NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F049504

Metagenome / Metatranscriptome Family F049504

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F049504
Family Type Metagenome / Metatranscriptome
Number of Sequences 146
Average Sequence Length 40 residues
Representative Sequence MKPWKKIAIGAGVVVLLAIIVGFTVHQSTKNVVTVQTG
Number of Associated Samples 128
Number of Associated Scaffolds 146

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 87.50 %
% of genes near scaffold ends (potentially truncated) 97.95 %
% of genes from short scaffolds (< 2000 bps) 91.78 %
Associated GOLD sequencing projects 122
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.219 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(9.589 % of family members)
Environment Ontology (ENVO) Unclassified
(25.342 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(51.370 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 42.42%    β-sheet: 0.00%    Coil/Unstructured: 57.58%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 146 Family Scaffolds
PF13620CarboxypepD_reg 4.11
PF04185Phosphoesterase 1.37
PF14520HHH_5 0.68
PF01875Memo 0.68
PF06421LepA_C 0.68
PF16491Peptidase_M48_N 0.68
PF01797Y1_Tnp 0.68
PF13533Biotin_lipoyl_2 0.68
PF00491Arginase 0.68
PF16576HlyD_D23 0.68

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 146 Family Scaffolds
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 1.37
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.68
COG0481Translation elongation factor EF-4, membrane-bound GTPaseTranslation, ribosomal structure and biogenesis [J] 0.68
COG1355Predicted class III extradiol dioxygenase, MEMO1 familyGeneral function prediction only [R] 0.68
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.68


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.22 %
All OrganismsrootAll Organisms41.78 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10778382Not Available549Open in IMG/M
3300002245|JGIcombinedJ26739_100803673All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2821Open in IMG/M
3300004152|Ga0062386_100387780All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21123Open in IMG/M
3300005332|Ga0066388_107263703Not Available557Open in IMG/M
3300005435|Ga0070714_100359115All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21369Open in IMG/M
3300005446|Ga0066686_10527296Not Available803Open in IMG/M
3300005447|Ga0066689_10223281All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21151Open in IMG/M
3300005454|Ga0066687_10294469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2918Open in IMG/M
3300005518|Ga0070699_100909039Not Available806Open in IMG/M
3300005540|Ga0066697_10164905All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21312Open in IMG/M
3300005559|Ga0066700_10555123Not Available801Open in IMG/M
3300005568|Ga0066703_10477515Not Available744Open in IMG/M
3300005569|Ga0066705_10303899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21011Open in IMG/M
3300005602|Ga0070762_11004372All Organisms → cellular organisms → Bacteria → Acidobacteria572Open in IMG/M
3300005602|Ga0070762_11017274Not Available569Open in IMG/M
3300005610|Ga0070763_10401183Not Available771Open in IMG/M
3300005874|Ga0075288_1021830All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2908Open in IMG/M
3300005921|Ga0070766_10343812All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2967Open in IMG/M
3300006052|Ga0075029_100456733Not Available838Open in IMG/M
3300006162|Ga0075030_100759688Not Available766Open in IMG/M
3300006800|Ga0066660_10051964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2681Open in IMG/M
3300006871|Ga0075434_102424941Not Available526Open in IMG/M
3300009012|Ga0066710_104780006Not Available506Open in IMG/M
3300009038|Ga0099829_10160118Not Available1802Open in IMG/M
3300009093|Ga0105240_11252587All Organisms → cellular organisms → Bacteria → Acidobacteria784Open in IMG/M
3300009143|Ga0099792_10303224All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2949Open in IMG/M
3300009143|Ga0099792_10823058Not Available610Open in IMG/M
3300009522|Ga0116218_1176739Not Available967Open in IMG/M
3300009524|Ga0116225_1199673Not Available904Open in IMG/M
3300009545|Ga0105237_10827139All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2933Open in IMG/M
3300009665|Ga0116135_1183715Not Available793Open in IMG/M
3300009672|Ga0116215_1043204All Organisms → cellular organisms → Bacteria2056Open in IMG/M
3300010046|Ga0126384_12370509Not Available513Open in IMG/M
3300010048|Ga0126373_12899198Not Available535Open in IMG/M
3300010159|Ga0099796_10192258Not Available824Open in IMG/M
3300010343|Ga0074044_10437080Not Available856Open in IMG/M
3300010343|Ga0074044_10857082Not Available594Open in IMG/M
3300010360|Ga0126372_12827570Not Available537Open in IMG/M
3300010376|Ga0126381_100694848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21454Open in IMG/M
3300010376|Ga0126381_101136252All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21129Open in IMG/M
3300010398|Ga0126383_12051951Not Available659Open in IMG/M
3300012096|Ga0137389_10040973All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter3439Open in IMG/M
3300012206|Ga0137380_10600685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2962Open in IMG/M
3300012349|Ga0137387_10134122Not Available1754Open in IMG/M
3300012683|Ga0137398_10657364Not Available727Open in IMG/M
3300012918|Ga0137396_10902792Not Available647Open in IMG/M
3300012925|Ga0137419_10467373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2997Open in IMG/M
3300012925|Ga0137419_11003682Not Available692Open in IMG/M
3300013306|Ga0163162_11476442Not Available774Open in IMG/M
3300013770|Ga0120123_1098825Not Available664Open in IMG/M
3300014165|Ga0181523_10087527All Organisms → cellular organisms → Bacteria1880Open in IMG/M
3300014200|Ga0181526_10355077Not Available932Open in IMG/M
3300014489|Ga0182018_10275731All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2920Open in IMG/M
3300014501|Ga0182024_10797874All Organisms → cellular organisms → Bacteria1151Open in IMG/M
3300014657|Ga0181522_10330712Not Available907Open in IMG/M
3300015374|Ga0132255_101573081All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2996Open in IMG/M
3300017924|Ga0187820_1238875All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300017924|Ga0187820_1260940Not Available559Open in IMG/M
3300017934|Ga0187803_10435246Not Available534Open in IMG/M
3300017934|Ga0187803_10452209Not Available524Open in IMG/M
3300017942|Ga0187808_10339480Not Available681Open in IMG/M
3300017948|Ga0187847_10368730Not Available787Open in IMG/M
3300017955|Ga0187817_10293934All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21036Open in IMG/M
3300017959|Ga0187779_10350065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2954Open in IMG/M
3300017970|Ga0187783_11048886Not Available587Open in IMG/M
3300017970|Ga0187783_11065383All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium582Open in IMG/M
3300017975|Ga0187782_10512641All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2918Open in IMG/M
3300017995|Ga0187816_10054582All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21675Open in IMG/M
3300017995|Ga0187816_10090193All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21311Open in IMG/M
3300017995|Ga0187816_10479764Not Available558Open in IMG/M
3300017999|Ga0187767_10272085Not Available566Open in IMG/M
3300018007|Ga0187805_10550582Not Available543Open in IMG/M
3300018016|Ga0187880_1300844Not Available691Open in IMG/M
3300018018|Ga0187886_1376796Not Available521Open in IMG/M
3300018022|Ga0187864_10174513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21040Open in IMG/M
3300018060|Ga0187765_11052975Not Available561Open in IMG/M
3300018060|Ga0187765_11298187Not Available515Open in IMG/M
3300018060|Ga0187765_11398013Not Available500Open in IMG/M
3300018062|Ga0187784_10403828All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21105Open in IMG/M
3300018064|Ga0187773_10008295All Organisms → cellular organisms → Bacteria4296Open in IMG/M
3300018085|Ga0187772_10132232All Organisms → cellular organisms → Bacteria1637Open in IMG/M
3300018086|Ga0187769_10504520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2913Open in IMG/M
3300018086|Ga0187769_11066364Not Available611Open in IMG/M
3300020580|Ga0210403_10013305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6649Open in IMG/M
3300020583|Ga0210401_10931817Not Available727Open in IMG/M
3300020583|Ga0210401_11281311Not Available591Open in IMG/M
3300021088|Ga0210404_10689844Not Available582Open in IMG/M
3300021420|Ga0210394_10032337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis4690Open in IMG/M
3300021420|Ga0210394_10179630All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21843Open in IMG/M
3300021474|Ga0210390_10289931All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21386Open in IMG/M
3300021476|Ga0187846_10097044All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1270Open in IMG/M
3300021478|Ga0210402_10286895All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1523Open in IMG/M
3300021559|Ga0210409_10128773All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2325Open in IMG/M
3300021560|Ga0126371_13818337Not Available508Open in IMG/M
3300022515|Ga0224546_1031106Not Available519Open in IMG/M
3300022557|Ga0212123_10299608All Organisms → cellular organisms → Bacteria → Acidobacteria1124Open in IMG/M
3300024295|Ga0224556_1077755Not Available813Open in IMG/M
3300025627|Ga0208220_1133152Not Available645Open in IMG/M
3300025900|Ga0207710_10743105Not Available515Open in IMG/M
3300025928|Ga0207700_12035480Not Available501Open in IMG/M
3300025941|Ga0207711_11534972Not Available609Open in IMG/M
3300026333|Ga0209158_1071208All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21370Open in IMG/M
3300026548|Ga0209161_10189993All Organisms → cellular organisms → Bacteria → Acidobacteria1148Open in IMG/M
3300027011|Ga0207740_1032339Not Available636Open in IMG/M
3300027072|Ga0208238_1016114Not Available644Open in IMG/M
3300027297|Ga0208241_1040959Not Available726Open in IMG/M
3300027575|Ga0209525_1017819All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21734Open in IMG/M
3300027667|Ga0209009_1011447All Organisms → cellular organisms → Bacteria2118Open in IMG/M
3300027667|Ga0209009_1160917Not Available571Open in IMG/M
3300027737|Ga0209038_10154837Not Available694Open in IMG/M
3300027826|Ga0209060_10114421All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21258Open in IMG/M
3300027846|Ga0209180_10449656Not Available726Open in IMG/M
3300027855|Ga0209693_10072394All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21700Open in IMG/M
3300027855|Ga0209693_10615072Not Available512Open in IMG/M
3300027862|Ga0209701_10573599Not Available603Open in IMG/M
3300027875|Ga0209283_10650446Not Available663Open in IMG/M
3300027884|Ga0209275_10787476Not Available548Open in IMG/M
3300027889|Ga0209380_10611232Not Available631Open in IMG/M
3300027908|Ga0209006_10063136All Organisms → cellular organisms → Bacteria3309Open in IMG/M
3300027911|Ga0209698_11338366Not Available523Open in IMG/M
3300028381|Ga0268264_10311114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21486Open in IMG/M
3300030399|Ga0311353_11397842Not Available570Open in IMG/M
3300030507|Ga0302192_10154753All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21018Open in IMG/M
3300030688|Ga0311345_10122882All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis2869Open in IMG/M
3300030878|Ga0265770_1145850Not Available516Open in IMG/M
3300030906|Ga0302314_10607599Not Available1142Open in IMG/M
3300030991|Ga0073994_12026023Not Available530Open in IMG/M
3300031231|Ga0170824_102209657Not Available534Open in IMG/M
3300031233|Ga0302307_10223716Not Available969Open in IMG/M
3300031236|Ga0302324_100873410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21241Open in IMG/M
3300031474|Ga0170818_113212709Not Available796Open in IMG/M
3300031524|Ga0302320_11443839Not Available681Open in IMG/M
3300031708|Ga0310686_112294211Not Available507Open in IMG/M
3300031715|Ga0307476_10415540All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2994Open in IMG/M
3300031715|Ga0307476_10863153All Organisms → cellular organisms → Bacteria668Open in IMG/M
3300031718|Ga0307474_10261577All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21327Open in IMG/M
3300031720|Ga0307469_12059478Not Available554Open in IMG/M
3300031754|Ga0307475_10214604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21540Open in IMG/M
3300031823|Ga0307478_10153713All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA21827Open in IMG/M
3300031946|Ga0310910_11395224Not Available539Open in IMG/M
3300031962|Ga0307479_10987116All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300032180|Ga0307471_104309467Not Available502Open in IMG/M
3300033158|Ga0335077_11618249Not Available615Open in IMG/M
3300034199|Ga0370514_086528Not Available797Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil9.59%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland8.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.53%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment6.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.48%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.48%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.48%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.79%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.74%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.74%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.74%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.05%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.05%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog2.05%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.37%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.37%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.37%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.37%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.37%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.37%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.37%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.37%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.37%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.68%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.68%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.68%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.68%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.68%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.68%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.68%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.68%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.68%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.68%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.68%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.68%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.68%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005454Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013770Permafrost microbial communities from Nunavut, Canada - A15_5cm_18MEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300017999Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018018Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022515Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300024295Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025900Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027011Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes)EnvironmentalOpen in IMG/M
3300027072Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes)EnvironmentalOpen in IMG/M
3300027297Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027667Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030507Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2EnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030878Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031233Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031524Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034199Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1077838223300001593Forest SoilMKLWKKIAIGAGVALLLGIIVGFTVHQSGKNVVTVQSGKVQRQDLASVVS
JGIcombinedJ26739_10080367323300002245Forest SoilMKAWKKVAIGVGSALVLAMIVGFTVHQSRKNVTTVQS
Ga0062386_10038778023300004152Bog Forest SoilVTGTMKLWKKIAIGSGVVVLLAAIVGFTVYQSGKNVVTVQTGK
Ga0066388_10726370313300005332Tropical Forest SoilMKTWKKIAIGGGVLILLATLIGVSVYQSRKNVATVQSGKV
Ga0070714_10035911523300005435Agricultural SoilMKAWKKVAIGVGAVVLLVIIVAFTVHQSGKNVVTVQTGKTQR
Ga0066686_1052729633300005446SoilMVTAIMKPWKKIVIGIGALLLVVAIVGFTVHQSSKNVVTVQT
Ga0066689_1022328113300005447SoilMKTWKKIAIITGVVVLLLAIVGFTVHQSHKNVVTVQTGKVQ
Ga0066687_1029446923300005454SoilMKKWKKIGIGAAAVVVLLAIVGFTVYQSRKNLVTVQSGKVQVQ
Ga0070699_10090903913300005518Corn, Switchgrass And Miscanthus RhizosphereMKAWKKIAIGVGIAVLLAMIVGFTVHQSSKNVVTVQTGKIQRQD
Ga0066697_1016490513300005540SoilMKTWKKIAIGAGVAVLLFVIVGFTVYQSRKNVVTVQTGNTQ
Ga0066700_1055512323300005559SoilMRTWKKITIIAGVVILLLAIVGFTVHQSRKNVVTVQTGK
Ga0066703_1047751513300005568SoilMKAWKKALIGVGALAVVAIIVGFTVRQSRKNVVTVQT
Ga0066705_1030389923300005569SoilMKLWKRIAIGAGVALLLGIIVGFAVHQSGKNVVTVQSGKVQRQE
Ga0070762_1100437223300005602SoilMKLWKKIALGGGVVLVLAAIVGFTVYQSGKNVVTVQTG
Ga0070762_1101727413300005602SoilMKTWKKIAIGVGAVVILAAIVGFTVHQSGKNVVTVQTGK
Ga0070763_1040118323300005610SoilMKVWKKVAIGVGAFLLVAIIVGLSVRQSSKNVVTVQTGKVQREDL
Ga0075288_102183013300005874Rice Paddy SoilMKAWKKIAIGAGIVVLLAGIVGFTVHQSGKNVVTV
Ga0070766_1034381213300005921SoilMKPWKKIAIGVGVLAVLGIVVGFTVLQSGKNVATVQTGKAQ
Ga0075029_10045673313300006052WatershedsMKTWKKIAIGAGIFVLLAIMVGVTVHQSSKNVVTVQ
Ga0075017_10070401113300006059WatershedsMKAWKKIAIGAVALVLVVSLVAFTVHQSQKNVVTVQTAKAKRETLTSVV
Ga0075030_10075968813300006162WatershedsMKAWKKIAIGVGVLVVLALIIGFTVHQSSKNVATVQTG
Ga0066660_1005196433300006800SoilMKTWKKIAIITGVVVLLLAIVGFTVHQSHKNVVTVQTG
Ga0075434_10242494113300006871Populus RhizosphereMTTWKKIAIGSGVAVVLIAIIGVTIYQSKKNVVSVQTAK
Ga0066710_10478000613300009012Grasslands SoilMKTSKKIAVGIGIALVLAGVVGFTVYRSRRNVVTVQTGKVQVQDLASL
Ga0099829_1016011813300009038Vadose Zone SoilMKTWKKIAIITGVVVLLLAIVGFTVHQSHKNVVTVQTGKVQRLD
Ga0105240_1125258713300009093Corn RhizosphereMKTWKKAAIGLGAALLLAAIVGFTVYQSRKNVVTVQTGK
Ga0099792_1030322423300009143Vadose Zone SoilMRTWKKIAIATGVVILLLAVVGFTVHQSRKNVVTVQT
Ga0099792_1082305823300009143Vadose Zone SoilMVTETMKPWKKIAIVVGVVVLLAIIVGITVHQSGR
Ga0116218_117673913300009522Peatlands SoilMKTWKKIAIGVGAVALLGTIVGVTVYQSDKNVVAVQTGKAQR
Ga0116225_119967313300009524Peatlands SoilMKAWKKVAIGVGIVVLVAIIVGFTVHQSSKNVVTVQ
Ga0105237_1082713913300009545Corn RhizosphereMKAWKKVAIGAVAVVLLVIIVAFTVHQSGKNVVTVQT
Ga0116135_118371523300009665PeatlandMKPWKKIAIGGGVVVLLAIIVGVTVYQSQKNVATVQ
Ga0116215_104320433300009672Peatlands SoilMSTLFMKTWKKIAIGVGAVALLGTIVGFTVYQSHKNVVAVQ
Ga0126384_1237050913300010046Tropical Forest SoilMKAWKKIAIGAGAVVLLLVIVLLSVRQSSKNTVTVQTSKVQRQDLTTV
Ga0126373_1289919813300010048Tropical Forest SoilMRTWKKIAIAAGAVVLVAAIVGFTVYQSHKNVVTVQTGKAQ
Ga0099796_1019225823300010159Vadose Zone SoilMKTWKKIAIGIGVALVLAIIVGITVHQSGKNVVTVQSGRV
Ga0074044_1043708013300010343Bog Forest SoilMKPWKKIAIGVGAVLLLAGIVGFTVNQSRKNVVTVQTGKVQ
Ga0074044_1085708213300010343Bog Forest SoilMKLWKKIAIGAGAALLMVGIVSYTVHQSSKNVVTVQTGKVQREDLA
Ga0126372_1282757023300010360Tropical Forest SoilMKPWKKIVIGVGGLVLLVVIVAFTVHQSSKNVVTVQ
Ga0126381_10069484833300010376Tropical Forest SoilMKTWKKIAIGAGIAIVLLAMVGFTVHQSKKNVVTVQ
Ga0126381_10113625223300010376Tropical Forest SoilMKAWKKIAIVGGALVVVSLLIWLSVVQSGKNVVTVQT
Ga0126383_1205195113300010398Tropical Forest SoilMKAWKKIAIGIGALVLLAALIGVTVNQSRKNVATVQTGKVQRQ
Ga0137389_1004097313300012096Vadose Zone SoilMKSWKKIAIGAAVAVFLSAIVGFTVYQSHKNLVTVQT
Ga0137380_1060068523300012206Vadose Zone SoilMKLWKKIAIGAGVAVLLAIIVGFTVHQSSKNVVTVQTGKV
Ga0137387_1013412223300012349Vadose Zone SoilMKLWKRIAIGAGVALLLGIIVGFAVHQSGKNVVTVQAARCSGRS*
Ga0137398_1065736413300012683Vadose Zone SoilMVTETMKPWKKIAIGVGVLVVLAIIVGITVYQSGKNVATVQTGKAQREDLSSVV
Ga0137396_1090279223300012918Vadose Zone SoilMVTETMKPWKKIAIVVGVVVLLAIIVGITVHQSGKNVATVQTGKA
Ga0137419_1046737323300012925Vadose Zone SoilMKLWKKIAIGAGVALLLGIIVGFTVHQSGKNVVTVQSGKLQRQELASVVS
Ga0137419_1100368223300012925Vadose Zone SoilMKPWKKIAIGIGVVLVLAIIVGVTVHQSGKNVVTVQSGRV
Ga0163162_1147644213300013306Switchgrass RhizosphereMKAWKKIAIGAGIVLLLASIVGFTVHQSGKNVVTVQTG
Ga0120123_109882523300013770PermafrostMKTWKKTAIIAGVVILLLAIVGFTVHQSHKNVVTVQTGKAQRLDLA
Ga0181523_1008752713300014165BogMKLWKKIAIGAGALLLLALIVGITVHQSRKNVVTVQTAK
Ga0181526_1035507723300014200BogMKAWKKIAIGVGIAVLLAIFVSATVLQSRKNVATVQTGKVQR
Ga0182018_1027573123300014489PalsaMKAWKKIAIGVGVVVLLAIIVGVTVYQSGKNVATVQTGKV
Ga0182024_1079787423300014501PermafrostMSTWKKIAIGAGVVVLLSAIVGFTVYQSHKNVVTVQTGK
Ga0181522_1033071213300014657BogMKAWKKIAIGAGIAILLAIFVGVTVHQSSKNVATVQTGKVQRQD
Ga0132255_10157308113300015374Arabidopsis RhizosphereMKLWKKIAIGVGVFLVLAGAVGLTVHQSSKNLVTVQTGKAMRQDL
Ga0187820_123887523300017924Freshwater SedimentMKTWKKIAIGAGAVVLLSAIVGFTVYQSHKNVVTV
Ga0187820_126094013300017924Freshwater SedimentMMTAWKKIAIGVGVVLLLAIIVAFTVHQSGKNVATVQT
Ga0187803_1043524613300017934Freshwater SedimentMMTAWKKIAIGVGVVLLLAIIVAFTVHQSSKNVATVQT
Ga0187803_1045220913300017934Freshwater SedimentVKSGKKIAIGIGILVLLLAIVGFTVHESCKGVVVVQTGKVARQ
Ga0187808_1033948013300017942Freshwater SedimentVTGLMKRWKKVAIGAGILVLLALVVGIAVFESGRNVVT
Ga0187847_1036873013300017948PeatlandMKVWKKVAIGAGALVVVAGIVGFTVRQSGKNVVTVQ
Ga0187817_1029393413300017955Freshwater SedimentMKTWKKIGIGAGILVLLAIIVGFTVHQSGKNVATVQTGKVQRQ
Ga0187779_1035006513300017959Tropical PeatlandMKPWKKVVIGASSAVLLAIIAAVAVHESNKNVVTVQT
Ga0187783_1104888613300017970Tropical PeatlandMAGIMKPWKKVAIGAGAVVLLAILVGVSVHQSSKN
Ga0187783_1106538313300017970Tropical PeatlandMSTWRKLAVGTGAAVLLSTIVGFAIYQSRKNVVTVQTAK
Ga0187782_1051264123300017975Tropical PeatlandMKAWKKIAIGLGAVVVVALIVGFTVHQSSKNVVTVQ
Ga0187816_1005458223300017995Freshwater SedimentMKAWKKIAIGVGIAVLLAIIVGFTVHQSSKNVVTVQT
Ga0187816_1009019313300017995Freshwater SedimentLREKIILDVTGIMKAWKKVAIGAGILVLLVSIIGFTVHQSSKNVVTVQTGKAQREDLAT
Ga0187816_1047976413300017995Freshwater SedimentMSTGKKVAIGAGVAVLLAAIIGFTVAQSHKNLVTVQT
Ga0187767_1027208513300017999Tropical PeatlandMKTWQKIAIGAGAAVGLSSIVGFTVYQSYKNVVTVQTGKVQRENLA
Ga0187805_1055058213300018007Freshwater SedimentMSTGKKVAIGAGVAVLLAAIIGFTVAQSHKNLVTVQTG
Ga0187880_130084423300018016PeatlandMKPWKKIAIGAGVVVLLAIIVGFTVHQSTKNVVTVQ
Ga0187886_137679613300018018PeatlandMKPWKKIAIGAGVVVLLAIIVGITVHQSGKNVVTVQTG
Ga0187864_1017451323300018022PeatlandMKPWKKIAIGAGVVVLLAIIVGFTVHQSTKNVVTVQTG
Ga0187765_1105297513300018060Tropical PeatlandMGSGKKLAVGAGAILLLAAIVAFTVYQSHKNVVTVET
Ga0187765_1129818713300018060Tropical PeatlandMKTWKKIAIGAVAVVVLAAIVGFTVYQSHKNVVTVQTGKA
Ga0187765_1139801313300018060Tropical PeatlandMRSGKKLAVGAGAILLLAAIVAFTVYQSHKNVVTVET
Ga0187784_1040382823300018062Tropical PeatlandMKAWKKIAIGAGAVVVVALIVGFTVHQSSKNVVTVQT
Ga0187773_1000829513300018064Tropical PeatlandVKNWKKIGIIVGIVVVVCAIVGFTVHESSKNVTTVQTGKVL
Ga0187772_1013223223300018085Tropical PeatlandMSTLKKIAIGVGAVVLLSCIVGFTVYQSHKNVVTVQTGK
Ga0187769_1050452013300018086Tropical PeatlandMKPLKKFAIGAGVVVLLAIIVAFTVHQSSKNVVTVQTGKVQR
Ga0187769_1106636413300018086Tropical PeatlandMKAWKKVAIGVGAVVVLAIIVGTTVYQSRKNVVTVQTGKA
Ga0210403_1001330513300020580SoilMKAWKKIAIGAGVALLLAIIVGFTVHQSSKNVTTVQTGKLQRQDL
Ga0210401_1093181713300020583SoilMTAWKKIAIGVGVVVVLAIIVGFTVHQSSKSVVTVQTGK
Ga0210401_1128131113300020583SoilMTTWKKIAIGAGAAVGLAAIVGFTVYQSHKNVVTVQSGKAQ
Ga0210404_1068984413300021088SoilMKPWKKIAIGAGAALLLVLIVAFTVHQSSKNVVTVQTGKVQ
Ga0210394_1003233753300021420SoilMTTWKKIAIGAGAAVGLAAIVGFTVYQSHKNVVTVQSGKAQRMD
Ga0210394_1017963013300021420SoilMKPWKKIAIGAGAALLLVAIVSFTVHQSAKNVVTV
Ga0210390_1028993113300021474SoilMKTWKKIAIGVGAVVVLASIVGFTVHQSGKNVVTV
Ga0187846_1009704413300021476BiofilmMKTWKKIAIGAGVVVVLAIMVGITVLQSGKNVATVQTGKAQVEDLSTVVS
Ga0210402_1028689533300021478SoilMKTWKKVAIGAGSVVVLAAIVGFTVYQSHKNVVTV
Ga0210409_1012877323300021559SoilMKAWKKIAIGVGVLVVLALIIGFTVHQSSKNVATVQTGKAQ
Ga0126371_1381833713300021560Tropical Forest SoilMRSGKKLAVAAGAILLLAAIVAFTVYQSHKNVVTVETS
Ga0224546_103110613300022515SoilMKPWKKIAIGGAVVVLLAIIVGVTVYHSGKNVVTVQ
Ga0212123_1029960823300022557Iron-Sulfur Acid SpringVSTWKKIAIGAGAVVLLSAIVGFTVYQSHKNVVTVQTGKA
Ga0224556_107775523300024295SoilMKPWKKIAIGIGVLLVLVIVVGVTVHQSGKNVATVQTGKTLRQDL
Ga0208220_113315213300025627Arctic Peat SoilMKTWKKISIAAGIVVALACIVGFTVHQSHKNLVTVQTGKTAR
Ga0207710_1074310513300025900Switchgrass RhizosphereMSTWKKIAIGAIVVVLLASMIGFTVYRSHKNVVVVQT
Ga0207700_1203548013300025928Corn, Switchgrass And Miscanthus RhizosphereMKLWKKITIGAGVLVLLALIVGISVHQSGKNVATVQTGKALHED
Ga0207711_1153497213300025941Switchgrass RhizosphereMSTWKKIAIGAIVVVLLASMIGFTVYRSHKNVVVVQTAKAKT
Ga0209158_107120823300026333SoilMKTWKKIAIGAGVAVLLFVIVGFTVYQSRKNVVTVQT
Ga0209161_1018999313300026548SoilMVTAIMKPWKKIVIGIGALLLVVAIVGFTVHQSSK
Ga0207740_103233923300027011Tropical Forest SoilMKAWKKVAIGAGIAVLLAIMVGFTVHQSSKNVVTVQTGKI
Ga0208238_101611413300027072Forest SoilMKLWKKIAIAAGVVVLLAIMVGFTVYQSGKNVVTVQTGKV
Ga0208241_104095923300027297Forest SoilMKAWKKVAIGAGVAVLLAIFVSASVLQSRKNVATVQTGKVQRQDLAT
Ga0209525_101781913300027575Forest SoilMKPWKKIAIGAGVVVLLAIIVGITVSQSGKNVATVQTGKV
Ga0209009_101144733300027667Forest SoilMKPWKKIAIGAGVVVLLAIVVGITVHQSGKNVVTVQTGKVERQ
Ga0209009_116091713300027667Forest SoilMVTGAMKLWKKIAIGGGVAVLLAAIVGFTVYQSGKN
Ga0209038_1015483723300027737Bog Forest SoilMKPWKKIAIGAGVVVLLAIIVGTTVHQSGKNVVTVQ
Ga0209060_1011442113300027826Surface SoilMKTWKKAAIGVGAGLLLAAIVGFTVYQSRKNVVTV
Ga0209180_1044965613300027846Vadose Zone SoilMKPWKKIAIGVGVVVVLAIIVGITVHQSGKNVSTVQT
Ga0209693_1007239423300027855SoilMKAWKKVAIGAGVAVLFAIIVGYTVHQSSKNVATVQT
Ga0209693_1061507213300027855SoilMKTWKKIAIGGGAVVLLAAIVGFTVYQSHKNVVTVQTG
Ga0209701_1057359923300027862Vadose Zone SoilMVTEIMKPWKKIAIGVGVVVVLAIIVGITVHQSGKN
Ga0209283_1065044613300027875Vadose Zone SoilMVTEIMKPWKKIAIGVGVVVVLAIIVGITVHQSGKNVSTVQTGKAQRQD
Ga0209275_1078747613300027884SoilMKPWKKIAIGAGVVVLLAIIVGITVHQSGKNVVTVQTGK
Ga0209380_1061123213300027889SoilMKLWKKIAIGVGVAVVLAAIVGFTVYQSGKNVVTVQ
Ga0209006_1006313613300027908Forest SoilMVAGVMKPWKKIAIGAGIAVLLAIIVGFTVHQSSKNVTTVQTGK
Ga0209698_1133836613300027911WatershedsMTTWKKVAIGAGAAVVLSAVAGFAVYQSHKNVVTVQT
Ga0268264_1031111413300028381Switchgrass RhizosphereMSTWKKIAIGAIVVVLLASMIGFTVYRSHKNVVVVQTAK
Ga0311353_1139784223300030399PalsaMKPWKKIAIGAGVALLLVAIVSFTVHQSAKNVVTVQ
Ga0302192_1015475323300030507BogMKPWKKIAIGIGVLLVLVIVVGVTVHQSGKNVATVQTGKTLRQDLSSVV
Ga0311345_1012288233300030688BogMKPWKKIAIGAGVMVLLAIIVGITVHQSGKNVVTVQTGKVQ
Ga0265770_114585013300030878SoilMKPWKKIAIGAGAALLLIAIVAFTVHQSAKNVVTVQTGKVQRE
Ga0302314_1060759913300030906PalsaVTETMKPWKKIAIGAGVVVLLAIIVGITVHQSGKNVVT
Ga0073994_1202602313300030991SoilMKTWKKITIGIGAALVLAIIVGITVHQSGKNVVTVQSGTVQR
Ga0170824_10220965713300031231Forest SoilMKAWKKVAIGVGIAVLLAMIVGFTVHQSSKNVVTVQTGKV
Ga0302307_1022371623300031233PalsaMKPWKIIAIGAGAALLLVGSVWLMVLQSRKSVVTVQTGKVQREDLATVVSAS
Ga0302324_10087341013300031236PalsaMKLWKKIASAAGVVVLLAIMVGFTVQQSGKNVVTV
Ga0170818_11321270913300031474Forest SoilMKAWKKIAIGVAIVLGIASMVWFTVHQSSKNVVTVQTGKAQRLDL
Ga0302320_1144383913300031524BogMKAWKKIAIGVGVVLLLAVVAGITVRQSGKNVVTVQTGKVQRLDLASVV
Ga0310686_11229421113300031708SoilMKLWKKIAIGGGVAVLLAAIVGFTVYQSGKNVVTVQT
Ga0307476_1041554013300031715Hardwood Forest SoilMVAETMKTWKKIAIGAGVVAVLALMVGISVHQSGKNVVTIQTGKVQRQDLSSVV
Ga0307476_1086315323300031715Hardwood Forest SoilMKTWKKIAIGVGAVVLVSAIVGFTVYQSHKNVVTVQTGK
Ga0307474_1026157713300031718Hardwood Forest SoilMKTWKKIAIGVGVVAVLAIIVGVSVHQSGKNVFTVQSGRVQ
Ga0307469_1205947813300031720Hardwood Forest SoilMKTWKKILIGVGAVLLLAVIVAFTVHQSSKNVVTVQTAKVQRQ
Ga0307475_1021460423300031754Hardwood Forest SoilMKTWKKIAIGVGVVAVLAIIVGVSVHQSGKNVFTVQSG
Ga0307478_1015371313300031823Hardwood Forest SoilMKPWKKIAIGAGVVVVLAIIVGITVHQSGKNVVTVQTGK
Ga0310910_1139522413300031946SoilMRNGRKLAVGAGAILLLGAIAAFTVYQSHKNVVTVETS
Ga0307479_1098711613300031962Hardwood Forest SoilMSTWKKIAIGAGAVVLLSAIVGFTVYQSHKNVVTVQSGKAQRMD
Ga0307471_10430946723300032180Hardwood Forest SoilMKLWKKIAIGAGVAALLAIIVGFTVYQSGKNVVTVQT
Ga0335081_1220599823300032892SoilMKSWKKVAIGSGVALVLTVIVVFTVYQSRKNVATVQTAKAQREDLAS
Ga0335077_1161824913300033158SoilMKAWKKVAIGAGIAVVLAIIVGFTVHQSSKNVATVQTGKAL
Ga0370514_086528_652_7953300034199Untreated Peat SoilMKAWKKIAIGVGIAVGLAIIVGFTVSQSGKNVVTVQTGKLQRQDLATV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.