| Basic Information | |
|---|---|
| Family ID | F049504 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 146 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MKPWKKIAIGAGVVVLLAIIVGFTVHQSTKNVVTVQTG |
| Number of Associated Samples | 128 |
| Number of Associated Scaffolds | 146 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 87.50 % |
| % of genes near scaffold ends (potentially truncated) | 97.95 % |
| % of genes from short scaffolds (< 2000 bps) | 91.78 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.56 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (58.219 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.589 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.342 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.370 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 42.42% β-sheet: 0.00% Coil/Unstructured: 57.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.56 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 146 Family Scaffolds |
|---|---|---|
| PF13620 | CarboxypepD_reg | 4.11 |
| PF04185 | Phosphoesterase | 1.37 |
| PF14520 | HHH_5 | 0.68 |
| PF01875 | Memo | 0.68 |
| PF06421 | LepA_C | 0.68 |
| PF16491 | Peptidase_M48_N | 0.68 |
| PF01797 | Y1_Tnp | 0.68 |
| PF13533 | Biotin_lipoyl_2 | 0.68 |
| PF00491 | Arginase | 0.68 |
| PF16576 | HlyD_D23 | 0.68 |
| COG ID | Name | Functional Category | % Frequency in 146 Family Scaffolds |
|---|---|---|---|
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 1.37 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.68 |
| COG0481 | Translation elongation factor EF-4, membrane-bound GTPase | Translation, ribosomal structure and biogenesis [J] | 0.68 |
| COG1355 | Predicted class III extradiol dioxygenase, MEMO1 family | General function prediction only [R] | 0.68 |
| COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.68 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 58.22 % |
| All Organisms | root | All Organisms | 41.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10778382 | Not Available | 549 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100803673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 821 | Open in IMG/M |
| 3300004152|Ga0062386_100387780 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1123 | Open in IMG/M |
| 3300005332|Ga0066388_107263703 | Not Available | 557 | Open in IMG/M |
| 3300005435|Ga0070714_100359115 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1369 | Open in IMG/M |
| 3300005446|Ga0066686_10527296 | Not Available | 803 | Open in IMG/M |
| 3300005447|Ga0066689_10223281 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1151 | Open in IMG/M |
| 3300005454|Ga0066687_10294469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 918 | Open in IMG/M |
| 3300005518|Ga0070699_100909039 | Not Available | 806 | Open in IMG/M |
| 3300005540|Ga0066697_10164905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1312 | Open in IMG/M |
| 3300005559|Ga0066700_10555123 | Not Available | 801 | Open in IMG/M |
| 3300005568|Ga0066703_10477515 | Not Available | 744 | Open in IMG/M |
| 3300005569|Ga0066705_10303899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1011 | Open in IMG/M |
| 3300005602|Ga0070762_11004372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300005602|Ga0070762_11017274 | Not Available | 569 | Open in IMG/M |
| 3300005610|Ga0070763_10401183 | Not Available | 771 | Open in IMG/M |
| 3300005874|Ga0075288_1021830 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 908 | Open in IMG/M |
| 3300005921|Ga0070766_10343812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 967 | Open in IMG/M |
| 3300006052|Ga0075029_100456733 | Not Available | 838 | Open in IMG/M |
| 3300006162|Ga0075030_100759688 | Not Available | 766 | Open in IMG/M |
| 3300006800|Ga0066660_10051964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2681 | Open in IMG/M |
| 3300006871|Ga0075434_102424941 | Not Available | 526 | Open in IMG/M |
| 3300009012|Ga0066710_104780006 | Not Available | 506 | Open in IMG/M |
| 3300009038|Ga0099829_10160118 | Not Available | 1802 | Open in IMG/M |
| 3300009093|Ga0105240_11252587 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300009143|Ga0099792_10303224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 949 | Open in IMG/M |
| 3300009143|Ga0099792_10823058 | Not Available | 610 | Open in IMG/M |
| 3300009522|Ga0116218_1176739 | Not Available | 967 | Open in IMG/M |
| 3300009524|Ga0116225_1199673 | Not Available | 904 | Open in IMG/M |
| 3300009545|Ga0105237_10827139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 933 | Open in IMG/M |
| 3300009665|Ga0116135_1183715 | Not Available | 793 | Open in IMG/M |
| 3300009672|Ga0116215_1043204 | All Organisms → cellular organisms → Bacteria | 2056 | Open in IMG/M |
| 3300010046|Ga0126384_12370509 | Not Available | 513 | Open in IMG/M |
| 3300010048|Ga0126373_12899198 | Not Available | 535 | Open in IMG/M |
| 3300010159|Ga0099796_10192258 | Not Available | 824 | Open in IMG/M |
| 3300010343|Ga0074044_10437080 | Not Available | 856 | Open in IMG/M |
| 3300010343|Ga0074044_10857082 | Not Available | 594 | Open in IMG/M |
| 3300010360|Ga0126372_12827570 | Not Available | 537 | Open in IMG/M |
| 3300010376|Ga0126381_100694848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1454 | Open in IMG/M |
| 3300010376|Ga0126381_101136252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1129 | Open in IMG/M |
| 3300010398|Ga0126383_12051951 | Not Available | 659 | Open in IMG/M |
| 3300012096|Ga0137389_10040973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3439 | Open in IMG/M |
| 3300012206|Ga0137380_10600685 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 962 | Open in IMG/M |
| 3300012349|Ga0137387_10134122 | Not Available | 1754 | Open in IMG/M |
| 3300012683|Ga0137398_10657364 | Not Available | 727 | Open in IMG/M |
| 3300012918|Ga0137396_10902792 | Not Available | 647 | Open in IMG/M |
| 3300012925|Ga0137419_10467373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 997 | Open in IMG/M |
| 3300012925|Ga0137419_11003682 | Not Available | 692 | Open in IMG/M |
| 3300013306|Ga0163162_11476442 | Not Available | 774 | Open in IMG/M |
| 3300013770|Ga0120123_1098825 | Not Available | 664 | Open in IMG/M |
| 3300014165|Ga0181523_10087527 | All Organisms → cellular organisms → Bacteria | 1880 | Open in IMG/M |
| 3300014200|Ga0181526_10355077 | Not Available | 932 | Open in IMG/M |
| 3300014489|Ga0182018_10275731 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 920 | Open in IMG/M |
| 3300014501|Ga0182024_10797874 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300014657|Ga0181522_10330712 | Not Available | 907 | Open in IMG/M |
| 3300015374|Ga0132255_101573081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 996 | Open in IMG/M |
| 3300017924|Ga0187820_1238875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
| 3300017924|Ga0187820_1260940 | Not Available | 559 | Open in IMG/M |
| 3300017934|Ga0187803_10435246 | Not Available | 534 | Open in IMG/M |
| 3300017934|Ga0187803_10452209 | Not Available | 524 | Open in IMG/M |
| 3300017942|Ga0187808_10339480 | Not Available | 681 | Open in IMG/M |
| 3300017948|Ga0187847_10368730 | Not Available | 787 | Open in IMG/M |
| 3300017955|Ga0187817_10293934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1036 | Open in IMG/M |
| 3300017959|Ga0187779_10350065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 954 | Open in IMG/M |
| 3300017970|Ga0187783_11048886 | Not Available | 587 | Open in IMG/M |
| 3300017970|Ga0187783_11065383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 582 | Open in IMG/M |
| 3300017975|Ga0187782_10512641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 918 | Open in IMG/M |
| 3300017995|Ga0187816_10054582 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1675 | Open in IMG/M |
| 3300017995|Ga0187816_10090193 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1311 | Open in IMG/M |
| 3300017995|Ga0187816_10479764 | Not Available | 558 | Open in IMG/M |
| 3300017999|Ga0187767_10272085 | Not Available | 566 | Open in IMG/M |
| 3300018007|Ga0187805_10550582 | Not Available | 543 | Open in IMG/M |
| 3300018016|Ga0187880_1300844 | Not Available | 691 | Open in IMG/M |
| 3300018018|Ga0187886_1376796 | Not Available | 521 | Open in IMG/M |
| 3300018022|Ga0187864_10174513 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1040 | Open in IMG/M |
| 3300018060|Ga0187765_11052975 | Not Available | 561 | Open in IMG/M |
| 3300018060|Ga0187765_11298187 | Not Available | 515 | Open in IMG/M |
| 3300018060|Ga0187765_11398013 | Not Available | 500 | Open in IMG/M |
| 3300018062|Ga0187784_10403828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1105 | Open in IMG/M |
| 3300018064|Ga0187773_10008295 | All Organisms → cellular organisms → Bacteria | 4296 | Open in IMG/M |
| 3300018085|Ga0187772_10132232 | All Organisms → cellular organisms → Bacteria | 1637 | Open in IMG/M |
| 3300018086|Ga0187769_10504520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 913 | Open in IMG/M |
| 3300018086|Ga0187769_11066364 | Not Available | 611 | Open in IMG/M |
| 3300020580|Ga0210403_10013305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6649 | Open in IMG/M |
| 3300020583|Ga0210401_10931817 | Not Available | 727 | Open in IMG/M |
| 3300020583|Ga0210401_11281311 | Not Available | 591 | Open in IMG/M |
| 3300021088|Ga0210404_10689844 | Not Available | 582 | Open in IMG/M |
| 3300021420|Ga0210394_10032337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4690 | Open in IMG/M |
| 3300021420|Ga0210394_10179630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1843 | Open in IMG/M |
| 3300021474|Ga0210390_10289931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1386 | Open in IMG/M |
| 3300021476|Ga0187846_10097044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1270 | Open in IMG/M |
| 3300021478|Ga0210402_10286895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1523 | Open in IMG/M |
| 3300021559|Ga0210409_10128773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2325 | Open in IMG/M |
| 3300021560|Ga0126371_13818337 | Not Available | 508 | Open in IMG/M |
| 3300022515|Ga0224546_1031106 | Not Available | 519 | Open in IMG/M |
| 3300022557|Ga0212123_10299608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1124 | Open in IMG/M |
| 3300024295|Ga0224556_1077755 | Not Available | 813 | Open in IMG/M |
| 3300025627|Ga0208220_1133152 | Not Available | 645 | Open in IMG/M |
| 3300025900|Ga0207710_10743105 | Not Available | 515 | Open in IMG/M |
| 3300025928|Ga0207700_12035480 | Not Available | 501 | Open in IMG/M |
| 3300025941|Ga0207711_11534972 | Not Available | 609 | Open in IMG/M |
| 3300026333|Ga0209158_1071208 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1370 | Open in IMG/M |
| 3300026548|Ga0209161_10189993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1148 | Open in IMG/M |
| 3300027011|Ga0207740_1032339 | Not Available | 636 | Open in IMG/M |
| 3300027072|Ga0208238_1016114 | Not Available | 644 | Open in IMG/M |
| 3300027297|Ga0208241_1040959 | Not Available | 726 | Open in IMG/M |
| 3300027575|Ga0209525_1017819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1734 | Open in IMG/M |
| 3300027667|Ga0209009_1011447 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
| 3300027667|Ga0209009_1160917 | Not Available | 571 | Open in IMG/M |
| 3300027737|Ga0209038_10154837 | Not Available | 694 | Open in IMG/M |
| 3300027826|Ga0209060_10114421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1258 | Open in IMG/M |
| 3300027846|Ga0209180_10449656 | Not Available | 726 | Open in IMG/M |
| 3300027855|Ga0209693_10072394 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1700 | Open in IMG/M |
| 3300027855|Ga0209693_10615072 | Not Available | 512 | Open in IMG/M |
| 3300027862|Ga0209701_10573599 | Not Available | 603 | Open in IMG/M |
| 3300027875|Ga0209283_10650446 | Not Available | 663 | Open in IMG/M |
| 3300027884|Ga0209275_10787476 | Not Available | 548 | Open in IMG/M |
| 3300027889|Ga0209380_10611232 | Not Available | 631 | Open in IMG/M |
| 3300027908|Ga0209006_10063136 | All Organisms → cellular organisms → Bacteria | 3309 | Open in IMG/M |
| 3300027911|Ga0209698_11338366 | Not Available | 523 | Open in IMG/M |
| 3300028381|Ga0268264_10311114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1486 | Open in IMG/M |
| 3300030399|Ga0311353_11397842 | Not Available | 570 | Open in IMG/M |
| 3300030507|Ga0302192_10154753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1018 | Open in IMG/M |
| 3300030688|Ga0311345_10122882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2869 | Open in IMG/M |
| 3300030878|Ga0265770_1145850 | Not Available | 516 | Open in IMG/M |
| 3300030906|Ga0302314_10607599 | Not Available | 1142 | Open in IMG/M |
| 3300030991|Ga0073994_12026023 | Not Available | 530 | Open in IMG/M |
| 3300031231|Ga0170824_102209657 | Not Available | 534 | Open in IMG/M |
| 3300031233|Ga0302307_10223716 | Not Available | 969 | Open in IMG/M |
| 3300031236|Ga0302324_100873410 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1241 | Open in IMG/M |
| 3300031474|Ga0170818_113212709 | Not Available | 796 | Open in IMG/M |
| 3300031524|Ga0302320_11443839 | Not Available | 681 | Open in IMG/M |
| 3300031708|Ga0310686_112294211 | Not Available | 507 | Open in IMG/M |
| 3300031715|Ga0307476_10415540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 994 | Open in IMG/M |
| 3300031715|Ga0307476_10863153 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300031718|Ga0307474_10261577 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1327 | Open in IMG/M |
| 3300031720|Ga0307469_12059478 | Not Available | 554 | Open in IMG/M |
| 3300031754|Ga0307475_10214604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1540 | Open in IMG/M |
| 3300031823|Ga0307478_10153713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 1827 | Open in IMG/M |
| 3300031946|Ga0310910_11395224 | Not Available | 539 | Open in IMG/M |
| 3300031962|Ga0307479_10987116 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300032180|Ga0307471_104309467 | Not Available | 502 | Open in IMG/M |
| 3300033158|Ga0335077_11618249 | Not Available | 615 | Open in IMG/M |
| 3300034199|Ga0370514_086528 | Not Available | 797 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 8.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 6.85% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.85% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.79% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.74% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.74% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.74% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.05% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.05% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.05% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.37% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.37% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.37% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.37% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.37% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.37% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.37% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.37% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.37% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.68% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.68% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.68% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.68% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.68% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.68% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.68% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.68% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.68% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.68% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.68% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.68% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.68% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.68% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013770 | Permafrost microbial communities from Nunavut, Canada - A15_5cm_18M | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022515 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 1-5 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025627 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027072 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030507 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_2 | Environmental | Open in IMG/M |
| 3300030688 | II_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034199 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_01D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_107783822 | 3300001593 | Forest Soil | MKLWKKIAIGAGVALLLGIIVGFTVHQSGKNVVTVQSGKVQRQDLASVVS |
| JGIcombinedJ26739_1008036732 | 3300002245 | Forest Soil | MKAWKKVAIGVGSALVLAMIVGFTVHQSRKNVTTVQS |
| Ga0062386_1003877802 | 3300004152 | Bog Forest Soil | VTGTMKLWKKIAIGSGVVVLLAAIVGFTVYQSGKNVVTVQTGK |
| Ga0066388_1072637031 | 3300005332 | Tropical Forest Soil | MKTWKKIAIGGGVLILLATLIGVSVYQSRKNVATVQSGKV |
| Ga0070714_1003591152 | 3300005435 | Agricultural Soil | MKAWKKVAIGVGAVVLLVIIVAFTVHQSGKNVVTVQTGKTQR |
| Ga0066686_105272963 | 3300005446 | Soil | MVTAIMKPWKKIVIGIGALLLVVAIVGFTVHQSSKNVVTVQT |
| Ga0066689_102232811 | 3300005447 | Soil | MKTWKKIAIITGVVVLLLAIVGFTVHQSHKNVVTVQTGKVQ |
| Ga0066687_102944692 | 3300005454 | Soil | MKKWKKIGIGAAAVVVLLAIVGFTVYQSRKNLVTVQSGKVQVQ |
| Ga0070699_1009090391 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MKAWKKIAIGVGIAVLLAMIVGFTVHQSSKNVVTVQTGKIQRQD |
| Ga0066697_101649051 | 3300005540 | Soil | MKTWKKIAIGAGVAVLLFVIVGFTVYQSRKNVVTVQTGNTQ |
| Ga0066700_105551232 | 3300005559 | Soil | MRTWKKITIIAGVVILLLAIVGFTVHQSRKNVVTVQTGK |
| Ga0066703_104775151 | 3300005568 | Soil | MKAWKKALIGVGALAVVAIIVGFTVRQSRKNVVTVQT |
| Ga0066705_103038992 | 3300005569 | Soil | MKLWKRIAIGAGVALLLGIIVGFAVHQSGKNVVTVQSGKVQRQE |
| Ga0070762_110043722 | 3300005602 | Soil | MKLWKKIALGGGVVLVLAAIVGFTVYQSGKNVVTVQTG |
| Ga0070762_110172741 | 3300005602 | Soil | MKTWKKIAIGVGAVVILAAIVGFTVHQSGKNVVTVQTGK |
| Ga0070763_104011832 | 3300005610 | Soil | MKVWKKVAIGVGAFLLVAIIVGLSVRQSSKNVVTVQTGKVQREDL |
| Ga0075288_10218301 | 3300005874 | Rice Paddy Soil | MKAWKKIAIGAGIVVLLAGIVGFTVHQSGKNVVTV |
| Ga0070766_103438121 | 3300005921 | Soil | MKPWKKIAIGVGVLAVLGIVVGFTVLQSGKNVATVQTGKAQ |
| Ga0075029_1004567331 | 3300006052 | Watersheds | MKTWKKIAIGAGIFVLLAIMVGVTVHQSSKNVVTVQ |
| Ga0075017_1007040111 | 3300006059 | Watersheds | MKAWKKIAIGAVALVLVVSLVAFTVHQSQKNVVTVQTAKAKRETLTSVV |
| Ga0075030_1007596881 | 3300006162 | Watersheds | MKAWKKIAIGVGVLVVLALIIGFTVHQSSKNVATVQTG |
| Ga0066660_100519643 | 3300006800 | Soil | MKTWKKIAIITGVVVLLLAIVGFTVHQSHKNVVTVQTG |
| Ga0075434_1024249411 | 3300006871 | Populus Rhizosphere | MTTWKKIAIGSGVAVVLIAIIGVTIYQSKKNVVSVQTAK |
| Ga0066710_1047800061 | 3300009012 | Grasslands Soil | MKTSKKIAVGIGIALVLAGVVGFTVYRSRRNVVTVQTGKVQVQDLASL |
| Ga0099829_101601181 | 3300009038 | Vadose Zone Soil | MKTWKKIAIITGVVVLLLAIVGFTVHQSHKNVVTVQTGKVQRLD |
| Ga0105240_112525871 | 3300009093 | Corn Rhizosphere | MKTWKKAAIGLGAALLLAAIVGFTVYQSRKNVVTVQTGK |
| Ga0099792_103032242 | 3300009143 | Vadose Zone Soil | MRTWKKIAIATGVVILLLAVVGFTVHQSRKNVVTVQT |
| Ga0099792_108230582 | 3300009143 | Vadose Zone Soil | MVTETMKPWKKIAIVVGVVVLLAIIVGITVHQSGR |
| Ga0116218_11767391 | 3300009522 | Peatlands Soil | MKTWKKIAIGVGAVALLGTIVGVTVYQSDKNVVAVQTGKAQR |
| Ga0116225_11996731 | 3300009524 | Peatlands Soil | MKAWKKVAIGVGIVVLVAIIVGFTVHQSSKNVVTVQ |
| Ga0105237_108271391 | 3300009545 | Corn Rhizosphere | MKAWKKVAIGAVAVVLLVIIVAFTVHQSGKNVVTVQT |
| Ga0116135_11837152 | 3300009665 | Peatland | MKPWKKIAIGGGVVVLLAIIVGVTVYQSQKNVATVQ |
| Ga0116215_10432043 | 3300009672 | Peatlands Soil | MSTLFMKTWKKIAIGVGAVALLGTIVGFTVYQSHKNVVAVQ |
| Ga0126384_123705091 | 3300010046 | Tropical Forest Soil | MKAWKKIAIGAGAVVLLLVIVLLSVRQSSKNTVTVQTSKVQRQDLTTV |
| Ga0126373_128991981 | 3300010048 | Tropical Forest Soil | MRTWKKIAIAAGAVVLVAAIVGFTVYQSHKNVVTVQTGKAQ |
| Ga0099796_101922582 | 3300010159 | Vadose Zone Soil | MKTWKKIAIGIGVALVLAIIVGITVHQSGKNVVTVQSGRV |
| Ga0074044_104370801 | 3300010343 | Bog Forest Soil | MKPWKKIAIGVGAVLLLAGIVGFTVNQSRKNVVTVQTGKVQ |
| Ga0074044_108570821 | 3300010343 | Bog Forest Soil | MKLWKKIAIGAGAALLMVGIVSYTVHQSSKNVVTVQTGKVQREDLA |
| Ga0126372_128275702 | 3300010360 | Tropical Forest Soil | MKPWKKIVIGVGGLVLLVVIVAFTVHQSSKNVVTVQ |
| Ga0126381_1006948483 | 3300010376 | Tropical Forest Soil | MKTWKKIAIGAGIAIVLLAMVGFTVHQSKKNVVTVQ |
| Ga0126381_1011362522 | 3300010376 | Tropical Forest Soil | MKAWKKIAIVGGALVVVSLLIWLSVVQSGKNVVTVQT |
| Ga0126383_120519511 | 3300010398 | Tropical Forest Soil | MKAWKKIAIGIGALVLLAALIGVTVNQSRKNVATVQTGKVQRQ |
| Ga0137389_100409731 | 3300012096 | Vadose Zone Soil | MKSWKKIAIGAAVAVFLSAIVGFTVYQSHKNLVTVQT |
| Ga0137380_106006852 | 3300012206 | Vadose Zone Soil | MKLWKKIAIGAGVAVLLAIIVGFTVHQSSKNVVTVQTGKV |
| Ga0137387_101341222 | 3300012349 | Vadose Zone Soil | MKLWKRIAIGAGVALLLGIIVGFAVHQSGKNVVTVQAARCSGRS* |
| Ga0137398_106573641 | 3300012683 | Vadose Zone Soil | MVTETMKPWKKIAIGVGVLVVLAIIVGITVYQSGKNVATVQTGKAQREDLSSVV |
| Ga0137396_109027922 | 3300012918 | Vadose Zone Soil | MVTETMKPWKKIAIVVGVVVLLAIIVGITVHQSGKNVATVQTGKA |
| Ga0137419_104673732 | 3300012925 | Vadose Zone Soil | MKLWKKIAIGAGVALLLGIIVGFTVHQSGKNVVTVQSGKLQRQELASVVS |
| Ga0137419_110036822 | 3300012925 | Vadose Zone Soil | MKPWKKIAIGIGVVLVLAIIVGVTVHQSGKNVVTVQSGRV |
| Ga0163162_114764421 | 3300013306 | Switchgrass Rhizosphere | MKAWKKIAIGAGIVLLLASIVGFTVHQSGKNVVTVQTG |
| Ga0120123_10988252 | 3300013770 | Permafrost | MKTWKKTAIIAGVVILLLAIVGFTVHQSHKNVVTVQTGKAQRLDLA |
| Ga0181523_100875271 | 3300014165 | Bog | MKLWKKIAIGAGALLLLALIVGITVHQSRKNVVTVQTAK |
| Ga0181526_103550772 | 3300014200 | Bog | MKAWKKIAIGVGIAVLLAIFVSATVLQSRKNVATVQTGKVQR |
| Ga0182018_102757312 | 3300014489 | Palsa | MKAWKKIAIGVGVVVLLAIIVGVTVYQSGKNVATVQTGKV |
| Ga0182024_107978742 | 3300014501 | Permafrost | MSTWKKIAIGAGVVVLLSAIVGFTVYQSHKNVVTVQTGK |
| Ga0181522_103307121 | 3300014657 | Bog | MKAWKKIAIGAGIAILLAIFVGVTVHQSSKNVATVQTGKVQRQD |
| Ga0132255_1015730811 | 3300015374 | Arabidopsis Rhizosphere | MKLWKKIAIGVGVFLVLAGAVGLTVHQSSKNLVTVQTGKAMRQDL |
| Ga0187820_12388752 | 3300017924 | Freshwater Sediment | MKTWKKIAIGAGAVVLLSAIVGFTVYQSHKNVVTV |
| Ga0187820_12609401 | 3300017924 | Freshwater Sediment | MMTAWKKIAIGVGVVLLLAIIVAFTVHQSGKNVATVQT |
| Ga0187803_104352461 | 3300017934 | Freshwater Sediment | MMTAWKKIAIGVGVVLLLAIIVAFTVHQSSKNVATVQT |
| Ga0187803_104522091 | 3300017934 | Freshwater Sediment | VKSGKKIAIGIGILVLLLAIVGFTVHESCKGVVVVQTGKVARQ |
| Ga0187808_103394801 | 3300017942 | Freshwater Sediment | VTGLMKRWKKVAIGAGILVLLALVVGIAVFESGRNVVT |
| Ga0187847_103687301 | 3300017948 | Peatland | MKVWKKVAIGAGALVVVAGIVGFTVRQSGKNVVTVQ |
| Ga0187817_102939341 | 3300017955 | Freshwater Sediment | MKTWKKIGIGAGILVLLAIIVGFTVHQSGKNVATVQTGKVQRQ |
| Ga0187779_103500651 | 3300017959 | Tropical Peatland | MKPWKKVVIGASSAVLLAIIAAVAVHESNKNVVTVQT |
| Ga0187783_110488861 | 3300017970 | Tropical Peatland | MAGIMKPWKKVAIGAGAVVLLAILVGVSVHQSSKN |
| Ga0187783_110653831 | 3300017970 | Tropical Peatland | MSTWRKLAVGTGAAVLLSTIVGFAIYQSRKNVVTVQTAK |
| Ga0187782_105126412 | 3300017975 | Tropical Peatland | MKAWKKIAIGLGAVVVVALIVGFTVHQSSKNVVTVQ |
| Ga0187816_100545822 | 3300017995 | Freshwater Sediment | MKAWKKIAIGVGIAVLLAIIVGFTVHQSSKNVVTVQT |
| Ga0187816_100901931 | 3300017995 | Freshwater Sediment | LREKIILDVTGIMKAWKKVAIGAGILVLLVSIIGFTVHQSSKNVVTVQTGKAQREDLAT |
| Ga0187816_104797641 | 3300017995 | Freshwater Sediment | MSTGKKVAIGAGVAVLLAAIIGFTVAQSHKNLVTVQT |
| Ga0187767_102720851 | 3300017999 | Tropical Peatland | MKTWQKIAIGAGAAVGLSSIVGFTVYQSYKNVVTVQTGKVQRENLA |
| Ga0187805_105505821 | 3300018007 | Freshwater Sediment | MSTGKKVAIGAGVAVLLAAIIGFTVAQSHKNLVTVQTG |
| Ga0187880_13008442 | 3300018016 | Peatland | MKPWKKIAIGAGVVVLLAIIVGFTVHQSTKNVVTVQ |
| Ga0187886_13767961 | 3300018018 | Peatland | MKPWKKIAIGAGVVVLLAIIVGITVHQSGKNVVTVQTG |
| Ga0187864_101745132 | 3300018022 | Peatland | MKPWKKIAIGAGVVVLLAIIVGFTVHQSTKNVVTVQTG |
| Ga0187765_110529751 | 3300018060 | Tropical Peatland | MGSGKKLAVGAGAILLLAAIVAFTVYQSHKNVVTVET |
| Ga0187765_112981871 | 3300018060 | Tropical Peatland | MKTWKKIAIGAVAVVVLAAIVGFTVYQSHKNVVTVQTGKA |
| Ga0187765_113980131 | 3300018060 | Tropical Peatland | MRSGKKLAVGAGAILLLAAIVAFTVYQSHKNVVTVET |
| Ga0187784_104038282 | 3300018062 | Tropical Peatland | MKAWKKIAIGAGAVVVVALIVGFTVHQSSKNVVTVQT |
| Ga0187773_100082951 | 3300018064 | Tropical Peatland | VKNWKKIGIIVGIVVVVCAIVGFTVHESSKNVTTVQTGKVL |
| Ga0187772_101322322 | 3300018085 | Tropical Peatland | MSTLKKIAIGVGAVVLLSCIVGFTVYQSHKNVVTVQTGK |
| Ga0187769_105045201 | 3300018086 | Tropical Peatland | MKPLKKFAIGAGVVVLLAIIVAFTVHQSSKNVVTVQTGKVQR |
| Ga0187769_110663641 | 3300018086 | Tropical Peatland | MKAWKKVAIGVGAVVVLAIIVGTTVYQSRKNVVTVQTGKA |
| Ga0210403_100133051 | 3300020580 | Soil | MKAWKKIAIGAGVALLLAIIVGFTVHQSSKNVTTVQTGKLQRQDL |
| Ga0210401_109318171 | 3300020583 | Soil | MTAWKKIAIGVGVVVVLAIIVGFTVHQSSKSVVTVQTGK |
| Ga0210401_112813111 | 3300020583 | Soil | MTTWKKIAIGAGAAVGLAAIVGFTVYQSHKNVVTVQSGKAQ |
| Ga0210404_106898441 | 3300021088 | Soil | MKPWKKIAIGAGAALLLVLIVAFTVHQSSKNVVTVQTGKVQ |
| Ga0210394_100323375 | 3300021420 | Soil | MTTWKKIAIGAGAAVGLAAIVGFTVYQSHKNVVTVQSGKAQRMD |
| Ga0210394_101796301 | 3300021420 | Soil | MKPWKKIAIGAGAALLLVAIVSFTVHQSAKNVVTV |
| Ga0210390_102899311 | 3300021474 | Soil | MKTWKKIAIGVGAVVVLASIVGFTVHQSGKNVVTV |
| Ga0187846_100970441 | 3300021476 | Biofilm | MKTWKKIAIGAGVVVVLAIMVGITVLQSGKNVATVQTGKAQVEDLSTVVS |
| Ga0210402_102868953 | 3300021478 | Soil | MKTWKKVAIGAGSVVVLAAIVGFTVYQSHKNVVTV |
| Ga0210409_101287732 | 3300021559 | Soil | MKAWKKIAIGVGVLVVLALIIGFTVHQSSKNVATVQTGKAQ |
| Ga0126371_138183371 | 3300021560 | Tropical Forest Soil | MRSGKKLAVAAGAILLLAAIVAFTVYQSHKNVVTVETS |
| Ga0224546_10311061 | 3300022515 | Soil | MKPWKKIAIGGAVVVLLAIIVGVTVYHSGKNVVTVQ |
| Ga0212123_102996082 | 3300022557 | Iron-Sulfur Acid Spring | VSTWKKIAIGAGAVVLLSAIVGFTVYQSHKNVVTVQTGKA |
| Ga0224556_10777552 | 3300024295 | Soil | MKPWKKIAIGIGVLLVLVIVVGVTVHQSGKNVATVQTGKTLRQDL |
| Ga0208220_11331521 | 3300025627 | Arctic Peat Soil | MKTWKKISIAAGIVVALACIVGFTVHQSHKNLVTVQTGKTAR |
| Ga0207710_107431051 | 3300025900 | Switchgrass Rhizosphere | MSTWKKIAIGAIVVVLLASMIGFTVYRSHKNVVVVQT |
| Ga0207700_120354801 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MKLWKKITIGAGVLVLLALIVGISVHQSGKNVATVQTGKALHED |
| Ga0207711_115349721 | 3300025941 | Switchgrass Rhizosphere | MSTWKKIAIGAIVVVLLASMIGFTVYRSHKNVVVVQTAKAKT |
| Ga0209158_10712082 | 3300026333 | Soil | MKTWKKIAIGAGVAVLLFVIVGFTVYQSRKNVVTVQT |
| Ga0209161_101899931 | 3300026548 | Soil | MVTAIMKPWKKIVIGIGALLLVVAIVGFTVHQSSK |
| Ga0207740_10323392 | 3300027011 | Tropical Forest Soil | MKAWKKVAIGAGIAVLLAIMVGFTVHQSSKNVVTVQTGKI |
| Ga0208238_10161141 | 3300027072 | Forest Soil | MKLWKKIAIAAGVVVLLAIMVGFTVYQSGKNVVTVQTGKV |
| Ga0208241_10409592 | 3300027297 | Forest Soil | MKAWKKVAIGAGVAVLLAIFVSASVLQSRKNVATVQTGKVQRQDLAT |
| Ga0209525_10178191 | 3300027575 | Forest Soil | MKPWKKIAIGAGVVVLLAIIVGITVSQSGKNVATVQTGKV |
| Ga0209009_10114473 | 3300027667 | Forest Soil | MKPWKKIAIGAGVVVLLAIVVGITVHQSGKNVVTVQTGKVERQ |
| Ga0209009_11609171 | 3300027667 | Forest Soil | MVTGAMKLWKKIAIGGGVAVLLAAIVGFTVYQSGKN |
| Ga0209038_101548372 | 3300027737 | Bog Forest Soil | MKPWKKIAIGAGVVVLLAIIVGTTVHQSGKNVVTVQ |
| Ga0209060_101144211 | 3300027826 | Surface Soil | MKTWKKAAIGVGAGLLLAAIVGFTVYQSRKNVVTV |
| Ga0209180_104496561 | 3300027846 | Vadose Zone Soil | MKPWKKIAIGVGVVVVLAIIVGITVHQSGKNVSTVQT |
| Ga0209693_100723942 | 3300027855 | Soil | MKAWKKVAIGAGVAVLFAIIVGYTVHQSSKNVATVQT |
| Ga0209693_106150721 | 3300027855 | Soil | MKTWKKIAIGGGAVVLLAAIVGFTVYQSHKNVVTVQTG |
| Ga0209701_105735992 | 3300027862 | Vadose Zone Soil | MVTEIMKPWKKIAIGVGVVVVLAIIVGITVHQSGKN |
| Ga0209283_106504461 | 3300027875 | Vadose Zone Soil | MVTEIMKPWKKIAIGVGVVVVLAIIVGITVHQSGKNVSTVQTGKAQRQD |
| Ga0209275_107874761 | 3300027884 | Soil | MKPWKKIAIGAGVVVLLAIIVGITVHQSGKNVVTVQTGK |
| Ga0209380_106112321 | 3300027889 | Soil | MKLWKKIAIGVGVAVVLAAIVGFTVYQSGKNVVTVQ |
| Ga0209006_100631361 | 3300027908 | Forest Soil | MVAGVMKPWKKIAIGAGIAVLLAIIVGFTVHQSSKNVTTVQTGK |
| Ga0209698_113383661 | 3300027911 | Watersheds | MTTWKKVAIGAGAAVVLSAVAGFAVYQSHKNVVTVQT |
| Ga0268264_103111141 | 3300028381 | Switchgrass Rhizosphere | MSTWKKIAIGAIVVVLLASMIGFTVYRSHKNVVVVQTAK |
| Ga0311353_113978422 | 3300030399 | Palsa | MKPWKKIAIGAGVALLLVAIVSFTVHQSAKNVVTVQ |
| Ga0302192_101547532 | 3300030507 | Bog | MKPWKKIAIGIGVLLVLVIVVGVTVHQSGKNVATVQTGKTLRQDLSSVV |
| Ga0311345_101228823 | 3300030688 | Bog | MKPWKKIAIGAGVMVLLAIIVGITVHQSGKNVVTVQTGKVQ |
| Ga0265770_11458501 | 3300030878 | Soil | MKPWKKIAIGAGAALLLIAIVAFTVHQSAKNVVTVQTGKVQRE |
| Ga0302314_106075991 | 3300030906 | Palsa | VTETMKPWKKIAIGAGVVVLLAIIVGITVHQSGKNVVT |
| Ga0073994_120260231 | 3300030991 | Soil | MKTWKKITIGIGAALVLAIIVGITVHQSGKNVVTVQSGTVQR |
| Ga0170824_1022096571 | 3300031231 | Forest Soil | MKAWKKVAIGVGIAVLLAMIVGFTVHQSSKNVVTVQTGKV |
| Ga0302307_102237162 | 3300031233 | Palsa | MKPWKIIAIGAGAALLLVGSVWLMVLQSRKSVVTVQTGKVQREDLATVVSAS |
| Ga0302324_1008734101 | 3300031236 | Palsa | MKLWKKIASAAGVVVLLAIMVGFTVQQSGKNVVTV |
| Ga0170818_1132127091 | 3300031474 | Forest Soil | MKAWKKIAIGVAIVLGIASMVWFTVHQSSKNVVTVQTGKAQRLDL |
| Ga0302320_114438391 | 3300031524 | Bog | MKAWKKIAIGVGVVLLLAVVAGITVRQSGKNVVTVQTGKVQRLDLASVV |
| Ga0310686_1122942111 | 3300031708 | Soil | MKLWKKIAIGGGVAVLLAAIVGFTVYQSGKNVVTVQT |
| Ga0307476_104155401 | 3300031715 | Hardwood Forest Soil | MVAETMKTWKKIAIGAGVVAVLALMVGISVHQSGKNVVTIQTGKVQRQDLSSVV |
| Ga0307476_108631532 | 3300031715 | Hardwood Forest Soil | MKTWKKIAIGVGAVVLVSAIVGFTVYQSHKNVVTVQTGK |
| Ga0307474_102615771 | 3300031718 | Hardwood Forest Soil | MKTWKKIAIGVGVVAVLAIIVGVSVHQSGKNVFTVQSGRVQ |
| Ga0307469_120594781 | 3300031720 | Hardwood Forest Soil | MKTWKKILIGVGAVLLLAVIVAFTVHQSSKNVVTVQTAKVQRQ |
| Ga0307475_102146042 | 3300031754 | Hardwood Forest Soil | MKTWKKIAIGVGVVAVLAIIVGVSVHQSGKNVFTVQSG |
| Ga0307478_101537131 | 3300031823 | Hardwood Forest Soil | MKPWKKIAIGAGVVVVLAIIVGITVHQSGKNVVTVQTGK |
| Ga0310910_113952241 | 3300031946 | Soil | MRNGRKLAVGAGAILLLGAIAAFTVYQSHKNVVTVETS |
| Ga0307479_109871161 | 3300031962 | Hardwood Forest Soil | MSTWKKIAIGAGAVVLLSAIVGFTVYQSHKNVVTVQSGKAQRMD |
| Ga0307471_1043094672 | 3300032180 | Hardwood Forest Soil | MKLWKKIAIGAGVAALLAIIVGFTVYQSGKNVVTVQT |
| Ga0335081_122059982 | 3300032892 | Soil | MKSWKKVAIGSGVALVLTVIVVFTVYQSRKNVATVQTAKAQREDLAS |
| Ga0335077_116182491 | 3300033158 | Soil | MKAWKKVAIGAGIAVVLAIIVGFTVHQSSKNVATVQTGKAL |
| Ga0370514_086528_652_795 | 3300034199 | Untreated Peat Soil | MKAWKKIAIGVGIAVGLAIIVGFTVSQSGKNVVTVQTGKLQRQDLATV |
| ⦗Top⦘ |