIGISPRHFVKKAD |
| Ga0207651_100156911 | 3300025960 | Switchgrass Rhizosphere | INRVESQRKAVQIVGASPIIRALLLLIGISPRHFLKKSF |
| Ga0207640_120802611 | 3300025981 | Corn Rhizosphere | IEGQRKTVQIIGASPILRALLLLIGISPRHFVKKAA |
| Ga0207641_103313971 | 3300026088 | Switchgrass Rhizosphere | NAINRVEQQRKAVQITGASPIIRALLLLIGISPRHFLKKPQ |
| Ga0207641_111359722 | 3300026088 | Switchgrass Rhizosphere | GALLNTINRVESQRKAVQIVGASPIVRALLLLIGISPRHFLKKPQ |
| Ga0207648_115506651 | 3300026089 | Miscanthus Rhizosphere | AINRIEAQRKAVQIVGVSPIVRALLLLIGISPRHFLKKAQ |
| Ga0207683_107922671 | 3300026121 | Miscanthus Rhizosphere | AIGRVEQQRKAVQIMGASPIIRALLLLIGISPRHFLKKPQ |
| Ga0209839_102452942 | 3300026294 | Soil | NGISRAESQRKSVQIVGATPIVRVLLLLIGISPRHFIKKAQ |
| Ga0209157_11571411 | 3300026537 | Soil | NAIGRTEAQHKTVQIAGASPIVRVLLLLIGISPRHFIKQAQ |
| Ga0209999_10935281 | 3300027543 | Arabidopsis Thaliana Rhizosphere | LLNAINRIEAQRKAVQIVGVSPIVRALLLLIGISPRHFLKKAQ |
| Ga0209682_100519761 | 3300027716 | Wetland Sediment | AINRVESQRKSVQIFGATPIIRALLLLIGISPRHFVKKPQ |
| Ga0209448_100510952 | 3300027783 | Bog Forest Soil | LNVIIRAEAQRKTVQIAGASPIIRALLLLIGISPRHFIKKTQ |
| Ga0209397_102623962 | 3300027871 | Wetland | EAQRKSVQIVGATPIIRALLLLIGLPPRHFVKKNV |
| Ga0209450_107038122 | 3300027885 | Freshwater Lake Sediment | TRVEAQRKAVQIVGASPIIRALLLLIGISPRHFLKKPQ |
| Ga0209254_107619511 | 3300027897 | Freshwater Lake Sediment | EQQRKSVQIVGATPIVRALLLLIGISPRHFVKKAD |
| Ga0209048_109117251 | 3300027902 | Freshwater Lake Sediment | IETQRKSVQIVGATPIVRALLLLIGISPRHFVKRAQ |
| Ga0268265_104023083 | 3300028380 | Switchgrass Rhizosphere | RLESQRKAVQIVGASPIIRALLLLIGISPRHFLKKLQ |
| Ga0247822_109607231 | 3300028592 | Soil | VEGQGKAVQIVGASPIVRALLLLIGISPRHFVKKGE |
| Ga0247821_104175861 | 3300028596 | Soil | HRFPLTLNTITRVEGQGKAVQIVGASPIVRALLLLIGISPRHFVKKGE |
| Ga0247821_109684091 | 3300028596 | Soil | LLNAITRIETLGKAVQITGTSPIVRALLLLIGISPRHFVKKVD |
| Ga0302256_101497511 | 3300028741 | Fen | SLLNTINRIEAQRKAVQIMGASPIIRALLLLIGISPRHFLKRTP |
| Ga0247824_109551811 | 3300028809 | Soil | TITRVEGQGKAVQIVGASPIVRALLLLIGISPRHFVKKGE |
| Ga0302163_100618582 | 3300028868 | Fen | EAQRKAVQIMGASPIIRALLLLIGISPRHFLKRSP |
| Ga0302263_103374322 | 3300028869 | Fen | AINRIETQRKAVQIVGASPIIRALLLLIGISPRHFLKRAQ |
| Ga0311332_105407021 | 3300029984 | Fen | LNAINRVESQRKAVQIVGASPIIRALLLLIGISPRHFLKRAP |
| Ga0311339_111241492 | 3300029999 | Palsa | ALLNAIIRAEGQRKTVQIAGASPIIRVLLLLIGISPRHFIKKAQ |
| Ga0302286_101902321 | 3300030047 | Fen | IEAQRKAVQIMGASPIIRALLLLIGISPRHFLKRTP |
| Ga0311333_105826592 | 3300030114 | Fen | LNAINRIEAQRKAVQIMGASPIIRALLLLIGISPRHFLKRSP |
| Ga0311333_107324921 | 3300030114 | Fen | GSLLNTINRIEAQRKAVQILGASPIIRALLLLIGISPRHFLKRAP |
| Ga0311349_108887812 | 3300030294 | Fen | LNTLSRIEGQRKAVQFVGATPIIRALLLLIGISPRHFVKKAH |
| Ga0311349_109171361 | 3300030294 | Fen | EAQRKAVQILGASPIIRALLLLIGISPRHFLKRAP |
| Ga0311349_111350882 | 3300030294 | Fen | VESQRKAVQIVGASPIIRALLLLIGISPRHFLKRAP |
| Ga0311349_116911102 | 3300030294 | Fen | LLNTLNRIEGQRKAVQFVGATPIIRALLLLIGISPRHFIKKAQ |
| Ga0311335_112118611 | 3300030838 | Fen | IESQRKKVEIIGASPIIKALLLILGVAPQSFVKKAQ |
| (restricted) Ga0255312_11155781 | 3300031248 | Sandy Soil | GRVEGQRKNVQIVGASPIIRALLLLIGVSPRNFVKKTG |
| Ga0315291_110479742 | 3300031707 | Sediment | IEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKPQ |
| Ga0315293_113006242 | 3300031746 | Sediment | LLNHINRIEAQRKVVQIVGASPIIRALLLLIGVSPRHFVKKPQ |
| Ga0318494_108275631 | 3300031751 | Soil | RAESQRKTVQIAGATPIIRALLLLIGISPRHFVKKAQ |
| Ga0318543_101421073 | 3300031777 | Soil | ALLNAIGRAESQRKTVQIAGATPIIRALLLLIGISPRHFVKKAQ |
| Ga0318543_101883082 | 3300031777 | Soil | NMINRIEMQRKSVQISGATPIVRALLLLIGISPRHFVRKNS |
| Ga0318568_108162981 | 3300031819 | Soil | VESQRKTVQISGATPIIRALLLLIGISPRHFVKKAP |
| Ga0307473_102907091 | 3300031820 | Hardwood Forest Soil | IGRAESQRKTVQISGATPIIRALLLLIGISPRHFVKKAQ |
| Ga0307413_103524771 | 3300031824 | Rhizosphere | LNAVTRVEGQRKAVQVLGASPIIRALLLLIGLSPRHFVKKVV |
| Ga0315297_105895112 | 3300031873 | Sediment | TRIEAQRKAIQIVGASPIIRALLLLIGVSPRHFVKKSQ |
| Ga0318536_106715782 | 3300031893 | Soil | NHISRIEAQRKAVQIVGVTPIIRALLLLLGVSPRHFVKKAE |
| Ga0307407_114243842 | 3300031903 | Rhizosphere | EGQRKAVQVLGASPIIRALLLLIGLSPRHFVKKAA |
| Ga0306926_111108981 | 3300031954 | Soil | AIGRVEGQRKSVQIVGASPIVRALLLLIGVSPRHFVKKSV |
| Ga0306926_126575841 | 3300031954 | Soil | LNSISRIEAQQTAVQIVGASPIIRALLLLIGVSPRQFVKK |
| Ga0307409_1010755041 | 3300031995 | Rhizosphere | TINRVEGQRKSVQISGASPIIRALLLLIGISPRHFVRKAA |
| Ga0315278_119763242 | 3300031997 | Sediment | HINRIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKPQ |
| Ga0318562_107229582 | 3300032008 | Soil | SRIEAQQTAVQIVGASPIIRALLLLIGVSPRQFVKK |
| Ga0318507_104072711 | 3300032025 | Soil | AESQRKTVQIAGATPIIRALLLLIGISPRHFVKKAQ |
| Ga0315284_115934201 | 3300032053 | Sediment | ALLNLINRIESQKKAIQIVGASPIIRALLLLIGVSPRHFVKKPQ |
| Ga0310890_114577512 | 3300032075 | Soil | NRIEQQRKAVQIAGATPIIRALLLLIGISPRHFVKKPT |
| Ga0315292_108993442 | 3300032143 | Sediment | EEHRKAVQIFGATPIIRAMLLLIGIPSGHFYKKSQ |
| Ga0315281_104522711 | 3300032163 | Sediment | EGQRKAVQIVGASPIIRALLLLIGVSPRHFVKKPQ |
| Ga0315281_116602982 | 3300032163 | Sediment | GALLNLINRIESQRKAIQIVGASPIIRALLLLIGVSPRHFVKKPQ |
| Ga0315276_101496011 | 3300032177 | Sediment | NHINRIEAQRKAVQIVGASPIIRALLLLIGVSPRHFVKKPQ |
| Ga0307472_1014734952 | 3300032205 | Hardwood Forest Soil | ISRAESQRKTVQIVGASPIIRALLLLIGISSRHFIRKEQ |
| Ga0315273_111408823 | 3300032516 | Sediment | MNAIYRVESQRKAVQIVGASPIIRALLLLIGISPRHFLKRTT |
| Ga0335080_124109991 | 3300032828 | Soil | NRVEAQRRAVQIIGASPIIRALLLLIGISPRHFVKKTQ |
| Ga0335076_106838213 | 3300032955 | Soil | TRAETQRKTVQIAGASPIIRALLLLIGISPRHFIKKVQ |
| Ga0335084_118299851 | 3300033004 | Soil | EGQRKSVQIIGASPMIRALLLLIGVSPRHFVKKSA |
| Ga0316603_120677322 | 3300033413 | Soil | TRIEGQRKSVQIVGATPIIRALLLLIGLPPRHFVKKNA |
| Ga0316627_1027540321 | 3300033482 | Soil | NRIEAQRKAVQIGGASPIIRALLLLIGVSPRHFVKKPQ |
| Ga0316616_1020024441 | 3300033521 | Soil | EAQRKAVQIVGASPIIRALLLLIGISPRHFLKKPQ |
| Ga0316617_1023438521 | 3300033557 | Soil | LLNVINRIEKQRKSVQIVGASPIIRSLLLLIGVSPRHFVKKS |
| Ga0314864_0171889_449_556 | 3300033805 | Peatland | ESQHKTVQIIGASPIIRALLMLIGITPRHFIKKAQ |
| Ga0364943_0052593_1228_1350 | 3300034354 | Sediment | SIIRAEGQRKTVQIAGASPIIRALLLLLGISPRHFIKKPQ |
| Ga0370497_0150375_1_135 | 3300034965 | Untreated Peat Soil | ALFNVINRVEQQRKAVQIVGASPIIRALLLLIGISPRHFLKKPQ |
| ⦗Top⦘ |